F357449

General Info

Members Datasets Scaffolds Average Seq Length
245 135 245 269

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10049981|Ga0207698_100499811
Length 312
Sequence MPFASRGRSHVSRDWPGPRYVPGGGSTLLGKITRALRPRGRTVIYMLSKDSHLSDQELLLAADGELPPVRAAQVASHLARCWTCRVRRGEIEESIGDLVRAYRRNLDPLLPSATGPRALLKAQLAEMTTEMASTPRVWRAWSSRFATVGYAGAALFVATLALLIYFSPEFPARQSFPVVPVSFPEPSLTPGVAIAVNPEQVCHSTGLKNRIVPASLQRRVFEEYGIAGAEPRAYEVDYLITPALGGADDIRNLWPQSYSSAVWNARVKDALEDRLRDLVCQGHLDLATAQQDISSDWIAAYKKYFHTDRPLQ

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.45
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10078932 3300003320 Bacteria 8417
2 Ga0070658_10221507 3300005327 Unclassified 1600
3 Ga0070683_100000371 3300005329 Bacteria 31146
4 Ga0070683_100007559 3300005329 Bacteria 9187
5 Ga0070683_100013365 3300005329 Bacteria 7157
6 Ga0070683_100018116 3300005329 Bacteria 6232
7 Ga0070683_100303555 3300005329 Bacteria 1519
8 Ga0068869_100138621 3300005334 Bacteria 1876
9 Ga0070666_10009128 3300005335 Bacteria 6183
10 Ga0070680_100002113 3300005336 Bacteria 14671
11 Ga0070680_100122655 3300005336 Unclassified 2170
12 Ga0068868_100024152 3300005338 Bacteria 4609
13 Ga0070660_100011370 3300005339 Bacteria 6320
14 Ga0070661_100161278 3300005344 Bacteria 1698
15 Ga0070667_100139326 3300005367 Bacteria 2123
16 Ga0070709_10167624 3300005434 Bacteria 1532
17 Ga0070713_100008959 3300005436 Bacteria 7131
18 Ga0070713_100027958 3300005436 Unclassified 4448
19 Ga0070713_100423938 3300005436 Unclassified 1246
20 Ga0070711_100143340 3300005439 Bacteria 1794
21 Ga0070711_100143937 3300005439 Unclassified 1791
22 Ga0070663_100392666 3300005455 Unclassified 1132
23 Ga0070681_10003648 3300005458 Bacteria 14448
24 Ga0070681_10049890 3300005458 Unclassified 4177
25 Ga0070681_10056280 3300005458 Unclassified 3915
26 Ga0070681_10125963 3300005458 Bacteria 2494
27 Ga0068867_100076881 3300005459 Bacteria 2507
28 Ga0068867_100127263 3300005459 Unclassified 1975
29 Ga0070679_100021210 3300005530 Bacteria 6339
30 Ga0070679_100070367 3300005530 Bacteria 3491
31 Ga0070679_100218728 3300005530 Bacteria 1866
32 Ga0070684_100126565 3300005535 Bacteria 2302
33 Ga0070684_100332268 3300005535 Bacteria 1397
34 Ga0068853_100067129 3300005539 Bacteria 3116
35 Ga0070665_100002019 3300005548 Bacteria 22824
36 Ga0070665_100013468 3300005548 Bacteria 8227
37 Ga0070665_100195087 3300005548 Bacteria 2026
38 Ga0068855_100017580 3300005563 Bacteria 8599
39 Ga0068855_100083986 3300005563 Bacteria 3688
40 Ga0068855_100255616 3300005563 Unclassified 1953
41 Ga0068855_100373309 3300005563 Bacteria 1567
42 Ga0068857_100004454 3300005577 Bacteria 11836
43 Ga0068857_100006293 3300005577 Bacteria 10158
44 Ga0068857_100013573 3300005577 Bacteria 7097
45 Ga0068854_100088182 3300005578 Bacteria 2303
46 Ga0068856_100000321 3300005614 Bacteria 52621
47 Ga0068856_100338470 3300005614 Bacteria 1523
48 Ga0068859_100096388 3300005617 Unclassified 3011
49 Ga0068858_100041827 3300005842 Bacteria 4248
50 Ga0081455_10032938 3300005937 Unclassified 4662
51 Ga0070717_10255494 3300006028 Bacteria 1549
52 Ga0097621_100016761 3300006237 Bacteria 5549
53 Ga0097621_100125507 3300006237 Bacteria 2180
54 Ga0068871_100009925 3300006358 Bacteria 6914
55 Ga0068871_100049373 3300006358 Bacteria 3401
56 Ga0068871_100223822 3300006358 Bacteria 1631
57 Ga0068865_100002593 3300006881 Bacteria 10734
58 Ga0097620_100096389 3300006931 Unclassified 3011
59 Ga0105240_10000780 3300009093 Bacteria 57653
60 Ga0105240_10004980 3300009093 Bacteria 19954
61 Ga0105240_10023146 3300009093 Bacteria 8225
62 Ga0105240_10038788 3300009093 Bacteria 6107
63 Ga0105240_10076252 3300009093 Bacteria 4133
64 Ga0105240_10106931 3300009093 Unclassified 3392
65 Ga0105240_10108037 3300009093 Bacteria 3371
66 Ga0105240_10594493 3300009093 Unclassified 1219
67 Ga0105245_10004029 3300009098 Bacteria 13069
68 Ga0105245_10012957 3300009098 Bacteria 7269
69 Ga0105245_10040185 3300009098 Bacteria 4166
70 Ga0105245_10138429 3300009098 Bacteria 2290
71 Ga0105245_10237511 3300009098 Unclassified 1765
72 Ga0105247_10088120 3300009101 Bacteria 1966
73 Ga0105243_10056176 3300009148 Bacteria 3129
74 Ga0105241_10002749 3300009174 Bacteria 13189
75 Ga0105241_10106906 3300009174 Bacteria 2234
76 Ga0105241_10150382 3300009174 Unclassified 1904
77 Ga0105242_10001181 3300009176 Bacteria 20568
78 Ga0105242_10002976 3300009176 Bacteria 13263
79 Ga0105242_10020818 3300009176 Bacteria 5145
80 Ga0105248_10038602 3300009177 Bacteria 5346
81 Ga0105248_10057336 3300009177 Bacteria 4372
82 Ga0105248_10058891 3300009177 Bacteria 4314
83 Ga0105248_10132360 3300009177 Bacteria 2814
84 Ga0105248_10134642 3300009177 Bacteria 2788
85 Ga0105237_10001374 3300009545 Bacteria 32109
86 Ga0105237_10001475 3300009545 Bacteria 31009
87 Ga0105237_10006068 3300009545 Bacteria 13516
88 Ga0105237_10044606 3300009545 Unclassified 4465
89 Ga0105237_10094146 3300009545 Unclassified 2985
90 Ga0105237_10413548 3300009545 Bacteria 1354
91 Ga0105238_10002509 3300009551 Bacteria 18367
92 Ga0105238_10010027 3300009551 Bacteria 9500
93 Ga0105238_10033083 3300009551 Bacteria 5261
94 Ga0105238_10039568 3300009551 Bacteria 4781
95 Ga0105238_10340438 3300009551 Bacteria 1488
96 Ga0105249_10052928 3300009553 Bacteria 3709
97 Ga0105239_10005217 3300010375 Bacteria 15292
98 Ga0105239_10127871 3300010375 Bacteria 2825
99 Ga0105246_10062297 3300011119 Bacteria 2598
100 Ga0157373_10273727 3300013100 Unclassified 1196
101 Ga0157370_10001518 3300013104 Bacteria 28705
102 Ga0157370_10004491 3300013104 Bacteria 15988
103 Ga0157370_10116410 3300013104 Bacteria 2497
104 Ga0157369_10000962 3300013105 Bacteria 36547
105 Ga0157369_10003744 3300013105 Bacteria 18069
106 Ga0157369_10004520 3300013105 Bacteria 16370
107 Ga0157369_10044262 3300013105 Bacteria 4847
108 Ga0157369_10127042 3300013105 Unclassified 2702
109 Ga0157374_10060028 3300013296 Bacteria 3558
110 Ga0157374_10275121 3300013296 Unclassified 1661
111 Ga0163162_10402828 3300013306 Bacteria 1501
112 Ga0163162_10443750 3300013306 Bacteria 1430
113 Ga0157372_10000562 3300013307 Bacteria 40924
114 Ga0157372_10002501 3300013307 Bacteria 19939
115 Ga0157372_10013602 3300013307 Bacteria 8698
116 Ga0157372_10089359 3300013307 Bacteria 3500
117 Ga0163163_10013956 3300014325 Bacteria 7372
118 Ga0163163_10079501 3300014325 Bacteria 3277
119 Ga0157379_10050051 3300014968 Bacteria 3729
120 Ga0157379_10151202 3300014968 Unclassified 2094
121 Ga0157376_10008200 3300014969 Bacteria 7518
122 Ga0157376_10606614 3300014969 Bacteria 1090
123 Ga0213872_10098465 3300021361 Unclassified 1305
124 Ga0213875_10055286 3300021388 Unclassified 1859
125 Ga0207710_10044746 3300025900 Bacteria 1972
126 Ga0207647_10018948 3300025904 Bacteria 4637
127 Ga0207699_10110777 3300025906 Bacteria 1759
128 Ga0207705_10000703 3300025909 Bacteria 27614
129 Ga0207654_10004427 3300025911 Bacteria 7087
130 Ga0207707_10000564 3300025912 Bacteria 37587
131 Ga0207707_10014034 3300025912 Bacteria 6983
132 Ga0207707_10084073 3300025912 Bacteria 2779
133 Ga0207707_10163160 3300025912 Unclassified 1948
134 Ga0207695_10000793 3300025913 Bacteria 59366
135 Ga0207695_10008060 3300025913 Bacteria 13261
136 Ga0207695_10067486 3300025913 Unclassified 3669
137 Ga0207695_10072417 3300025913 Bacteria 3516
138 Ga0207671_10003208 3300025914 Bacteria 16468
139 Ga0207671_10009900 3300025914 Bacteria 7923
140 Ga0207671_10048888 3300025914 Bacteria 3130
141 Ga0207671_10073260 3300025914 Bacteria 2558
142 Ga0207663_10119236 3300025916 Bacteria 1804
143 Ga0207660_10406216 3300025917 Bacteria 1097
144 Ga0207657_10032131 3300025919 Unclassified 4745
145 Ga0207657_10045293 3300025919 Bacteria 3862
146 Ga0207657_10285144 3300025919 Bacteria 1310
147 Ga0207649_10240490 3300025920 Bacteria 1299
148 Ga0207694_10000901 3300025924 Bacteria 26253
149 Ga0207694_10001417 3300025924 Bacteria 20545
150 Ga0207694_10021325 3300025924 Bacteria 4908
151 Ga0207694_10414904 3300025924 Unclassified 1121
152 Ga0207687_10001282 3300025927 Bacteria 17189
153 Ga0207687_10005244 3300025927 Bacteria 8594
154 Ga0207687_10274113 3300025927 Bacteria 1350
155 Ga0207700_10042963 3300025928 Bacteria 3318
156 Ga0207700_10081682 3300025928 Bacteria 2525
157 Ga0207690_10039354 3300025932 Bacteria 3084
158 Ga0207686_10093114 3300025934 Bacteria 1994
159 Ga0207704_10001769 3300025938 Bacteria 9672
160 Ga0207704_10094080 3300025938 Bacteria 1978
161 Ga0207711_10003810 3300025941 Bacteria 12972
162 Ga0207711_10134749 3300025941 Bacteria 2218
163 Ga0207711_10311969 3300025941 Bacteria 1452
164 Ga0207711_10312584 3300025941 Bacteria 1451
165 Ga0207661_10005998 3300025944 Bacteria 8580
166 Ga0207661_10006339 3300025944 Bacteria 8367
167 Ga0207661_10129856 3300025944 Bacteria 2156
168 Ga0207661_10308593 3300025944 Bacteria 1420
169 Ga0207661_10313219 3300025944 Bacteria 1409
170 Ga0207667_10000530 3300025949 Bacteria 50307
171 Ga0207667_10000702 3300025949 Bacteria 43396
172 Ga0207667_10031905 3300025949 Bacteria 5681
173 Ga0207658_10096124 3300025986 Bacteria 2310
174 Ga0207658_10179508 3300025986 Unclassified 1751
175 Ga0207677_10275867 3300026023 Unclassified 1378
176 Ga0207703_10016415 3300026035 Bacteria 5773
177 Ga0207678_10115599 3300026067 Bacteria 2289
178 Ga0207702_10004842 3300026078 Bacteria 11857
179 Ga0207702_10155801 3300026078 Unclassified 2082
180 Ga0207676_10253692 3300026095 Bacteria 1585
181 Ga0207674_10001356 3300026116 Bacteria 31674
182 Ga0207674_10013793 3300026116 Bacteria 8940
183 Ga0207674_10029885 3300026116 Bacteria 5733
184 Ga0207674_10091991 3300026116 Bacteria 3023
185 Ga0207698_10049981 3300026142 Unclassified 3187
186 Ga0265354_1000127 3300028016 Bacteria 13408
187 Ga0268266_10012348 3300028379 Bacteria 7388
188 Ga0268266_10048433 3300028379 Bacteria 3643
189 Ga0265338_10020898 3300028800 Bacteria 6855
190 Ga0265762_1005444 3300030760 Bacteria 2282
191 Ga0265765_1000082 3300030879 Bacteria 5080
192 Ga0265760_10002575 3300031090 Bacteria 5298
193 Ga0265332_10030820 3300031238 Unclassified 2341
194 Ga0265325_10030812 3300031241 Unclassified 2875
195 Ga0265325_10158431 3300031241 Unclassified 1066
196 Ga0265340_10081353 3300031247 Unclassified 1525
197 Ga0265340_10161071 3300031247 Unclassified 1019
198 Ga0265313_10109566 3300031595 Unclassified 1216
199 Ga0265314_10004252 3300031711 Bacteria 13420
200 Ga0265314_10007228 3300031711 Bacteria 9655
201 Ga0307510_10091415 3300033180 Bacteria 2886
202 Ga0316212_1000317 3300033547 Bacteria 5704
203 Ga0373954_0099310 3300035118 Unclassified 1403
204 Ga0373956_0020745 3300035119 Bacteria 2799
205 Ga0373957_0020633 3300035120 Bacteria 2330
206 Ga0373933_0069570 3300035724 Bacteria 2140
207 Ga0373937_0103543 3300036401 Unclassified 2643
208 Ga0373937_0123064 3300036401 Bacteria 2418
209 Ga0373937_0715425 3300036401 Bacteria 948
210 Ga0395905_0205227 3300037471 Bacteria 1847
211 Ga0436365_1714757 3300039437 Bacteria 3725
212 Ga0436361_1032362 3300039447 Bacteria 3507
213 Ga0451576_0137764 3300045051 Bacteria 2546
214 Ga0451576_0167346 3300045051 Bacteria 2294
215 Ga0495651_0329576 3300046462 Bacteria 1015
216 Ga0495628_0170597 3300046516 Bacteria 1650
217 Ga0495652_0025023 3300046529 Bacteria 5283
218 Ga0495586_0228230 3300046535 Unclassified 1059
219 Ga0495587_0000289 3300046536 Bacteria 35652
220 Ga0495634_0071781 3300046642 Bacteria 2278
221 Ga0495599_0045161 3300046678 Bacteria 2762
222 Ga0495658_0052967 3300046683 Bacteria 2303
223 Ga0495674_0311729 3300047319 Unclassified 1284
224 Ga0495680_0045923 3300047322 Bacteria 3447
225 Ga0495684_0034382 3300047471 Bacteria 3889
226 Ga0495602_0062068 3300048088 Unclassified 3244
227 Ga0496102_0185536 3300048905 Unclassified 1960
228 Ga0496104_0098762 3300048907 Bacteria 2795
229 Ga0496112_0045953 3300048915 Bacteria 4281
230 Ga0496114_0014176 3300048917 Bacteria 6394
231 Ga0496115_0010281 3300048918 Bacteria 6986
232 Ga0496115_0116316 3300048918 Bacteria 2199
233 Ga0496126_0000285 3300048929 Bacteria 106970
234 Ga0495682_0099655 3300049460 Bacteria 1042
235 Ga0501033_0111486 3300049570 Unclassified 1991
236 Ga0501034_0023314 3300049571 Bacteria 6307
237 Ga0501034_0413195 3300049571 Unclassified 1271
238 Ga0501037_0112234 3300049573 Bacteria 1963
239 Ga0501043_0464599 3300049579 Bacteria 949
240 Ga0501046_0287378 3300049580 Unclassified 1203
241 Ga0501047_0121673 3300049581 Bacteria 2491
242 Ga0501048_0318843 3300049582 Unclassified 1107
243 Ga0501070_0022779 3300049586 Bacteria 5243
244 Ga0501073_0102322 3300049589 Bacteria 1989
245 Ga0466962_0153076 3300061719 Bacteria 1119

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10606614 Ga0157376_106066141 196
2 3300013306 Ga0163162_10443750 Ga0163162_104437502 205
3 3300005548 Ga0070665_100013468 Ga0070665_1000134682 214
4 3300025938 Ga0207704_10094080 Ga0207704_100940802 214
5 3300028379 Ga0268266_10048433 Ga0268266_100484332 214
6 3300005436 Ga0070713_100008959 Ga0070713_1000089598 218
7 3300025928 Ga0207700_10042963 Ga0207700_100429634 218
8 3300025913 Ga0207695_10067486 Ga0207695_100674864 228
9 3300035118 Ga0373954_0099310 Ga0373954_0099310_520_1323 228
10 3300035119 Ga0373956_0020745 Ga0373956_0020745_1007_1810 228
11 3300035120 Ga0373957_0020633 Ga0373957_0020633_699_1502 228
12 3300035724 Ga0373933_0069570 Ga0373933_0069570_1253_2056 228
13 3300036401 Ga0373937_0123064 Ga0373937_0123064_812_1615 228
14 3300046535 Ga0495586_0228230 Ga0495586_0228230_162_965 228
15 3300048905 Ga0496102_0185536 Ga0496102_0185536_576_1499 229
16 3300049571 Ga0501034_0413195 Ga0501034_0413195_393_1196 233
17 3300005459 Ga0068867_100076881 Ga0068867_1000768813 234
18 3300005459 Ga0068867_100127263 Ga0068867_1001272632 237
19 3300006237 Ga0097621_100125507 Ga0097621_1001255073 237
20 3300048929 Ga0496126_0000285 Ga0496126_0000285_70033_70860 237
21 3300009093 Ga0105240_10038788 Ga0105240_100387882 238
22 3300009545 Ga0105237_10094146 Ga0105237_100941463 238
23 3300037471 Ga0395905_0205227 Ga0395905_0205227_180_992 238
24 3300033180 Ga0307510_10091415 Ga0307510_100914153 239
25 3300048915 Ga0496112_0045953 Ga0496112_0045953_211_1134 239
26 3300049460 Ga0495682_0099655 Ga0495682_0099655_142_969 239
27 3300005434 Ga0070709_10167624 Ga0070709_101676242 240
28 3300005436 Ga0070713_100423938 Ga0070713_1004239382 240
29 3300005439 Ga0070711_100143340 Ga0070711_1001433402 240
30 3300009098 Ga0105245_10138429 Ga0105245_101384292 240
31 3300009148 Ga0105243_10056176 Ga0105243_100561762 240
32 3300025906 Ga0207699_10110777 Ga0207699_101107772 240
33 3300025916 Ga0207663_10119236 Ga0207663_101192362 240
34 3300025927 Ga0207687_10274113 Ga0207687_102741132 240
35 3300026023 Ga0207677_10275867 Ga0207677_102758672 240
36 3300031247 Ga0265340_10081353 Ga0265340_100813532 240
37 3300031711 Ga0265314_10004252 Ga0265314_100042523 240
38 3300031711 Ga0265314_10007228 Ga0265314_100072286 240
39 3300036401 Ga0373937_0715425 Ga0373937_0715425_139_903 240
40 3300005329 Ga0070683_100007559 Ga0070683_1000075598 241
41 3300005458 Ga0070681_10056280 Ga0070681_100562805 241
42 3300005530 Ga0070679_100070367 Ga0070679_1000703675 241
43 3300005563 Ga0068855_100083986 Ga0068855_1000839863 241
44 3300005577 Ga0068857_100004454 Ga0068857_1000044548 241
45 3300009093 Ga0105240_10106931 Ga0105240_101069312 241
46 3300009551 Ga0105238_10010027 Ga0105238_100100276 241
47 3300013307 Ga0157372_10013602 Ga0157372_100136026 241
48 3300021388 Ga0213875_10055286 Ga0213875_100552862 241
49 3300025912 Ga0207707_10163160 Ga0207707_101631604 241
50 3300025924 Ga0207694_10021325 Ga0207694_100213256 241
51 3300025944 Ga0207661_10129856 Ga0207661_101298563 241
52 3300026116 Ga0207674_10013793 Ga0207674_100137936 241
53 3300048918 Ga0496115_0116316 Ga0496115_0116316_1331_2152 241
54 3300005327 Ga0070658_10221507 Ga0070658_102215072 242
55 3300005329 Ga0070683_100000371 Ga0070683_10000037112 242
56 3300005329 Ga0070683_100013365 Ga0070683_1000133655 242
57 3300005336 Ga0070680_100002113 Ga0070680_1000021134 242
58 3300005436 Ga0070713_100027958 Ga0070713_1000279582 242
59 3300005439 Ga0070711_100143937 Ga0070711_1001439372 242
60 3300005458 Ga0070681_10003648 Ga0070681_100036485 242
61 3300005535 Ga0070684_100332268 Ga0070684_1003322682 242
62 3300005563 Ga0068855_100017580 Ga0068855_1000175802 242
63 3300005563 Ga0068855_100255616 Ga0068855_1002556162 242
64 3300005614 Ga0068856_100000321 Ga0068856_10000032128 242
65 3300005614 Ga0068856_100338470 Ga0068856_1003384702 242
66 3300006028 Ga0070717_10255494 Ga0070717_102554942 242
67 3300006358 Ga0068871_100223822 Ga0068871_1002238221 242
68 3300009093 Ga0105240_10000780 Ga0105240_1000078026 242
69 3300009093 Ga0105240_10004980 Ga0105240_100049806 242
70 3300009098 Ga0105245_10004029 Ga0105245_1000402912 242
71 3300009098 Ga0105245_10012957 Ga0105245_100129572 242
72 3300009098 Ga0105245_10237511 Ga0105245_102375112 242
73 3300009174 Ga0105241_10002749 Ga0105241_100027495 242
74 3300009174 Ga0105241_10150382 Ga0105241_101503822 242
75 3300009545 Ga0105237_10001374 Ga0105237_100013749 242
76 3300009545 Ga0105237_10001475 Ga0105237_1000147510 242
77 3300009545 Ga0105237_10044606 Ga0105237_100446063 242
78 3300009551 Ga0105238_10002509 Ga0105238_1000250910 242
79 3300009551 Ga0105238_10039568 Ga0105238_100395683 242
80 3300009553 Ga0105249_10052928 Ga0105249_100529282 242
81 3300010375 Ga0105239_10005217 Ga0105239_100052179 242
82 3300011119 Ga0105246_10062297 Ga0105246_100622973 242
83 3300013104 Ga0157370_10001518 Ga0157370_100015183 242
84 3300013104 Ga0157370_10004491 Ga0157370_100044914 242
85 3300013105 Ga0157369_10000962 Ga0157369_100009629 242
86 3300013105 Ga0157369_10003744 Ga0157369_1000374416 242
87 3300013105 Ga0157369_10004520 Ga0157369_1000452011 242
88 3300013105 Ga0157369_10127042 Ga0157369_101270422 242
89 3300013307 Ga0157372_10000562 Ga0157372_1000056212 242
90 3300013307 Ga0157372_10002501 Ga0157372_1000250116 242
91 3300025911 Ga0207654_10004427 Ga0207654_100044274 242
92 3300025912 Ga0207707_10000564 Ga0207707_1000056411 242
93 3300025913 Ga0207695_10000793 Ga0207695_1000079326 242
94 3300025913 Ga0207695_10008060 Ga0207695_1000806014 242
95 3300025914 Ga0207671_10003208 Ga0207671_100032084 242
96 3300025914 Ga0207671_10009900 Ga0207671_100099003 242
97 3300025919 Ga0207657_10032131 Ga0207657_100321313 242
98 3300025924 Ga0207694_10000901 Ga0207694_1000090116 242
99 3300025924 Ga0207694_10001417 Ga0207694_100014175 242
100 3300025924 Ga0207694_10414904 Ga0207694_104149042 242
101 3300025927 Ga0207687_10001282 Ga0207687_1000128214 242
102 3300025927 Ga0207687_10005244 Ga0207687_100052442 242
103 3300025928 Ga0207700_10081682 Ga0207700_100816823 242
104 3300025941 Ga0207711_10003810 Ga0207711_100038102 242
105 3300025944 Ga0207661_10005998 Ga0207661_100059984 242
106 3300025944 Ga0207661_10006339 Ga0207661_100063393 242
107 3300025949 Ga0207667_10000530 Ga0207667_1000053012 242
108 3300025949 Ga0207667_10000702 Ga0207667_1000070240 242
109 3300025986 Ga0207658_10179508 Ga0207658_101795082 242
110 3300026078 Ga0207702_10004842 Ga0207702_100048423 242
111 3300026078 Ga0207702_10155801 Ga0207702_101558012 242
112 3300026116 Ga0207674_10001356 Ga0207674_100013565 242
113 3300026142 Ga0207698_10049981 Ga0207698_100499811 242
114 3300031241 Ga0265325_10158431 Ga0265325_101584312 242
115 3300031247 Ga0265340_10161071 Ga0265340_101610712 242
116 3300036401 Ga0373937_0103543 Ga0373937_0103543_422_1225 242
117 3300046462 Ga0495651_0329576 Ga0495651_0329576_39_842 242
118 3300046516 Ga0495628_0170597 Ga0495628_0170597_469_1272 242
119 3300046529 Ga0495652_0025023 Ga0495652_0025023_1178_1981 242
120 3300046536 Ga0495587_0000289 Ga0495587_0000289_30762_31565 242
121 3300046678 Ga0495599_0045161 Ga0495599_0045161_621_1424 242
122 3300047322 Ga0495680_0045923 Ga0495680_0045923_810_1613 242
123 3300047471 Ga0495684_0034382 Ga0495684_0034382_1294_2097 242
124 3300048088 Ga0495602_0062068 Ga0495602_0062068_765_1568 242
125 3300005334 Ga0068869_100138621 Ga0068869_1001386212 243
126 3300005335 Ga0070666_10009128 Ga0070666_100091283 243
127 3300005338 Ga0068868_100024152 Ga0068868_1000241522 243
128 3300005367 Ga0070667_100139326 Ga0070667_1001393262 243
129 3300005548 Ga0070665_100002019 Ga0070665_10000201915 243
130 3300005842 Ga0068858_100041827 Ga0068858_1000418273 243
131 3300006358 Ga0068871_100049373 Ga0068871_1000493732 243
132 3300009093 Ga0105240_10108037 Ga0105240_101080372 243
133 3300009098 Ga0105245_10040185 Ga0105245_100401852 243
134 3300009176 Ga0105242_10002976 Ga0105242_100029769 243
135 3300009177 Ga0105248_10038602 Ga0105248_100386022 243
136 3300013296 Ga0157374_10060028 Ga0157374_100600282 243
137 3300014968 Ga0157379_10050051 Ga0157379_100500512 243
138 3300014969 Ga0157376_10008200 Ga0157376_100082003 243
139 3300025986 Ga0207658_10096124 Ga0207658_100961242 243
140 3300026035 Ga0207703_10016415 Ga0207703_100164153 243
141 3300026095 Ga0207676_10253692 Ga0207676_102536922 243
142 3300028379 Ga0268266_10012348 Ga0268266_100123483 243
143 3300048907 Ga0496104_0098762 Ga0496104_0098762_487_1323 243
144 3300048917 Ga0496114_0014176 Ga0496114_0014176_2091_2927 243
145 3300048918 Ga0496115_0010281 Ga0496115_0010281_3848_4684 243
146 3300031238 Ga0265332_10030820 Ga0265332_100308203 244
147 3300005329 Ga0070683_100303555 Ga0070683_1003035552 245
148 3300006237 Ga0097621_100016761 Ga0097621_1000167612 245
149 3300006358 Ga0068871_100009925 Ga0068871_1000099253 245
150 3300006881 Ga0068865_100002593 Ga0068865_1000025934 245
151 3300009093 Ga0105240_10023146 Ga0105240_100231467 245
152 3300009176 Ga0105242_10001181 Ga0105242_1000118110 245
153 3300009177 Ga0105248_10058891 Ga0105248_100588914 245
154 3300009545 Ga0105237_10006068 Ga0105237_1000606810 245
155 3300009551 Ga0105238_10340438 Ga0105238_103404382 245
156 3300010375 Ga0105239_10127871 Ga0105239_101278712 245
157 3300025914 Ga0207671_10048888 Ga0207671_100488883 245
158 3300025934 Ga0207686_10093114 Ga0207686_100931141 245
159 3300025938 Ga0207704_10001769 Ga0207704_100017695 245
160 3300025941 Ga0207711_10312584 Ga0207711_103125842 245
161 3300025944 Ga0207661_10308593 Ga0207661_103085932 245
162 3300049570 Ga0501033_0111486 Ga0501033_0111486_754_1542 245
163 3300049571 Ga0501034_0023314 Ga0501034_0023314_699_1487 245
164 3300049573 Ga0501037_0112234 Ga0501037_0112234_357_1145 245
165 3300049579 Ga0501043_0464599 Ga0501043_0464599_64_852 245
166 3300049580 Ga0501046_0287378 Ga0501046_0287378_17_805 245
167 3300049581 Ga0501047_0121673 Ga0501047_0121673_851_1639 245
168 3300049582 Ga0501048_0318843 Ga0501048_0318843_300_1088 245
169 3300049586 Ga0501070_0022779 Ga0501070_0022779_874_1662 245
170 3300049589 Ga0501073_0102322 Ga0501073_0102322_168_956 245
171 3300005617 Ga0068859_100096388 Ga0068859_1000963882 246
172 3300005937 Ga0081455_10032938 Ga0081455_100329384 246
173 3300006931 Ga0097620_100096389 Ga0097620_1000963892 246
174 3300030760 Ga0265762_1005444 Ga0265762_10054442 246
175 3300061719 Ga0466962_0153076 Ga0466962_0153076_282_1070 246
176 3300009545 Ga0105237_10413548 Ga0105237_104135482 248
177 3300013296 Ga0157374_10275121 Ga0157374_102751213 248
178 3300009177 Ga0105248_10134642 Ga0105248_101346422 249
179 3300025941 Ga0207711_10311969 Ga0207711_103119692 249
180 3300009177 Ga0105248_10132360 Ga0105248_101323603 250
181 3300021361 Ga0213872_10098465 Ga0213872_100984652 250
182 3300031090 Ga0265760_10002575 Ga0265760_100025753 250
183 3300039447 Ga0436361_1032362 Ga0436361_1032362_378_1214 250
184 3300005336 Ga0070680_100122655 Ga0070680_1001226553 251
185 3300005458 Ga0070681_10049890 Ga0070681_100498903 251
186 3300005530 Ga0070679_100218728 Ga0070679_1002187283 251
187 3300005548 Ga0070665_100195087 Ga0070665_1001950872 251
188 3300005577 Ga0068857_100013573 Ga0068857_1000135733 251
189 3300009093 Ga0105240_10594493 Ga0105240_105944932 251
190 3300009176 Ga0105242_10020818 Ga0105242_100208183 251
191 3300009177 Ga0105248_10057336 Ga0105248_100573363 251
192 3300013306 Ga0163162_10402828 Ga0163162_104028282 251
193 3300014325 Ga0163163_10079501 Ga0163163_100795013 251
194 3300025912 Ga0207707_10014034 Ga0207707_100140343 251
195 3300025941 Ga0207711_10134749 Ga0207711_101347492 251
196 3300026116 Ga0207674_10029885 Ga0207674_100298853 251
197 3300009174 Ga0105241_10106906 Ga0105241_101069062 252
198 3300028016 Ga0265354_1000127 Ga0265354_10001275 252
199 3300030879 Ga0265765_1000082 Ga0265765_10000823 252
200 3300031595 Ga0265313_10109566 Ga0265313_101095661 252
201 3300033547 Ga0316212_1000317 Ga0316212_10003172 252
202 3300046683 Ga0495658_0052967 Ga0495658_0052967_799_1644 252
203 3300005329 Ga0070683_100018116 Ga0070683_1000181163 254
204 3300005339 Ga0070660_100011370 Ga0070660_1000113703 254
205 3300005344 Ga0070661_100161278 Ga0070661_1001612782 254
206 3300005455 Ga0070663_100392666 Ga0070663_1003926662 254
207 3300005458 Ga0070681_10125963 Ga0070681_101259633 254
208 3300005530 Ga0070679_100021210 Ga0070679_1000212104 254
209 3300005535 Ga0070684_100126565 Ga0070684_1001265651 254
210 3300005539 Ga0068853_100067129 Ga0068853_1000671293 254
211 3300005563 Ga0068855_100373309 Ga0068855_1003733092 254
212 3300005577 Ga0068857_100006293 Ga0068857_1000062931 254
213 3300005578 Ga0068854_100088182 Ga0068854_1000881823 254
214 3300009093 Ga0105240_10076252 Ga0105240_100762522 254
215 3300009551 Ga0105238_10033083 Ga0105238_100330833 254
216 3300013100 Ga0157373_10273727 Ga0157373_102737271 254
217 3300013104 Ga0157370_10116410 Ga0157370_101164102 254
218 3300013105 Ga0157369_10044262 Ga0157369_100442623 254
219 3300013307 Ga0157372_10089359 Ga0157372_100893592 254
220 3300025904 Ga0207647_10018948 Ga0207647_100189484 254
221 3300025909 Ga0207705_10000703 Ga0207705_100007036 254
222 3300025912 Ga0207707_10084073 Ga0207707_100840732 254
223 3300025913 Ga0207695_10072417 Ga0207695_100724173 254
224 3300025914 Ga0207671_10073260 Ga0207671_100732601 254
225 3300025917 Ga0207660_10406216 Ga0207660_104062162 254
226 3300025919 Ga0207657_10045293 Ga0207657_100452933 254
227 3300025919 Ga0207657_10285144 Ga0207657_102851442 254
228 3300025920 Ga0207649_10240490 Ga0207649_102404902 254
229 3300025932 Ga0207690_10039354 Ga0207690_100393542 254
230 3300025944 Ga0207661_10313219 Ga0207661_103132192 254
231 3300025949 Ga0207667_10031905 Ga0207667_100319053 254
232 3300026067 Ga0207678_10115599 Ga0207678_101155993 254
233 3300026116 Ga0207674_10091991 Ga0207674_100919912 254
234 3300039437 Ga0436365_1714757 Ga0436365_1714757_621_1481 255
235 3300047319 Ga0495674_0311729 Ga0495674_0311729_328_1233 257
236 3300045051 Ga0451576_0167346 Ga0451576_0167346_1087_1941 259
237 3300028800 Ga0265338_10020898 Ga0265338_100208987 261
238 3300031241 Ga0265325_10030812 Ga0265325_100308122 261
239 3300009101 Ga0105247_10088120 Ga0105247_100881202 262
240 3300014325 Ga0163163_10013956 Ga0163163_100139563 262
241 3300014968 Ga0157379_10151202 Ga0157379_101512022 262
242 3300025900 Ga0207710_10044746 Ga0207710_100447462 262
243 3300045051 Ga0451576_0137764 Ga0451576_0137764_978_1838 262
244 3300046642 Ga0495634_0071781 Ga0495634_0071781_261_1181 264
245 3300003320 rootH2_10078932 rootH2_100789328 276

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j5s-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8081 203 234
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.7743 2 50
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.7132 6 68
2z2s-assembly2.cif.gz_D crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.7121 1 65
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6823 2 50
ID Description Score Start End Superfamily
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.7743 2 50 1.10.10.1320
2z2sD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.7298 1 63 1.10.10.1320
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6823 2 50 1.10.10.1320
3hugN00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6789 9 66 1.10.10.1320
3hugD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6509 2 66 1.10.10.1320
ID Description Score Start End GO Terms
AF-A0A0E4H316-F1-model_v4 HNH endonuclease 0.9646 165 244
AF-A0A535V259-F1-model_v4 HNH endonuclease 0.9475 174 247
AF-A0A654D9Q9-F1-model_v4 HNH nuclease domain-containing protein 0.9466 172 244
AF-A0A7S7SP79-F1-model_v4 HNH endonuclease 0.9416 135 250 GO:0004519
AF-A0A7C2EKF6-F1-model_v4 HNH endonuclease 0.931 123 247 GO:0004519

Feature Viewer

pLDDT pTM Quality
81.16 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map