F357449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 245 | 135 | 245 | 269 |
Family's Representative Sequence
| Representative Sequence | 3300026142|Ga0207698_10049981|Ga0207698_100499811 |
| Length | 312 |
| Sequence | MPFASRGRSHVSRDWPGPRYVPGGGSTLLGKITRALRPRGRTVIYMLSKDSHLSDQELLLAADGELPPVRAAQVASHLARCWTCRVRRGEIEESIGDLVRAYRRNLDPLLPSATGPRALLKAQLAEMTTEMASTPRVWRAWSSRFATVGYAGAALFVATLALLIYFSPEFPARQSFPVVPVSFPEPSLTPGVAIAVNPEQVCHSTGLKNRIVPASLQRRVFEEYGIAGAEPRAYEVDYLITPALGGADDIRNLWPQSYSSAVWNARVKDALEDRLRDLVCQGHLDLATAQQDISSDWIAAYKKYFHTDRPLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 32 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 55 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 56 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 93 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 94 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 97 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 98 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 99 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 100 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 101 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 102 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 104 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 105 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 106 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 107 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 120 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 121 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 122 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 123 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 124 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 125 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.78 |
| Metatranscriptomes | 1.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.45 |
| Rhizosphere | 95.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10078932 | 3300003320 | Bacteria | 8417 |
| 2 | Ga0070658_10221507 | 3300005327 | Unclassified | 1600 |
| 3 | Ga0070683_100000371 | 3300005329 | Bacteria | 31146 |
| 4 | Ga0070683_100007559 | 3300005329 | Bacteria | 9187 |
| 5 | Ga0070683_100013365 | 3300005329 | Bacteria | 7157 |
| 6 | Ga0070683_100018116 | 3300005329 | Bacteria | 6232 |
| 7 | Ga0070683_100303555 | 3300005329 | Bacteria | 1519 |
| 8 | Ga0068869_100138621 | 3300005334 | Bacteria | 1876 |
| 9 | Ga0070666_10009128 | 3300005335 | Bacteria | 6183 |
| 10 | Ga0070680_100002113 | 3300005336 | Bacteria | 14671 |
| 11 | Ga0070680_100122655 | 3300005336 | Unclassified | 2170 |
| 12 | Ga0068868_100024152 | 3300005338 | Bacteria | 4609 |
| 13 | Ga0070660_100011370 | 3300005339 | Bacteria | 6320 |
| 14 | Ga0070661_100161278 | 3300005344 | Bacteria | 1698 |
| 15 | Ga0070667_100139326 | 3300005367 | Bacteria | 2123 |
| 16 | Ga0070709_10167624 | 3300005434 | Bacteria | 1532 |
| 17 | Ga0070713_100008959 | 3300005436 | Bacteria | 7131 |
| 18 | Ga0070713_100027958 | 3300005436 | Unclassified | 4448 |
| 19 | Ga0070713_100423938 | 3300005436 | Unclassified | 1246 |
| 20 | Ga0070711_100143340 | 3300005439 | Bacteria | 1794 |
| 21 | Ga0070711_100143937 | 3300005439 | Unclassified | 1791 |
| 22 | Ga0070663_100392666 | 3300005455 | Unclassified | 1132 |
| 23 | Ga0070681_10003648 | 3300005458 | Bacteria | 14448 |
| 24 | Ga0070681_10049890 | 3300005458 | Unclassified | 4177 |
| 25 | Ga0070681_10056280 | 3300005458 | Unclassified | 3915 |
| 26 | Ga0070681_10125963 | 3300005458 | Bacteria | 2494 |
| 27 | Ga0068867_100076881 | 3300005459 | Bacteria | 2507 |
| 28 | Ga0068867_100127263 | 3300005459 | Unclassified | 1975 |
| 29 | Ga0070679_100021210 | 3300005530 | Bacteria | 6339 |
| 30 | Ga0070679_100070367 | 3300005530 | Bacteria | 3491 |
| 31 | Ga0070679_100218728 | 3300005530 | Bacteria | 1866 |
| 32 | Ga0070684_100126565 | 3300005535 | Bacteria | 2302 |
| 33 | Ga0070684_100332268 | 3300005535 | Bacteria | 1397 |
| 34 | Ga0068853_100067129 | 3300005539 | Bacteria | 3116 |
| 35 | Ga0070665_100002019 | 3300005548 | Bacteria | 22824 |
| 36 | Ga0070665_100013468 | 3300005548 | Bacteria | 8227 |
| 37 | Ga0070665_100195087 | 3300005548 | Bacteria | 2026 |
| 38 | Ga0068855_100017580 | 3300005563 | Bacteria | 8599 |
| 39 | Ga0068855_100083986 | 3300005563 | Bacteria | 3688 |
| 40 | Ga0068855_100255616 | 3300005563 | Unclassified | 1953 |
| 41 | Ga0068855_100373309 | 3300005563 | Bacteria | 1567 |
| 42 | Ga0068857_100004454 | 3300005577 | Bacteria | 11836 |
| 43 | Ga0068857_100006293 | 3300005577 | Bacteria | 10158 |
| 44 | Ga0068857_100013573 | 3300005577 | Bacteria | 7097 |
| 45 | Ga0068854_100088182 | 3300005578 | Bacteria | 2303 |
| 46 | Ga0068856_100000321 | 3300005614 | Bacteria | 52621 |
| 47 | Ga0068856_100338470 | 3300005614 | Bacteria | 1523 |
| 48 | Ga0068859_100096388 | 3300005617 | Unclassified | 3011 |
| 49 | Ga0068858_100041827 | 3300005842 | Bacteria | 4248 |
| 50 | Ga0081455_10032938 | 3300005937 | Unclassified | 4662 |
| 51 | Ga0070717_10255494 | 3300006028 | Bacteria | 1549 |
| 52 | Ga0097621_100016761 | 3300006237 | Bacteria | 5549 |
| 53 | Ga0097621_100125507 | 3300006237 | Bacteria | 2180 |
| 54 | Ga0068871_100009925 | 3300006358 | Bacteria | 6914 |
| 55 | Ga0068871_100049373 | 3300006358 | Bacteria | 3401 |
| 56 | Ga0068871_100223822 | 3300006358 | Bacteria | 1631 |
| 57 | Ga0068865_100002593 | 3300006881 | Bacteria | 10734 |
| 58 | Ga0097620_100096389 | 3300006931 | Unclassified | 3011 |
| 59 | Ga0105240_10000780 | 3300009093 | Bacteria | 57653 |
| 60 | Ga0105240_10004980 | 3300009093 | Bacteria | 19954 |
| 61 | Ga0105240_10023146 | 3300009093 | Bacteria | 8225 |
| 62 | Ga0105240_10038788 | 3300009093 | Bacteria | 6107 |
| 63 | Ga0105240_10076252 | 3300009093 | Bacteria | 4133 |
| 64 | Ga0105240_10106931 | 3300009093 | Unclassified | 3392 |
| 65 | Ga0105240_10108037 | 3300009093 | Bacteria | 3371 |
| 66 | Ga0105240_10594493 | 3300009093 | Unclassified | 1219 |
| 67 | Ga0105245_10004029 | 3300009098 | Bacteria | 13069 |
| 68 | Ga0105245_10012957 | 3300009098 | Bacteria | 7269 |
| 69 | Ga0105245_10040185 | 3300009098 | Bacteria | 4166 |
| 70 | Ga0105245_10138429 | 3300009098 | Bacteria | 2290 |
| 71 | Ga0105245_10237511 | 3300009098 | Unclassified | 1765 |
| 72 | Ga0105247_10088120 | 3300009101 | Bacteria | 1966 |
| 73 | Ga0105243_10056176 | 3300009148 | Bacteria | 3129 |
| 74 | Ga0105241_10002749 | 3300009174 | Bacteria | 13189 |
| 75 | Ga0105241_10106906 | 3300009174 | Bacteria | 2234 |
| 76 | Ga0105241_10150382 | 3300009174 | Unclassified | 1904 |
| 77 | Ga0105242_10001181 | 3300009176 | Bacteria | 20568 |
| 78 | Ga0105242_10002976 | 3300009176 | Bacteria | 13263 |
| 79 | Ga0105242_10020818 | 3300009176 | Bacteria | 5145 |
| 80 | Ga0105248_10038602 | 3300009177 | Bacteria | 5346 |
| 81 | Ga0105248_10057336 | 3300009177 | Bacteria | 4372 |
| 82 | Ga0105248_10058891 | 3300009177 | Bacteria | 4314 |
| 83 | Ga0105248_10132360 | 3300009177 | Bacteria | 2814 |
| 84 | Ga0105248_10134642 | 3300009177 | Bacteria | 2788 |
| 85 | Ga0105237_10001374 | 3300009545 | Bacteria | 32109 |
| 86 | Ga0105237_10001475 | 3300009545 | Bacteria | 31009 |
| 87 | Ga0105237_10006068 | 3300009545 | Bacteria | 13516 |
| 88 | Ga0105237_10044606 | 3300009545 | Unclassified | 4465 |
| 89 | Ga0105237_10094146 | 3300009545 | Unclassified | 2985 |
| 90 | Ga0105237_10413548 | 3300009545 | Bacteria | 1354 |
| 91 | Ga0105238_10002509 | 3300009551 | Bacteria | 18367 |
| 92 | Ga0105238_10010027 | 3300009551 | Bacteria | 9500 |
| 93 | Ga0105238_10033083 | 3300009551 | Bacteria | 5261 |
| 94 | Ga0105238_10039568 | 3300009551 | Bacteria | 4781 |
| 95 | Ga0105238_10340438 | 3300009551 | Bacteria | 1488 |
| 96 | Ga0105249_10052928 | 3300009553 | Bacteria | 3709 |
| 97 | Ga0105239_10005217 | 3300010375 | Bacteria | 15292 |
| 98 | Ga0105239_10127871 | 3300010375 | Bacteria | 2825 |
| 99 | Ga0105246_10062297 | 3300011119 | Bacteria | 2598 |
| 100 | Ga0157373_10273727 | 3300013100 | Unclassified | 1196 |
| 101 | Ga0157370_10001518 | 3300013104 | Bacteria | 28705 |
| 102 | Ga0157370_10004491 | 3300013104 | Bacteria | 15988 |
| 103 | Ga0157370_10116410 | 3300013104 | Bacteria | 2497 |
| 104 | Ga0157369_10000962 | 3300013105 | Bacteria | 36547 |
| 105 | Ga0157369_10003744 | 3300013105 | Bacteria | 18069 |
| 106 | Ga0157369_10004520 | 3300013105 | Bacteria | 16370 |
| 107 | Ga0157369_10044262 | 3300013105 | Bacteria | 4847 |
| 108 | Ga0157369_10127042 | 3300013105 | Unclassified | 2702 |
| 109 | Ga0157374_10060028 | 3300013296 | Bacteria | 3558 |
| 110 | Ga0157374_10275121 | 3300013296 | Unclassified | 1661 |
| 111 | Ga0163162_10402828 | 3300013306 | Bacteria | 1501 |
| 112 | Ga0163162_10443750 | 3300013306 | Bacteria | 1430 |
| 113 | Ga0157372_10000562 | 3300013307 | Bacteria | 40924 |
| 114 | Ga0157372_10002501 | 3300013307 | Bacteria | 19939 |
| 115 | Ga0157372_10013602 | 3300013307 | Bacteria | 8698 |
| 116 | Ga0157372_10089359 | 3300013307 | Bacteria | 3500 |
| 117 | Ga0163163_10013956 | 3300014325 | Bacteria | 7372 |
| 118 | Ga0163163_10079501 | 3300014325 | Bacteria | 3277 |
| 119 | Ga0157379_10050051 | 3300014968 | Bacteria | 3729 |
| 120 | Ga0157379_10151202 | 3300014968 | Unclassified | 2094 |
| 121 | Ga0157376_10008200 | 3300014969 | Bacteria | 7518 |
| 122 | Ga0157376_10606614 | 3300014969 | Bacteria | 1090 |
| 123 | Ga0213872_10098465 | 3300021361 | Unclassified | 1305 |
| 124 | Ga0213875_10055286 | 3300021388 | Unclassified | 1859 |
| 125 | Ga0207710_10044746 | 3300025900 | Bacteria | 1972 |
| 126 | Ga0207647_10018948 | 3300025904 | Bacteria | 4637 |
| 127 | Ga0207699_10110777 | 3300025906 | Bacteria | 1759 |
| 128 | Ga0207705_10000703 | 3300025909 | Bacteria | 27614 |
| 129 | Ga0207654_10004427 | 3300025911 | Bacteria | 7087 |
| 130 | Ga0207707_10000564 | 3300025912 | Bacteria | 37587 |
| 131 | Ga0207707_10014034 | 3300025912 | Bacteria | 6983 |
| 132 | Ga0207707_10084073 | 3300025912 | Bacteria | 2779 |
| 133 | Ga0207707_10163160 | 3300025912 | Unclassified | 1948 |
| 134 | Ga0207695_10000793 | 3300025913 | Bacteria | 59366 |
| 135 | Ga0207695_10008060 | 3300025913 | Bacteria | 13261 |
| 136 | Ga0207695_10067486 | 3300025913 | Unclassified | 3669 |
| 137 | Ga0207695_10072417 | 3300025913 | Bacteria | 3516 |
| 138 | Ga0207671_10003208 | 3300025914 | Bacteria | 16468 |
| 139 | Ga0207671_10009900 | 3300025914 | Bacteria | 7923 |
| 140 | Ga0207671_10048888 | 3300025914 | Bacteria | 3130 |
| 141 | Ga0207671_10073260 | 3300025914 | Bacteria | 2558 |
| 142 | Ga0207663_10119236 | 3300025916 | Bacteria | 1804 |
| 143 | Ga0207660_10406216 | 3300025917 | Bacteria | 1097 |
| 144 | Ga0207657_10032131 | 3300025919 | Unclassified | 4745 |
| 145 | Ga0207657_10045293 | 3300025919 | Bacteria | 3862 |
| 146 | Ga0207657_10285144 | 3300025919 | Bacteria | 1310 |
| 147 | Ga0207649_10240490 | 3300025920 | Bacteria | 1299 |
| 148 | Ga0207694_10000901 | 3300025924 | Bacteria | 26253 |
| 149 | Ga0207694_10001417 | 3300025924 | Bacteria | 20545 |
| 150 | Ga0207694_10021325 | 3300025924 | Bacteria | 4908 |
| 151 | Ga0207694_10414904 | 3300025924 | Unclassified | 1121 |
| 152 | Ga0207687_10001282 | 3300025927 | Bacteria | 17189 |
| 153 | Ga0207687_10005244 | 3300025927 | Bacteria | 8594 |
| 154 | Ga0207687_10274113 | 3300025927 | Bacteria | 1350 |
| 155 | Ga0207700_10042963 | 3300025928 | Bacteria | 3318 |
| 156 | Ga0207700_10081682 | 3300025928 | Bacteria | 2525 |
| 157 | Ga0207690_10039354 | 3300025932 | Bacteria | 3084 |
| 158 | Ga0207686_10093114 | 3300025934 | Bacteria | 1994 |
| 159 | Ga0207704_10001769 | 3300025938 | Bacteria | 9672 |
| 160 | Ga0207704_10094080 | 3300025938 | Bacteria | 1978 |
| 161 | Ga0207711_10003810 | 3300025941 | Bacteria | 12972 |
| 162 | Ga0207711_10134749 | 3300025941 | Bacteria | 2218 |
| 163 | Ga0207711_10311969 | 3300025941 | Bacteria | 1452 |
| 164 | Ga0207711_10312584 | 3300025941 | Bacteria | 1451 |
| 165 | Ga0207661_10005998 | 3300025944 | Bacteria | 8580 |
| 166 | Ga0207661_10006339 | 3300025944 | Bacteria | 8367 |
| 167 | Ga0207661_10129856 | 3300025944 | Bacteria | 2156 |
| 168 | Ga0207661_10308593 | 3300025944 | Bacteria | 1420 |
| 169 | Ga0207661_10313219 | 3300025944 | Bacteria | 1409 |
| 170 | Ga0207667_10000530 | 3300025949 | Bacteria | 50307 |
| 171 | Ga0207667_10000702 | 3300025949 | Bacteria | 43396 |
| 172 | Ga0207667_10031905 | 3300025949 | Bacteria | 5681 |
| 173 | Ga0207658_10096124 | 3300025986 | Bacteria | 2310 |
| 174 | Ga0207658_10179508 | 3300025986 | Unclassified | 1751 |
| 175 | Ga0207677_10275867 | 3300026023 | Unclassified | 1378 |
| 176 | Ga0207703_10016415 | 3300026035 | Bacteria | 5773 |
| 177 | Ga0207678_10115599 | 3300026067 | Bacteria | 2289 |
| 178 | Ga0207702_10004842 | 3300026078 | Bacteria | 11857 |
| 179 | Ga0207702_10155801 | 3300026078 | Unclassified | 2082 |
| 180 | Ga0207676_10253692 | 3300026095 | Bacteria | 1585 |
| 181 | Ga0207674_10001356 | 3300026116 | Bacteria | 31674 |
| 182 | Ga0207674_10013793 | 3300026116 | Bacteria | 8940 |
| 183 | Ga0207674_10029885 | 3300026116 | Bacteria | 5733 |
| 184 | Ga0207674_10091991 | 3300026116 | Bacteria | 3023 |
| 185 | Ga0207698_10049981 | 3300026142 | Unclassified | 3187 |
| 186 | Ga0265354_1000127 | 3300028016 | Bacteria | 13408 |
| 187 | Ga0268266_10012348 | 3300028379 | Bacteria | 7388 |
| 188 | Ga0268266_10048433 | 3300028379 | Bacteria | 3643 |
| 189 | Ga0265338_10020898 | 3300028800 | Bacteria | 6855 |
| 190 | Ga0265762_1005444 | 3300030760 | Bacteria | 2282 |
| 191 | Ga0265765_1000082 | 3300030879 | Bacteria | 5080 |
| 192 | Ga0265760_10002575 | 3300031090 | Bacteria | 5298 |
| 193 | Ga0265332_10030820 | 3300031238 | Unclassified | 2341 |
| 194 | Ga0265325_10030812 | 3300031241 | Unclassified | 2875 |
| 195 | Ga0265325_10158431 | 3300031241 | Unclassified | 1066 |
| 196 | Ga0265340_10081353 | 3300031247 | Unclassified | 1525 |
| 197 | Ga0265340_10161071 | 3300031247 | Unclassified | 1019 |
| 198 | Ga0265313_10109566 | 3300031595 | Unclassified | 1216 |
| 199 | Ga0265314_10004252 | 3300031711 | Bacteria | 13420 |
| 200 | Ga0265314_10007228 | 3300031711 | Bacteria | 9655 |
| 201 | Ga0307510_10091415 | 3300033180 | Bacteria | 2886 |
| 202 | Ga0316212_1000317 | 3300033547 | Bacteria | 5704 |
| 203 | Ga0373954_0099310 | 3300035118 | Unclassified | 1403 |
| 204 | Ga0373956_0020745 | 3300035119 | Bacteria | 2799 |
| 205 | Ga0373957_0020633 | 3300035120 | Bacteria | 2330 |
| 206 | Ga0373933_0069570 | 3300035724 | Bacteria | 2140 |
| 207 | Ga0373937_0103543 | 3300036401 | Unclassified | 2643 |
| 208 | Ga0373937_0123064 | 3300036401 | Bacteria | 2418 |
| 209 | Ga0373937_0715425 | 3300036401 | Bacteria | 948 |
| 210 | Ga0395905_0205227 | 3300037471 | Bacteria | 1847 |
| 211 | Ga0436365_1714757 | 3300039437 | Bacteria | 3725 |
| 212 | Ga0436361_1032362 | 3300039447 | Bacteria | 3507 |
| 213 | Ga0451576_0137764 | 3300045051 | Bacteria | 2546 |
| 214 | Ga0451576_0167346 | 3300045051 | Bacteria | 2294 |
| 215 | Ga0495651_0329576 | 3300046462 | Bacteria | 1015 |
| 216 | Ga0495628_0170597 | 3300046516 | Bacteria | 1650 |
| 217 | Ga0495652_0025023 | 3300046529 | Bacteria | 5283 |
| 218 | Ga0495586_0228230 | 3300046535 | Unclassified | 1059 |
| 219 | Ga0495587_0000289 | 3300046536 | Bacteria | 35652 |
| 220 | Ga0495634_0071781 | 3300046642 | Bacteria | 2278 |
| 221 | Ga0495599_0045161 | 3300046678 | Bacteria | 2762 |
| 222 | Ga0495658_0052967 | 3300046683 | Bacteria | 2303 |
| 223 | Ga0495674_0311729 | 3300047319 | Unclassified | 1284 |
| 224 | Ga0495680_0045923 | 3300047322 | Bacteria | 3447 |
| 225 | Ga0495684_0034382 | 3300047471 | Bacteria | 3889 |
| 226 | Ga0495602_0062068 | 3300048088 | Unclassified | 3244 |
| 227 | Ga0496102_0185536 | 3300048905 | Unclassified | 1960 |
| 228 | Ga0496104_0098762 | 3300048907 | Bacteria | 2795 |
| 229 | Ga0496112_0045953 | 3300048915 | Bacteria | 4281 |
| 230 | Ga0496114_0014176 | 3300048917 | Bacteria | 6394 |
| 231 | Ga0496115_0010281 | 3300048918 | Bacteria | 6986 |
| 232 | Ga0496115_0116316 | 3300048918 | Bacteria | 2199 |
| 233 | Ga0496126_0000285 | 3300048929 | Bacteria | 106970 |
| 234 | Ga0495682_0099655 | 3300049460 | Bacteria | 1042 |
| 235 | Ga0501033_0111486 | 3300049570 | Unclassified | 1991 |
| 236 | Ga0501034_0023314 | 3300049571 | Bacteria | 6307 |
| 237 | Ga0501034_0413195 | 3300049571 | Unclassified | 1271 |
| 238 | Ga0501037_0112234 | 3300049573 | Bacteria | 1963 |
| 239 | Ga0501043_0464599 | 3300049579 | Bacteria | 949 |
| 240 | Ga0501046_0287378 | 3300049580 | Unclassified | 1203 |
| 241 | Ga0501047_0121673 | 3300049581 | Bacteria | 2491 |
| 242 | Ga0501048_0318843 | 3300049582 | Unclassified | 1107 |
| 243 | Ga0501070_0022779 | 3300049586 | Bacteria | 5243 |
| 244 | Ga0501073_0102322 | 3300049589 | Bacteria | 1989 |
| 245 | Ga0466962_0153076 | 3300061719 | Bacteria | 1119 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014969 | Ga0157376_10606614 | Ga0157376_106066141 | 196 |
| 2 | 3300013306 | Ga0163162_10443750 | Ga0163162_104437502 | 205 |
| 3 | 3300005548 | Ga0070665_100013468 | Ga0070665_1000134682 | 214 |
| 4 | 3300025938 | Ga0207704_10094080 | Ga0207704_100940802 | 214 |
| 5 | 3300028379 | Ga0268266_10048433 | Ga0268266_100484332 | 214 |
| 6 | 3300005436 | Ga0070713_100008959 | Ga0070713_1000089598 | 218 |
| 7 | 3300025928 | Ga0207700_10042963 | Ga0207700_100429634 | 218 |
| 8 | 3300025913 | Ga0207695_10067486 | Ga0207695_100674864 | 228 |
| 9 | 3300035118 | Ga0373954_0099310 | Ga0373954_0099310_520_1323 | 228 |
| 10 | 3300035119 | Ga0373956_0020745 | Ga0373956_0020745_1007_1810 | 228 |
| 11 | 3300035120 | Ga0373957_0020633 | Ga0373957_0020633_699_1502 | 228 |
| 12 | 3300035724 | Ga0373933_0069570 | Ga0373933_0069570_1253_2056 | 228 |
| 13 | 3300036401 | Ga0373937_0123064 | Ga0373937_0123064_812_1615 | 228 |
| 14 | 3300046535 | Ga0495586_0228230 | Ga0495586_0228230_162_965 | 228 |
| 15 | 3300048905 | Ga0496102_0185536 | Ga0496102_0185536_576_1499 | 229 |
| 16 | 3300049571 | Ga0501034_0413195 | Ga0501034_0413195_393_1196 | 233 |
| 17 | 3300005459 | Ga0068867_100076881 | Ga0068867_1000768813 | 234 |
| 18 | 3300005459 | Ga0068867_100127263 | Ga0068867_1001272632 | 237 |
| 19 | 3300006237 | Ga0097621_100125507 | Ga0097621_1001255073 | 237 |
| 20 | 3300048929 | Ga0496126_0000285 | Ga0496126_0000285_70033_70860 | 237 |
| 21 | 3300009093 | Ga0105240_10038788 | Ga0105240_100387882 | 238 |
| 22 | 3300009545 | Ga0105237_10094146 | Ga0105237_100941463 | 238 |
| 23 | 3300037471 | Ga0395905_0205227 | Ga0395905_0205227_180_992 | 238 |
| 24 | 3300033180 | Ga0307510_10091415 | Ga0307510_100914153 | 239 |
| 25 | 3300048915 | Ga0496112_0045953 | Ga0496112_0045953_211_1134 | 239 |
| 26 | 3300049460 | Ga0495682_0099655 | Ga0495682_0099655_142_969 | 239 |
| 27 | 3300005434 | Ga0070709_10167624 | Ga0070709_101676242 | 240 |
| 28 | 3300005436 | Ga0070713_100423938 | Ga0070713_1004239382 | 240 |
| 29 | 3300005439 | Ga0070711_100143340 | Ga0070711_1001433402 | 240 |
| 30 | 3300009098 | Ga0105245_10138429 | Ga0105245_101384292 | 240 |
| 31 | 3300009148 | Ga0105243_10056176 | Ga0105243_100561762 | 240 |
| 32 | 3300025906 | Ga0207699_10110777 | Ga0207699_101107772 | 240 |
| 33 | 3300025916 | Ga0207663_10119236 | Ga0207663_101192362 | 240 |
| 34 | 3300025927 | Ga0207687_10274113 | Ga0207687_102741132 | 240 |
| 35 | 3300026023 | Ga0207677_10275867 | Ga0207677_102758672 | 240 |
| 36 | 3300031247 | Ga0265340_10081353 | Ga0265340_100813532 | 240 |
| 37 | 3300031711 | Ga0265314_10004252 | Ga0265314_100042523 | 240 |
| 38 | 3300031711 | Ga0265314_10007228 | Ga0265314_100072286 | 240 |
| 39 | 3300036401 | Ga0373937_0715425 | Ga0373937_0715425_139_903 | 240 |
| 40 | 3300005329 | Ga0070683_100007559 | Ga0070683_1000075598 | 241 |
| 41 | 3300005458 | Ga0070681_10056280 | Ga0070681_100562805 | 241 |
| 42 | 3300005530 | Ga0070679_100070367 | Ga0070679_1000703675 | 241 |
| 43 | 3300005563 | Ga0068855_100083986 | Ga0068855_1000839863 | 241 |
| 44 | 3300005577 | Ga0068857_100004454 | Ga0068857_1000044548 | 241 |
| 45 | 3300009093 | Ga0105240_10106931 | Ga0105240_101069312 | 241 |
| 46 | 3300009551 | Ga0105238_10010027 | Ga0105238_100100276 | 241 |
| 47 | 3300013307 | Ga0157372_10013602 | Ga0157372_100136026 | 241 |
| 48 | 3300021388 | Ga0213875_10055286 | Ga0213875_100552862 | 241 |
| 49 | 3300025912 | Ga0207707_10163160 | Ga0207707_101631604 | 241 |
| 50 | 3300025924 | Ga0207694_10021325 | Ga0207694_100213256 | 241 |
| 51 | 3300025944 | Ga0207661_10129856 | Ga0207661_101298563 | 241 |
| 52 | 3300026116 | Ga0207674_10013793 | Ga0207674_100137936 | 241 |
| 53 | 3300048918 | Ga0496115_0116316 | Ga0496115_0116316_1331_2152 | 241 |
| 54 | 3300005327 | Ga0070658_10221507 | Ga0070658_102215072 | 242 |
| 55 | 3300005329 | Ga0070683_100000371 | Ga0070683_10000037112 | 242 |
| 56 | 3300005329 | Ga0070683_100013365 | Ga0070683_1000133655 | 242 |
| 57 | 3300005336 | Ga0070680_100002113 | Ga0070680_1000021134 | 242 |
| 58 | 3300005436 | Ga0070713_100027958 | Ga0070713_1000279582 | 242 |
| 59 | 3300005439 | Ga0070711_100143937 | Ga0070711_1001439372 | 242 |
| 60 | 3300005458 | Ga0070681_10003648 | Ga0070681_100036485 | 242 |
| 61 | 3300005535 | Ga0070684_100332268 | Ga0070684_1003322682 | 242 |
| 62 | 3300005563 | Ga0068855_100017580 | Ga0068855_1000175802 | 242 |
| 63 | 3300005563 | Ga0068855_100255616 | Ga0068855_1002556162 | 242 |
| 64 | 3300005614 | Ga0068856_100000321 | Ga0068856_10000032128 | 242 |
| 65 | 3300005614 | Ga0068856_100338470 | Ga0068856_1003384702 | 242 |
| 66 | 3300006028 | Ga0070717_10255494 | Ga0070717_102554942 | 242 |
| 67 | 3300006358 | Ga0068871_100223822 | Ga0068871_1002238221 | 242 |
| 68 | 3300009093 | Ga0105240_10000780 | Ga0105240_1000078026 | 242 |
| 69 | 3300009093 | Ga0105240_10004980 | Ga0105240_100049806 | 242 |
| 70 | 3300009098 | Ga0105245_10004029 | Ga0105245_1000402912 | 242 |
| 71 | 3300009098 | Ga0105245_10012957 | Ga0105245_100129572 | 242 |
| 72 | 3300009098 | Ga0105245_10237511 | Ga0105245_102375112 | 242 |
| 73 | 3300009174 | Ga0105241_10002749 | Ga0105241_100027495 | 242 |
| 74 | 3300009174 | Ga0105241_10150382 | Ga0105241_101503822 | 242 |
| 75 | 3300009545 | Ga0105237_10001374 | Ga0105237_100013749 | 242 |
| 76 | 3300009545 | Ga0105237_10001475 | Ga0105237_1000147510 | 242 |
| 77 | 3300009545 | Ga0105237_10044606 | Ga0105237_100446063 | 242 |
| 78 | 3300009551 | Ga0105238_10002509 | Ga0105238_1000250910 | 242 |
| 79 | 3300009551 | Ga0105238_10039568 | Ga0105238_100395683 | 242 |
| 80 | 3300009553 | Ga0105249_10052928 | Ga0105249_100529282 | 242 |
| 81 | 3300010375 | Ga0105239_10005217 | Ga0105239_100052179 | 242 |
| 82 | 3300011119 | Ga0105246_10062297 | Ga0105246_100622973 | 242 |
| 83 | 3300013104 | Ga0157370_10001518 | Ga0157370_100015183 | 242 |
| 84 | 3300013104 | Ga0157370_10004491 | Ga0157370_100044914 | 242 |
| 85 | 3300013105 | Ga0157369_10000962 | Ga0157369_100009629 | 242 |
| 86 | 3300013105 | Ga0157369_10003744 | Ga0157369_1000374416 | 242 |
| 87 | 3300013105 | Ga0157369_10004520 | Ga0157369_1000452011 | 242 |
| 88 | 3300013105 | Ga0157369_10127042 | Ga0157369_101270422 | 242 |
| 89 | 3300013307 | Ga0157372_10000562 | Ga0157372_1000056212 | 242 |
| 90 | 3300013307 | Ga0157372_10002501 | Ga0157372_1000250116 | 242 |
| 91 | 3300025911 | Ga0207654_10004427 | Ga0207654_100044274 | 242 |
| 92 | 3300025912 | Ga0207707_10000564 | Ga0207707_1000056411 | 242 |
| 93 | 3300025913 | Ga0207695_10000793 | Ga0207695_1000079326 | 242 |
| 94 | 3300025913 | Ga0207695_10008060 | Ga0207695_1000806014 | 242 |
| 95 | 3300025914 | Ga0207671_10003208 | Ga0207671_100032084 | 242 |
| 96 | 3300025914 | Ga0207671_10009900 | Ga0207671_100099003 | 242 |
| 97 | 3300025919 | Ga0207657_10032131 | Ga0207657_100321313 | 242 |
| 98 | 3300025924 | Ga0207694_10000901 | Ga0207694_1000090116 | 242 |
| 99 | 3300025924 | Ga0207694_10001417 | Ga0207694_100014175 | 242 |
| 100 | 3300025924 | Ga0207694_10414904 | Ga0207694_104149042 | 242 |
| 101 | 3300025927 | Ga0207687_10001282 | Ga0207687_1000128214 | 242 |
| 102 | 3300025927 | Ga0207687_10005244 | Ga0207687_100052442 | 242 |
| 103 | 3300025928 | Ga0207700_10081682 | Ga0207700_100816823 | 242 |
| 104 | 3300025941 | Ga0207711_10003810 | Ga0207711_100038102 | 242 |
| 105 | 3300025944 | Ga0207661_10005998 | Ga0207661_100059984 | 242 |
| 106 | 3300025944 | Ga0207661_10006339 | Ga0207661_100063393 | 242 |
| 107 | 3300025949 | Ga0207667_10000530 | Ga0207667_1000053012 | 242 |
| 108 | 3300025949 | Ga0207667_10000702 | Ga0207667_1000070240 | 242 |
| 109 | 3300025986 | Ga0207658_10179508 | Ga0207658_101795082 | 242 |
| 110 | 3300026078 | Ga0207702_10004842 | Ga0207702_100048423 | 242 |
| 111 | 3300026078 | Ga0207702_10155801 | Ga0207702_101558012 | 242 |
| 112 | 3300026116 | Ga0207674_10001356 | Ga0207674_100013565 | 242 |
| 113 | 3300026142 | Ga0207698_10049981 | Ga0207698_100499811 | 242 |
| 114 | 3300031241 | Ga0265325_10158431 | Ga0265325_101584312 | 242 |
| 115 | 3300031247 | Ga0265340_10161071 | Ga0265340_101610712 | 242 |
| 116 | 3300036401 | Ga0373937_0103543 | Ga0373937_0103543_422_1225 | 242 |
| 117 | 3300046462 | Ga0495651_0329576 | Ga0495651_0329576_39_842 | 242 |
| 118 | 3300046516 | Ga0495628_0170597 | Ga0495628_0170597_469_1272 | 242 |
| 119 | 3300046529 | Ga0495652_0025023 | Ga0495652_0025023_1178_1981 | 242 |
| 120 | 3300046536 | Ga0495587_0000289 | Ga0495587_0000289_30762_31565 | 242 |
| 121 | 3300046678 | Ga0495599_0045161 | Ga0495599_0045161_621_1424 | 242 |
| 122 | 3300047322 | Ga0495680_0045923 | Ga0495680_0045923_810_1613 | 242 |
| 123 | 3300047471 | Ga0495684_0034382 | Ga0495684_0034382_1294_2097 | 242 |
| 124 | 3300048088 | Ga0495602_0062068 | Ga0495602_0062068_765_1568 | 242 |
| 125 | 3300005334 | Ga0068869_100138621 | Ga0068869_1001386212 | 243 |
| 126 | 3300005335 | Ga0070666_10009128 | Ga0070666_100091283 | 243 |
| 127 | 3300005338 | Ga0068868_100024152 | Ga0068868_1000241522 | 243 |
| 128 | 3300005367 | Ga0070667_100139326 | Ga0070667_1001393262 | 243 |
| 129 | 3300005548 | Ga0070665_100002019 | Ga0070665_10000201915 | 243 |
| 130 | 3300005842 | Ga0068858_100041827 | Ga0068858_1000418273 | 243 |
| 131 | 3300006358 | Ga0068871_100049373 | Ga0068871_1000493732 | 243 |
| 132 | 3300009093 | Ga0105240_10108037 | Ga0105240_101080372 | 243 |
| 133 | 3300009098 | Ga0105245_10040185 | Ga0105245_100401852 | 243 |
| 134 | 3300009176 | Ga0105242_10002976 | Ga0105242_100029769 | 243 |
| 135 | 3300009177 | Ga0105248_10038602 | Ga0105248_100386022 | 243 |
| 136 | 3300013296 | Ga0157374_10060028 | Ga0157374_100600282 | 243 |
| 137 | 3300014968 | Ga0157379_10050051 | Ga0157379_100500512 | 243 |
| 138 | 3300014969 | Ga0157376_10008200 | Ga0157376_100082003 | 243 |
| 139 | 3300025986 | Ga0207658_10096124 | Ga0207658_100961242 | 243 |
| 140 | 3300026035 | Ga0207703_10016415 | Ga0207703_100164153 | 243 |
| 141 | 3300026095 | Ga0207676_10253692 | Ga0207676_102536922 | 243 |
| 142 | 3300028379 | Ga0268266_10012348 | Ga0268266_100123483 | 243 |
| 143 | 3300048907 | Ga0496104_0098762 | Ga0496104_0098762_487_1323 | 243 |
| 144 | 3300048917 | Ga0496114_0014176 | Ga0496114_0014176_2091_2927 | 243 |
| 145 | 3300048918 | Ga0496115_0010281 | Ga0496115_0010281_3848_4684 | 243 |
| 146 | 3300031238 | Ga0265332_10030820 | Ga0265332_100308203 | 244 |
| 147 | 3300005329 | Ga0070683_100303555 | Ga0070683_1003035552 | 245 |
| 148 | 3300006237 | Ga0097621_100016761 | Ga0097621_1000167612 | 245 |
| 149 | 3300006358 | Ga0068871_100009925 | Ga0068871_1000099253 | 245 |
| 150 | 3300006881 | Ga0068865_100002593 | Ga0068865_1000025934 | 245 |
| 151 | 3300009093 | Ga0105240_10023146 | Ga0105240_100231467 | 245 |
| 152 | 3300009176 | Ga0105242_10001181 | Ga0105242_1000118110 | 245 |
| 153 | 3300009177 | Ga0105248_10058891 | Ga0105248_100588914 | 245 |
| 154 | 3300009545 | Ga0105237_10006068 | Ga0105237_1000606810 | 245 |
| 155 | 3300009551 | Ga0105238_10340438 | Ga0105238_103404382 | 245 |
| 156 | 3300010375 | Ga0105239_10127871 | Ga0105239_101278712 | 245 |
| 157 | 3300025914 | Ga0207671_10048888 | Ga0207671_100488883 | 245 |
| 158 | 3300025934 | Ga0207686_10093114 | Ga0207686_100931141 | 245 |
| 159 | 3300025938 | Ga0207704_10001769 | Ga0207704_100017695 | 245 |
| 160 | 3300025941 | Ga0207711_10312584 | Ga0207711_103125842 | 245 |
| 161 | 3300025944 | Ga0207661_10308593 | Ga0207661_103085932 | 245 |
| 162 | 3300049570 | Ga0501033_0111486 | Ga0501033_0111486_754_1542 | 245 |
| 163 | 3300049571 | Ga0501034_0023314 | Ga0501034_0023314_699_1487 | 245 |
| 164 | 3300049573 | Ga0501037_0112234 | Ga0501037_0112234_357_1145 | 245 |
| 165 | 3300049579 | Ga0501043_0464599 | Ga0501043_0464599_64_852 | 245 |
| 166 | 3300049580 | Ga0501046_0287378 | Ga0501046_0287378_17_805 | 245 |
| 167 | 3300049581 | Ga0501047_0121673 | Ga0501047_0121673_851_1639 | 245 |
| 168 | 3300049582 | Ga0501048_0318843 | Ga0501048_0318843_300_1088 | 245 |
| 169 | 3300049586 | Ga0501070_0022779 | Ga0501070_0022779_874_1662 | 245 |
| 170 | 3300049589 | Ga0501073_0102322 | Ga0501073_0102322_168_956 | 245 |
| 171 | 3300005617 | Ga0068859_100096388 | Ga0068859_1000963882 | 246 |
| 172 | 3300005937 | Ga0081455_10032938 | Ga0081455_100329384 | 246 |
| 173 | 3300006931 | Ga0097620_100096389 | Ga0097620_1000963892 | 246 |
| 174 | 3300030760 | Ga0265762_1005444 | Ga0265762_10054442 | 246 |
| 175 | 3300061719 | Ga0466962_0153076 | Ga0466962_0153076_282_1070 | 246 |
| 176 | 3300009545 | Ga0105237_10413548 | Ga0105237_104135482 | 248 |
| 177 | 3300013296 | Ga0157374_10275121 | Ga0157374_102751213 | 248 |
| 178 | 3300009177 | Ga0105248_10134642 | Ga0105248_101346422 | 249 |
| 179 | 3300025941 | Ga0207711_10311969 | Ga0207711_103119692 | 249 |
| 180 | 3300009177 | Ga0105248_10132360 | Ga0105248_101323603 | 250 |
| 181 | 3300021361 | Ga0213872_10098465 | Ga0213872_100984652 | 250 |
| 182 | 3300031090 | Ga0265760_10002575 | Ga0265760_100025753 | 250 |
| 183 | 3300039447 | Ga0436361_1032362 | Ga0436361_1032362_378_1214 | 250 |
| 184 | 3300005336 | Ga0070680_100122655 | Ga0070680_1001226553 | 251 |
| 185 | 3300005458 | Ga0070681_10049890 | Ga0070681_100498903 | 251 |
| 186 | 3300005530 | Ga0070679_100218728 | Ga0070679_1002187283 | 251 |
| 187 | 3300005548 | Ga0070665_100195087 | Ga0070665_1001950872 | 251 |
| 188 | 3300005577 | Ga0068857_100013573 | Ga0068857_1000135733 | 251 |
| 189 | 3300009093 | Ga0105240_10594493 | Ga0105240_105944932 | 251 |
| 190 | 3300009176 | Ga0105242_10020818 | Ga0105242_100208183 | 251 |
| 191 | 3300009177 | Ga0105248_10057336 | Ga0105248_100573363 | 251 |
| 192 | 3300013306 | Ga0163162_10402828 | Ga0163162_104028282 | 251 |
| 193 | 3300014325 | Ga0163163_10079501 | Ga0163163_100795013 | 251 |
| 194 | 3300025912 | Ga0207707_10014034 | Ga0207707_100140343 | 251 |
| 195 | 3300025941 | Ga0207711_10134749 | Ga0207711_101347492 | 251 |
| 196 | 3300026116 | Ga0207674_10029885 | Ga0207674_100298853 | 251 |
| 197 | 3300009174 | Ga0105241_10106906 | Ga0105241_101069062 | 252 |
| 198 | 3300028016 | Ga0265354_1000127 | Ga0265354_10001275 | 252 |
| 199 | 3300030879 | Ga0265765_1000082 | Ga0265765_10000823 | 252 |
| 200 | 3300031595 | Ga0265313_10109566 | Ga0265313_101095661 | 252 |
| 201 | 3300033547 | Ga0316212_1000317 | Ga0316212_10003172 | 252 |
| 202 | 3300046683 | Ga0495658_0052967 | Ga0495658_0052967_799_1644 | 252 |
| 203 | 3300005329 | Ga0070683_100018116 | Ga0070683_1000181163 | 254 |
| 204 | 3300005339 | Ga0070660_100011370 | Ga0070660_1000113703 | 254 |
| 205 | 3300005344 | Ga0070661_100161278 | Ga0070661_1001612782 | 254 |
| 206 | 3300005455 | Ga0070663_100392666 | Ga0070663_1003926662 | 254 |
| 207 | 3300005458 | Ga0070681_10125963 | Ga0070681_101259633 | 254 |
| 208 | 3300005530 | Ga0070679_100021210 | Ga0070679_1000212104 | 254 |
| 209 | 3300005535 | Ga0070684_100126565 | Ga0070684_1001265651 | 254 |
| 210 | 3300005539 | Ga0068853_100067129 | Ga0068853_1000671293 | 254 |
| 211 | 3300005563 | Ga0068855_100373309 | Ga0068855_1003733092 | 254 |
| 212 | 3300005577 | Ga0068857_100006293 | Ga0068857_1000062931 | 254 |
| 213 | 3300005578 | Ga0068854_100088182 | Ga0068854_1000881823 | 254 |
| 214 | 3300009093 | Ga0105240_10076252 | Ga0105240_100762522 | 254 |
| 215 | 3300009551 | Ga0105238_10033083 | Ga0105238_100330833 | 254 |
| 216 | 3300013100 | Ga0157373_10273727 | Ga0157373_102737271 | 254 |
| 217 | 3300013104 | Ga0157370_10116410 | Ga0157370_101164102 | 254 |
| 218 | 3300013105 | Ga0157369_10044262 | Ga0157369_100442623 | 254 |
| 219 | 3300013307 | Ga0157372_10089359 | Ga0157372_100893592 | 254 |
| 220 | 3300025904 | Ga0207647_10018948 | Ga0207647_100189484 | 254 |
| 221 | 3300025909 | Ga0207705_10000703 | Ga0207705_100007036 | 254 |
| 222 | 3300025912 | Ga0207707_10084073 | Ga0207707_100840732 | 254 |
| 223 | 3300025913 | Ga0207695_10072417 | Ga0207695_100724173 | 254 |
| 224 | 3300025914 | Ga0207671_10073260 | Ga0207671_100732601 | 254 |
| 225 | 3300025917 | Ga0207660_10406216 | Ga0207660_104062162 | 254 |
| 226 | 3300025919 | Ga0207657_10045293 | Ga0207657_100452933 | 254 |
| 227 | 3300025919 | Ga0207657_10285144 | Ga0207657_102851442 | 254 |
| 228 | 3300025920 | Ga0207649_10240490 | Ga0207649_102404902 | 254 |
| 229 | 3300025932 | Ga0207690_10039354 | Ga0207690_100393542 | 254 |
| 230 | 3300025944 | Ga0207661_10313219 | Ga0207661_103132192 | 254 |
| 231 | 3300025949 | Ga0207667_10031905 | Ga0207667_100319053 | 254 |
| 232 | 3300026067 | Ga0207678_10115599 | Ga0207678_101155993 | 254 |
| 233 | 3300026116 | Ga0207674_10091991 | Ga0207674_100919912 | 254 |
| 234 | 3300039437 | Ga0436365_1714757 | Ga0436365_1714757_621_1481 | 255 |
| 235 | 3300047319 | Ga0495674_0311729 | Ga0495674_0311729_328_1233 | 257 |
| 236 | 3300045051 | Ga0451576_0167346 | Ga0451576_0167346_1087_1941 | 259 |
| 237 | 3300028800 | Ga0265338_10020898 | Ga0265338_100208987 | 261 |
| 238 | 3300031241 | Ga0265325_10030812 | Ga0265325_100308122 | 261 |
| 239 | 3300009101 | Ga0105247_10088120 | Ga0105247_100881202 | 262 |
| 240 | 3300014325 | Ga0163163_10013956 | Ga0163163_100139563 | 262 |
| 241 | 3300014968 | Ga0157379_10151202 | Ga0157379_101512022 | 262 |
| 242 | 3300025900 | Ga0207710_10044746 | Ga0207710_100447462 | 262 |
| 243 | 3300045051 | Ga0451576_0137764 | Ga0451576_0137764_978_1838 | 262 |
| 244 | 3300046642 | Ga0495634_0071781 | Ga0495634_0071781_261_1181 | 264 |
| 245 | 3300003320 | rootH2_10078932 | rootH2_100789328 | 276 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j5s-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8081 | 203 | 234 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.7743 | 2 | 50 |
| 5wuq-assembly2.cif.gz_D | crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form | 0.7132 | 6 | 68 |
| 2z2s-assembly2.cif.gz_D | crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr | 0.7121 | 1 | 65 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6823 | 2 | 50 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.7743 | 2 | 50 | 1.10.10.1320 |
| 2z2sD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.7298 | 1 | 63 | 1.10.10.1320 |
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6823 | 2 | 50 | 1.10.10.1320 |
| 3hugN00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6789 | 9 | 66 | 1.10.10.1320 |
| 3hugD00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6509 | 2 | 66 | 1.10.10.1320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0E4H316-F1-model_v4 | HNH endonuclease | 0.9646 | 165 | 244 |
|
| AF-A0A535V259-F1-model_v4 | HNH endonuclease | 0.9475 | 174 | 247 |
|
| AF-A0A654D9Q9-F1-model_v4 | HNH nuclease domain-containing protein | 0.9466 | 172 | 244 |
|
| AF-A0A7S7SP79-F1-model_v4 | HNH endonuclease | 0.9416 | 135 | 250 |
GO:0004519
|
| AF-A0A7C2EKF6-F1-model_v4 | HNH endonuclease | 0.931 | 123 | 247 |
GO:0004519
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar