F357435

General Info

Members Datasets Scaffolds Average Seq Length
245 168 490 152

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10033679|Ga0207709_100336793
Length 167
Sequence MMKHLKFWLLVTMLLPASMAVADIKNFIAVSSELGTAGQPSETQLREVAGAGFEVVVNLGLLDPRYCLADEAGSVAALGLAYHHIPVDFNAPQPDDLRRFFDAMDAAKDQKVFVHCAANYRVSTFVALYGESRLGWSPEEGDAHIRRIWEPNETWTRFIAEARARLA

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.67
Nodule 0
Rhizoplane 0.41
Rhizosphere 94.69
Stem 0
Stem Tuber 0
Unclassified 15.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10033679 3300025935 Bacteria 3011
2 JGI25150J39212_1000396 3300002774 Bacteria 20500
3 rootL2_10061487 3300003322 Bacteria 6655
4 Ga0055524_1000458 3300003775 Bacteria 33324
5 Ga0055530_10004378 3300003791 Bacteria 7309
6 Ga0070676_10015078 3300005328 Bacteria 4259
7 Ga0070690_100027110 3300005330 Bacteria 3540
8 Ga0070670_100009830 3300005331 Bacteria 8173
9 Ga0070670_100320869 3300005331 Bacteria 1357
10 Ga0070677_10032150 3300005333 Bacteria 2011
11 Ga0068869_100003238 3300005334 Bacteria 9951
12 Ga0070666_10061230 3300005335 Bacteria 2548
13 Ga0070682_100000429 3300005337 Bacteria 27186
14 Ga0068868_101205342 3300005338 Bacteria 700
15 Ga0070689_100156322 3300005340 Bacteria 1841
16 Ga0070689_100543778 3300005340 Bacteria 1000
17 Ga0070689_101101405 3300005340 Bacteria 710
18 Ga0070687_100038737 3300005343 Bacteria 2391
19 Ga0070661_100620978 3300005344 Bacteria 875
20 Ga0070668_100000442 3300005347 Bacteria 27426
21 Ga0070669_100010407 3300005353 Bacteria 6606
22 Ga0070669_100059481 3300005353 Bacteria 2806
23 Ga0070669_100198334 3300005353 Bacteria 1578
24 Ga0070669_100920374 3300005353 Bacteria 747
25 Ga0070675_100010957 3300005354 Bacteria 7095
26 Ga0070675_100020419 3300005354 Bacteria 5287
27 Ga0070675_100446307 3300005354 Bacteria 1160
28 Ga0070675_100566908 3300005354 Bacteria 1028
29 Ga0070671_100001456 3300005355 Bacteria 17668
30 Ga0070671_100009780 3300005355 Bacteria 7701
31 Ga0070671_100834879 3300005355 Bacteria 803
32 Ga0070674_100042994 3300005356 Bacteria 3072
33 Ga0070674_100051876 3300005356 Bacteria 2828
34 Ga0070674_101742619 3300005356 Unclassified 564
35 Ga0070673_100000603 3300005364 Bacteria 19619
36 Ga0070673_100072062 3300005364 Bacteria 2777
37 Ga0070688_100044197 3300005365 Bacteria 2748
38 Ga0070688_100458478 3300005365 Bacteria 954
39 Ga0070667_100000016 3300005367 Bacteria 237028
40 Ga0070667_100022969 3300005367 Bacteria 5172
41 Ga0070667_100563079 3300005367 Bacteria 1048
42 Ga0070711_100038850 3300005439 Bacteria 3203
43 Ga0070700_100002239 3300005441 Bacteria 9843
44 Ga0070694_100083419 3300005444 Bacteria 2227
45 Ga0070694_101123614 3300005444 Unclassified 656
46 Ga0070678_100075983 3300005456 Bacteria 2529
47 Ga0070678_100153678 3300005456 Bacteria 1857
48 Ga0070662_101807160 3300005457 Unclassified 528
49 Ga0068867_100016481 3300005459 Bacteria 5246
50 Ga0068867_101392014 3300005459 Bacteria 650
51 Ga0070685_10195056 3300005466 Bacteria 1313
52 Ga0070698_100505451 3300005471 Bacteria 1147
53 Ga0070672_100009076 3300005543 Bacteria 6840
54 Ga0070672_100293924 3300005543 Bacteria 1376
55 Ga0070695_100177417 3300005545 Bacteria 1507
56 Ga0070693_100615475 3300005547 Unclassified 786
57 Ga0070665_100341268 3300005548 Bacteria 1503
58 Ga0070665_100676897 3300005548 Bacteria 1045
59 Ga0070664_100019452 3300005564 Bacteria 5587
60 Ga0068854_100070428 3300005578 Unclassified 2556
61 Ga0068852_100004061 3300005616 Bacteria 10298
62 Ga0068859_100000075 3300005617 Bacteria 91974
63 Ga0068859_100204225 3300005617 Bacteria 2061
64 Ga0068859_100500059 3300005617 Bacteria 1311
65 Ga0068859_102112220 3300005617 Bacteria 622
66 Ga0068864_101085965 3300005618 Bacteria 796
67 Ga0068866_10005189 3300005718 Bacteria 5367
68 Ga0068861_100037468 3300005719 Bacteria 3605
69 Ga0068861_100106509 3300005719 Bacteria 2240
70 Ga0068851_10928774 3300005834 Bacteria 546
71 Ga0068863_100001396 3300005841 Bacteria 23941
72 Ga0068863_100002391 3300005841 Bacteria 18658
73 Ga0068858_100001857 3300005842 Bacteria 21542
74 Ga0068860_100000361 3300005843 Bacteria 60231
75 Ga0068860_100026506 3300005843 Bacteria 5587
76 Ga0068860_100841849 3300005843 Unclassified 932
77 Ga0068862_100034452 3300005844 Bacteria 4284
78 Ga0068862_100092571 3300005844 Bacteria 2635
79 Ga0070717_10861255 3300006028 Bacteria 825
80 Ga0070715_10357887 3300006163 Unclassified 799
81 Ga0097621_100007066 3300006237 Bacteria 8001
82 Ga0097621_100838735 3300006237 Unclassified 853
83 Ga0068871_100019738 3300006358 Bacteria 5150
84 Ga0075430_101029360 3300006846 Bacteria 678
85 Ga0075429_100410013 3300006880 Bacteria 1187
86 Ga0068865_100247258 3300006881 Bacteria 1406
87 Ga0097620_100000075 3300006931 Bacteria 91974
88 Ga0097620_100204225 3300006931 Bacteria 2061
89 Ga0097620_100500119 3300006931 Bacteria 1311
90 Ga0097620_101993646 3300006931 Unclassified 641
91 Ga0097620_102112145 3300006931 Bacteria 622
92 Ga0111539_12385713 3300009094 Bacteria 614
93 Ga0105243_10006731 3300009148 Bacteria 8868
94 Ga0105242_10010380 3300009176 Bacteria 7143
95 Ga0105242_10340553 3300009176 Bacteria 1382
96 Ga0105242_11482610 3300009176 Bacteria 708
97 Ga0105248_10049904 3300009177 Bacteria 4692
98 Ga0105248_10259366 3300009177 Bacteria 1957
99 Ga0105248_12495271 3300009177 Unclassified 589
100 Ga0105238_10002348 3300009551 Bacteria 19032
101 Ga0105238_11176306 3300009551 Bacteria 791
102 Ga0105246_10042015 3300011119 Bacteria 3094
103 Ga0157374_10055521 3300013296 Bacteria 3697
104 Ga0163162_10073052 3300013306 Bacteria 3485
105 Ga0157372_12574111 3300013307 Unclassified 584
106 Ga0157375_10411743 3300013308 Bacteria 1518
107 Ga0157375_11077547 3300013308 Bacteria 940
108 Ga0163163_10040331 3300014325 Bacteria 4559
109 Ga0163163_10064221 3300014325 Bacteria 3642
110 Ga0163163_11034507 3300014325 Bacteria 885
111 Ga0157380_10007353 3300014326 Bacteria 7820
112 Ga0157380_10045493 3300014326 Bacteria 3444
113 Ga0157380_10058065 3300014326 Bacteria 3084
114 Ga0157380_10098058 3300014326 Bacteria 2434
115 Ga0157380_10996425 3300014326 Bacteria 871
116 Ga0157377_10025147 3300014745 Bacteria 3173
117 Ga0157379_10010680 3300014968 Bacteria 7999
118 Ga0157379_10363219 3300014968 Bacteria 1327
119 Ga0157376_10068043 3300014969 Unclassified 3014
120 Ga0207425_1000001 3300025245 Bacteria 2525432
121 Ga0209129_1000001 3300025258 Bacteria 1452436
122 Ga0209758_1000116 3300025297 Bacteria 198356
123 Ga0209050_1001303 3300025298 Bacteria 28129
124 Ga0209256_1000350 3300025299 Bacteria 74944
125 Ga0207697_10375178 3300025315 Bacteria 632
126 Ga0207680_10144784 3300025903 Bacteria 1579
127 Ga0207645_10007572 3300025907 Bacteria 7656
128 Ga0207684_11096667 3300025910 Unclassified 663
129 Ga0207695_11335864 3300025913 Unclassified 597
130 Ga0207671_10241977 3300025914 Unclassified 1417
131 Ga0207662_10052798 3300025918 Bacteria 2419
132 Ga0207681_10023286 3300025923 Bacteria 3959
133 Ga0207694_10059444 3300025924 Bacteria 2973
134 Ga0207650_10080299 3300025925 Bacteria 2472
135 Ga0207650_10658328 3300025925 Unclassified 883
136 Ga0207659_10015424 3300025926 Bacteria 4950
137 Ga0207659_10015541 3300025926 Bacteria 4935
138 Ga0207659_10031711 3300025926 Bacteria 3621
139 Ga0207659_10151990 3300025926 Bacteria 1809
140 Ga0207644_10004871 3300025931 Bacteria 8743
141 Ga0207644_10012431 3300025931 Bacteria 5653
142 Ga0207706_10904334 3300025933 Bacteria 745
143 Ga0207706_11153956 3300025933 Unclassified 645
144 Ga0207686_10013388 3300025934 Bacteria 4537
145 Ga0207670_10257419 3300025936 Bacteria 1351
146 Ga0207670_10543692 3300025936 Bacteria 948
147 Ga0207669_10014368 3300025937 Bacteria 3966
148 Ga0207704_11075522 3300025938 Unclassified 683
149 Ga0207691_10003798 3300025940 Bacteria 14658
150 Ga0207691_10098688 3300025940 Bacteria 2609
151 Ga0207691_10274107 3300025940 Bacteria 1452
152 Ga0207711_10573487 3300025941 Bacteria 1053
153 Ga0207711_10915460 3300025941 Bacteria 815
154 Ga0207689_10020891 3300025942 Bacteria 5504
155 Ga0207679_10567043 3300025945 Bacteria 1020
156 Ga0207651_10009763 3300025960 Bacteria 5277
157 Ga0207651_10010090 3300025960 Bacteria 5213
158 Ga0207668_10000680 3300025972 Bacteria 20866
159 Ga0207658_10000134 3300025986 Bacteria 78342
160 Ga0207658_10016341 3300025986 Bacteria 5104
161 Ga0207658_10361391 3300025986 Bacteria 1267
162 Ga0207658_10610862 3300025986 Bacteria 980
163 Ga0207677_10575061 3300026023 Bacteria 985
164 Ga0207703_10022695 3300026035 Bacteria 4928
165 Ga0207708_10000706 3300026075 Bacteria 25251
166 Ga0207641_10001362 3300026088 Bacteria 24233
167 Ga0207641_10001969 3300026088 Bacteria 19648
168 Ga0207648_10008633 3300026089 Bacteria 9847
169 Ga0207648_12055167 3300026089 Bacteria 532
170 Ga0207676_10190979 3300026095 Bacteria 1802
171 Ga0207675_100031546 3300026118 Bacteria 4936
172 Ga0207675_100319470 3300026118 Bacteria 1515
173 Ga0207683_10214436 3300026121 Bacteria 1753
174 Ga0207698_10369003 3300026142 Unclassified 1362
175 Ga0268266_11730015 3300028379 Bacteria 600
176 Ga0268265_10013174 3300028380 Bacteria 5619
177 Ga0268265_10132911 3300028380 Bacteria 2071
178 Ga0268265_10133964 3300028380 Bacteria 2064
179 Ga0268264_10000087 3300028381 Bacteria 236696
180 Ga0268264_10043824 3300028381 Bacteria 3710
181 Ga0268264_10178174 3300028381 Bacteria 1928
182 Ga0268264_11678184 3300028381 Unclassified 646
183 Ga0265316_10226442 3300031344 Unclassified 1378
184 Ga0307408_101451325 3300031548 Unclassified 647
185 Ga0265313_10018810 3300031595 Bacteria 3867
186 Ga0373950_0000049 3300034818 Bacteria 87604
187 Ga0373944_0333765 3300035089 Unclassified 574
188 Ga0373953_0084342 3300035117 Bacteria 1324
189 Ga0373953_0249163 3300035117 Unclassified 772
190 Ga0373953_0283787 3300035117 Unclassified 722
191 Ga0373943_0002566 3300035170 Bacteria 8263
192 Ga0373955_0137416 3300035172 Unclassified 1430
193 Ga0373924_0146555 3300035410 Unclassified 1031
194 Ga0373927_0174115 3300035695 Bacteria 1411
195 Ga0373933_0011146 3300035724 Bacteria 4945
196 Ga0373933_0050998 3300035724 Unclassified 2472
197 Ga0373947_0294715 3300035725 Unclassified 1080
198 Ga0373937_0006179 3300036401 Bacteria 10315
199 Ga0373937_0165753 3300036401 Bacteria 2072
200 Ga0373937_0797489 3300036401 Bacteria 892
201 Ga0373925_0019441 3300037068 Bacteria 4940
202 Ga0395905_0272540 3300037471 Unclassified 1578
203 Ga0436364_0494410 3300037853 Bacteria 637
204 Ga0451853_2528070 3300041512 Bacteria 1483
205 Ga0495580_1004880 3300046472 Unclassified 531
206 Ga0495582_0322303 3300046473 Unclassified 889
207 Ga0495608_0034081 3300046511 Bacteria 3438
208 Ga0495628_0030887 3300046516 Bacteria 4335
209 Ga0495630_0041023 3300046517 Bacteria 3457
210 Ga0495637_0021980 3300046520 Bacteria 2916
211 Ga0495652_0478290 3300046529 Unclassified 867
212 Ga0495665_0204198 3300046531 Bacteria 1024
213 Ga0495586_0251655 3300046535 Unclassified 1008
214 Ga0495634_0079911 3300046642 Bacteria 2141
215 Ga0495635_1054100 3300046663 Unclassified 516
216 Ga0495599_0065619 3300046678 Bacteria 2268
217 Ga0495658_0077931 3300046683 Bacteria 1939
218 Ga0495613_0055291 3300046689 Bacteria 2916
219 Ga0495674_0052885 3300047319 Bacteria 3572
220 Ga0495684_0000053 3300047471 Bacteria 82157
221 Ga0496114_0749103 3300048917 Bacteria 854
222 Ga0501034_0000354 3300049571 Bacteria 78713
223 Ga0501036_0012107 3300049572 Bacteria 7149
224 Ga0501043_0002885 3300049579 Bacteria 14358
225 Ga0501046_0011244 3300049580 Bacteria 7662
226 Ga0501047_0000001 3300049581 Bacteria 658799
227 Ga0501068_0006558 3300049584 Bacteria 6419
228 Ga0501069_0085207 3300049585 Bacteria 1783
229 Ga0501070_0204265 3300049586 Bacteria 1622
230 Ga0501072_0000019 3300049588 Bacteria 158156
231 Ga0501073_0030127 3300049589 Bacteria 3875
232 Ga0501074_0000342 3300049590 Bacteria 27192
233 Ga0501079_0001733 3300049741 Bacteria 15554
234 Ga0501080_0014410 3300049742 Bacteria 7281
235 Ga0501080_0025854 3300049742 Bacteria 5454
236 Ga0501083_0012783 3300049744 Bacteria 5871
237 nmdc:mga09592_1106840_c1 3300050508 Bacteria 658
238 nmdc:mga0qj67_464288_c1 3300050509 Bacteria 1019
239 Ga0495601_0031575 3300053077 Bacteria 3292
240 Ga0495601_0511480 3300053077 Unclassified 774
241 Ga0495595_0073362 3300053084 Bacteria 1621
242 Ga0495619_0403044 3300053085 Bacteria 944
243 Ga0500583_0409912 3300053092 Unclassified 649
244 Ga0501084_0000509 3300054114 Bacteria 29788
245 Ga0501082_0065359 3300060353 Bacteria 3132
246 Ga0207709_10033679
247 JGI25150J39212_1000396
248 rootL2_10061487
249 Ga0055524_1000458
250 Ga0055530_10004378
251 Ga0070676_10015078
252 Ga0070690_100027110
253 Ga0070670_100009830
254 Ga0070670_100320869
255 Ga0070677_10032150
256 Ga0068869_100003238
257 Ga0070666_10061230
258 Ga0070682_100000429
259 Ga0068868_101205342
260 Ga0070689_100156322
261 Ga0070689_100543778
262 Ga0070689_101101405
263 Ga0070687_100038737
264 Ga0070661_100620978
265 Ga0070668_100000442
266 Ga0070669_100010407
267 Ga0070669_100059481
268 Ga0070669_100198334
269 Ga0070669_100920374
270 Ga0070675_100010957
271 Ga0070675_100020419
272 Ga0070675_100446307
273 Ga0070675_100566908
274 Ga0070671_100001456
275 Ga0070671_100009780
276 Ga0070671_100834879
277 Ga0070674_100042994
278 Ga0070674_100051876
279 Ga0070674_101742619
280 Ga0070673_100000603
281 Ga0070673_100072062
282 Ga0070688_100044197
283 Ga0070688_100458478
284 Ga0070667_100000016
285 Ga0070667_100022969
286 Ga0070667_100563079
287 Ga0070711_100038850
288 Ga0070700_100002239
289 Ga0070694_100083419
290 Ga0070694_101123614
291 Ga0070678_100075983
292 Ga0070678_100153678
293 Ga0070662_101807160
294 Ga0068867_100016481
295 Ga0068867_101392014
296 Ga0070685_10195056
297 Ga0070698_100505451
298 Ga0070672_100009076
299 Ga0070672_100293924
300 Ga0070695_100177417
301 Ga0070693_100615475
302 Ga0070665_100341268
303 Ga0070665_100676897
304 Ga0070664_100019452
305 Ga0068854_100070428
306 Ga0068852_100004061
307 Ga0068859_100000075
308 Ga0068859_100204225
309 Ga0068859_100500059
310 Ga0068859_102112220
311 Ga0068864_101085965
312 Ga0068866_10005189
313 Ga0068861_100037468
314 Ga0068861_100106509
315 Ga0068851_10928774
316 Ga0068863_100001396
317 Ga0068863_100002391
318 Ga0068858_100001857
319 Ga0068860_100000361
320 Ga0068860_100026506
321 Ga0068860_100841849
322 Ga0068862_100034452
323 Ga0068862_100092571
324 Ga0070717_10861255
325 Ga0070715_10357887
326 Ga0097621_100007066
327 Ga0097621_100838735
328 Ga0068871_100019738
329 Ga0075430_101029360
330 Ga0075429_100410013
331 Ga0068865_100247258
332 Ga0097620_100000075
333 Ga0097620_100204225
334 Ga0097620_100500119
335 Ga0097620_101993646
336 Ga0097620_102112145
337 Ga0111539_12385713
338 Ga0105243_10006731
339 Ga0105242_10010380
340 Ga0105242_10340553
341 Ga0105242_11482610
342 Ga0105248_10049904
343 Ga0105248_10259366
344 Ga0105248_12495271
345 Ga0105238_10002348
346 Ga0105238_11176306
347 Ga0105246_10042015
348 Ga0157374_10055521
349 Ga0163162_10073052
350 Ga0157372_12574111
351 Ga0157375_10411743
352 Ga0157375_11077547
353 Ga0163163_10040331
354 Ga0163163_10064221
355 Ga0163163_11034507
356 Ga0157380_10007353
357 Ga0157380_10045493
358 Ga0157380_10058065
359 Ga0157380_10098058
360 Ga0157380_10996425
361 Ga0157377_10025147
362 Ga0157379_10010680
363 Ga0157379_10363219
364 Ga0157376_10068043
365 Ga0207425_1000001
366 Ga0209129_1000001
367 Ga0209758_1000116
368 Ga0209050_1001303
369 Ga0209256_1000350
370 Ga0207697_10375178
371 Ga0207680_10144784
372 Ga0207645_10007572
373 Ga0207684_11096667
374 Ga0207695_11335864
375 Ga0207671_10241977
376 Ga0207662_10052798
377 Ga0207681_10023286
378 Ga0207694_10059444
379 Ga0207650_10080299
380 Ga0207650_10658328
381 Ga0207659_10015424
382 Ga0207659_10015541
383 Ga0207659_10031711
384 Ga0207659_10151990
385 Ga0207644_10004871
386 Ga0207644_10012431
387 Ga0207706_10904334
388 Ga0207706_11153956
389 Ga0207686_10013388
390 Ga0207670_10257419
391 Ga0207670_10543692
392 Ga0207669_10014368
393 Ga0207704_11075522
394 Ga0207691_10003798
395 Ga0207691_10098688
396 Ga0207691_10274107
397 Ga0207711_10573487
398 Ga0207711_10915460
399 Ga0207689_10020891
400 Ga0207679_10567043
401 Ga0207651_10009763
402 Ga0207651_10010090
403 Ga0207668_10000680
404 Ga0207658_10000134
405 Ga0207658_10016341
406 Ga0207658_10361391
407 Ga0207658_10610862
408 Ga0207677_10575061
409 Ga0207703_10022695
410 Ga0207708_10000706
411 Ga0207641_10001362
412 Ga0207641_10001969
413 Ga0207648_10008633
414 Ga0207648_12055167
415 Ga0207676_10190979
416 Ga0207675_100031546
417 Ga0207675_100319470
418 Ga0207683_10214436
419 Ga0207698_10369003
420 Ga0268266_11730015
421 Ga0268265_10013174
422 Ga0268265_10132911
423 Ga0268265_10133964
424 Ga0268264_10000087
425 Ga0268264_10043824
426 Ga0268264_10178174
427 Ga0268264_11678184
428 Ga0265316_10226442
429 Ga0307408_101451325
430 Ga0265313_10018810
431 Ga0373950_0000049
432 Ga0373944_0333765
433 Ga0373953_0084342
434 Ga0373953_0249163
435 Ga0373953_0283787
436 Ga0373943_0002566
437 Ga0373955_0137416
438 Ga0373924_0146555
439 Ga0373927_0174115
440 Ga0373933_0011146
441 Ga0373933_0050998
442 Ga0373947_0294715
443 Ga0373937_0006179
444 Ga0373937_0165753
445 Ga0373937_0797489
446 Ga0373925_0019441
447 Ga0395905_0272540
448 Ga0436364_0494410
449 Ga0451853_2528070
450 Ga0495580_1004880
451 Ga0495582_0322303
452 Ga0495608_0034081
453 Ga0495628_0030887
454 Ga0495630_0041023
455 Ga0495637_0021980
456 Ga0495652_0478290
457 Ga0495665_0204198
458 Ga0495586_0251655
459 Ga0495634_0079911
460 Ga0495635_1054100
461 Ga0495599_0065619
462 Ga0495658_0077931
463 Ga0495613_0055291
464 Ga0495674_0052885
465 Ga0495684_0000053
466 Ga0496114_0749103
467 Ga0501034_0000354
468 Ga0501036_0012107
469 Ga0501043_0002885
470 Ga0501046_0011244
471 Ga0501047_0000001
472 Ga0501068_0006558
473 Ga0501069_0085207
474 Ga0501070_0204265
475 Ga0501072_0000019
476 Ga0501073_0030127
477 Ga0501074_0000342
478 Ga0501079_0001733
479 Ga0501080_0014410
480 Ga0501080_0025854
481 Ga0501083_0012783
482 nmdc:mga09592_1106840_c1
483 nmdc:mga0qj67_464288_c1
484 Ga0495601_0031575
485 Ga0495601_0511480
486 Ga0495595_0073362
487 Ga0495619_0403044
488 Ga0500583_0409912
489 Ga0501084_0000509
490 Ga0501082_0065359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gxh-assembly3.cif.gz_B crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.40 a resolution 0.9149 3 148
3gxg-assembly1.cif.gz_A crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.60 a resolution 0.8913 3 148
3gxh-assembly3.cif.gz_B crystal structure of putative phosphatase (duf442) (yp_001181608.1) from shewanella putrefaciens cn-32 at 1.40 a resolution 0.8747 3 148
5z5b-assembly3.cif.gz_C crystal structure of tk-ptp in the g95a mutant form 0.853 9 147
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.8528 14 143
ID Description Score Start End Superfamily
3gxhB00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.9144 3 148 3.90.190.10
3gxhB00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8729 3 148 3.90.190.10
af_Q7XC53_86_235_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8659 9 149 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8597 14 143 3.90.190.10
5z5aA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8515 8 147 3.90.190.10
ID Description Score Start End GO Terms
AF-T0YZH4-F1-model_v4 Beta-lactamase hydrolase-like protein (EC 3.-.-.-) 0.9874 3 142 GO:0016787
AF-A0A4R3Y0C0-F1-model_v4 Putative phosphatase DUF442 0.9863 5 113
AF-A0A2E8KBV6-F1-model_v4 Beta-lactamase hydrolase-like protein phosphatase-like domain-containing protein 0.9861 1 147 GO:0016787
AF-A0A2Z5X0R6-F1-model_v4 Beta-lactamase hydrolase-family protein 0.9854 3 146 GO:0016020
GO:0016787
AF-T1AG17-F1-model_v4 Beta-lactamase hydrolase-like protein (EC 3.-.-.-) 0.9853 3 104 GO:0016787

Map