F357419

General Info

Members Datasets Scaffolds Average Seq Length
245 165 488 667

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10065958|Ga0207671_100659582
Length 723
Sequence MKALAQALGSGWLSLATAAGTSAADQVPGGATSAHAAPDVLSSLAIILCVAAVTTVVFQRIHQPVVLGYLLAGLIVGPHMPVPLFADIKIAHLFXXXXVILLMFSLGLEFTLRKLARVGPTAGVVAVIECSLMVGLGYAAAGLLGWRPLERLFAGAFVAISSTTIIVKAFAERKVAGRLGEIVFGILIVEDVVAIGRLLAFLAGMMVVGMLVIPRLVRGIARLGRNETTVVACVGICFASALIARSFGYSVALGAFIGGVLVAESGEARTVEQVIEPVKDVFAAVFFVSVGMLIDPRLVGAHIGAILLLALVVIGGKVLGVTLGAFIAGNGVRTSVQAGMSLAQIGEFSFIIVGLYPVAVAISALTTLLTPWLIRASGPAARALDRRLPHVLQTYASLYGTWVDGLRASPQRRGTPEHRTAWSRIRRLVVLLMVDVGLVTGIVVAASVSLPYLLAWLDAHVRLDPWVAMAVVLGGAAAVATPFAIGAVRVARGLGLALAAEALPHAEARPDAVDRLDLAAAPRRALLVSLQIGILLVAGLPMLAIAQPFLPSFPWAALLGLALLALAVPLWRGAANLDQHVRAGAQVLLEAIGKQSRATESGSHPAGPGVVAEREGHAGARAPGEVAAGAGEAEARRLMPGLGSAGALQLTDGHFAVGRTLKQTNLRGETGASVIGIRRAGEALFPTGDERLAAGDTLVLTGTEDAVIAARALLTAGPPGPGA

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.67
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10065958 3300025914 Bacteria 2693
2 Ga0070683_100087178 3300005329 Bacteria 2927
3 Ga0070690_100008041 3300005330 Bacteria 6055
4 Ga0068868_100009517 3300005338 Bacteria 6999
5 Ga0068868_100042954 3300005338 Bacteria 3530
6 Ga0070689_100000004 3300005340 Bacteria 497771
7 Ga0070689_100006493 3300005340 Bacteria 8102
8 Ga0070689_100037989 3300005340 Bacteria 3682
9 Ga0070691_10009241 3300005341 Bacteria 4505
10 Ga0070687_100002696 3300005343 Bacteria 6718
11 Ga0070692_10030671 3300005345 Bacteria 2689
12 Ga0070669_100009455 3300005353 Bacteria 6942
13 Ga0070669_100019280 3300005353 Bacteria 4872
14 Ga0070675_100003463 3300005354 Bacteria 11960
15 Ga0070675_100066081 3300005354 Bacteria 2991
16 Ga0070674_100057396 3300005356 Bacteria 2702
17 Ga0070673_100001040 3300005364 Bacteria 15742
18 Ga0070688_100003222 3300005365 Bacteria 8365
19 Ga0070659_100016865 3300005366 Bacteria 5489
20 Ga0070667_100017679 3300005367 Bacteria 5909
21 Ga0070701_10002364 3300005438 Bacteria 7246
22 Ga0070701_10007181 3300005438 Bacteria 4741
23 Ga0070705_100002208 3300005440 Bacteria 9888
24 Ga0070694_100037856 3300005444 Bacteria 3201
25 Ga0070708_100037943 3300005445 Bacteria 4205
26 Ga0070681_10002141 3300005458 Bacteria 17952
27 Ga0068867_100031029 3300005459 Bacteria 3857
28 Ga0070685_10022339 3300005466 Bacteria 3448
29 Ga0070707_100001619 3300005468 Bacteria 21827
30 Ga0070698_100019832 3300005471 Bacteria 7053
31 Ga0070679_100007163 3300005530 Bacteria 10410
32 Ga0070679_100007763 3300005530 Bacteria 10045
33 Ga0070684_100002995 3300005535 Bacteria 12575
34 Ga0070684_100006448 3300005535 Bacteria 9081
35 Ga0070684_100028903 3300005535 Bacteria 4692
36 Ga0068853_100000505 3300005539 Bacteria 26608
37 Ga0070672_100006914 3300005543 Bacteria 7667
38 Ga0070672_100007630 3300005543 Bacteria 7360
39 Ga0070672_100009744 3300005543 Bacteria 6633
40 Ga0070696_100028930 3300005546 Bacteria 3783
41 Ga0070665_100000170 3300005548 Bacteria 116622
42 Ga0070664_100031222 3300005564 Bacteria 4449
43 Ga0068857_100016219 3300005577 Bacteria 6526
44 Ga0068854_100091622 3300005578 Bacteria 2263
45 Ga0068852_100068282 3300005616 Bacteria 3110
46 Ga0068859_100038230 3300005617 Bacteria 4815
47 Ga0068859_100080628 3300005617 Bacteria 3296
48 Ga0068861_100006233 3300005719 Bacteria 8113
49 Ga0068861_100025064 3300005719 Bacteria 4320
50 Ga0068863_100020425 3300005841 Bacteria 6330
51 Ga0068858_100021213 3300005842 Bacteria 6066
52 Ga0068858_100095425 3300005842 Bacteria 2771
53 Ga0068860_100025642 3300005843 Bacteria 5686
54 Ga0068862_100087023 3300005844 Bacteria 2717
55 Ga0070712_100090683 3300006175 Bacteria 2238
56 Ga0075428_100038149 3300006844 Bacteria 5288
57 Ga0075428_100096996 3300006844 Bacteria 3214
58 Ga0075430_100050948 3300006846 Bacteria 3490
59 Ga0075430_100060819 3300006846 Bacteria 3174
60 Ga0075431_100038139 3300006847 Bacteria 4947
61 Ga0075431_100059480 3300006847 Bacteria 3943
62 Ga0075434_100012959 3300006871 Bacteria 7920
63 Ga0075434_100053860 3300006871 Bacteria 3997
64 Ga0075434_100066319 3300006871 Bacteria 3595
65 Ga0075429_100007078 3300006880 Bacteria 9737
66 Ga0075429_100008198 3300006880 Bacteria 9082
67 Ga0075429_100009326 3300006880 Bacteria 8520
68 Ga0068865_100001057 3300006881 Bacteria 15823
69 Ga0097620_100038229 3300006931 Bacteria 4815
70 Ga0097620_100080628 3300006931 Bacteria 3296
71 Ga0111539_10003269 3300009094 Bacteria 21423
72 Ga0114129_10004036 3300009147 Bacteria 20725
73 Ga0105243_10037838 3300009148 Bacteria 3754
74 Ga0105242_10038383 3300009176 Bacteria 3851
75 Ga0105248_10009885 3300009177 Bacteria 10505
76 Ga0105237_10000047 3300009545 Bacteria 165578
77 Ga0105238_10011347 3300009551 Bacteria 8965
78 Ga0105239_10018272 3300010375 Bacteria 7752
79 Ga0163162_10009720 3300013306 Bacteria 9362
80 Ga0157375_10004574 3300013308 Bacteria 12015
81 Ga0157380_10008969 3300014326 Bacteria 7146
82 Ga0207680_10026283 3300025903 Bacteria 3225
83 Ga0207645_10002693 3300025907 Bacteria 13845
84 Ga0207645_10010368 3300025907 Bacteria 6398
85 Ga0207707_10001826 3300025912 Bacteria 19517
86 Ga0207693_10042710 3300025915 Bacteria 3569
87 Ga0207662_10001182 3300025918 Bacteria 12409
88 Ga0207662_10019753 3300025918 Bacteria 3839
89 Ga0207649_10009367 3300025920 Bacteria 5358
90 Ga0207649_10044897 3300025920 Bacteria 2707
91 Ga0207652_10022712 3300025921 Bacteria 5194
92 Ga0207646_10034977 3300025922 Bacteria 4540
93 Ga0207646_10112620 3300025922 Bacteria 2442
94 Ga0207694_10012803 3300025924 Bacteria 6318
95 Ga0207650_10024345 3300025925 Bacteria 4302
96 Ga0207659_10033060 3300025926 Bacteria 3556
97 Ga0207659_10047099 3300025926 Bacteria 3048
98 Ga0207644_10068047 3300025931 Bacteria 2597
99 Ga0207690_10027682 3300025932 Bacteria 3584
100 Ga0207690_10080916 3300025932 Bacteria 2268
101 Ga0207706_10005789 3300025933 Bacteria 11498
102 Ga0207706_10077575 3300025933 Bacteria 2922
103 Ga0207709_10015982 3300025935 Bacteria 4165
104 Ga0207670_10000007 3300025936 Bacteria 376171
105 Ga0207670_10017526 3300025936 Bacteria 4330
106 Ga0207670_10081033 3300025936 Bacteria 2270
107 Ga0207669_10056270 3300025937 Bacteria 2387
108 Ga0207704_10003393 3300025938 Bacteria 7236
109 Ga0207691_10002331 3300025940 Bacteria 18586
110 Ga0207691_10004059 3300025940 Bacteria 14197
111 Ga0207661_10011757 3300025944 Bacteria 6354
112 Ga0207679_10006287 3300025945 Bacteria 7495
113 Ga0207667_10062982 3300025949 Bacteria 3876
114 Ga0207651_10049881 3300025960 Bacteria 2839
115 Ga0207712_10018486 3300025961 Bacteria 4541
116 Ga0207639_10001700 3300026041 Bacteria 14852
117 Ga0207678_10004743 3300026067 Bacteria 12214
118 Ga0207708_10006733 3300026075 Bacteria 8502
119 Ga0207708_10016430 3300026075 Bacteria 5566
120 Ga0207648_10008660 3300026089 Bacteria 9819
121 Ga0207676_10082662 3300026095 Bacteria 2613
122 Ga0207674_10002583 3300026116 Bacteria 22787
123 Ga0207674_10004771 3300026116 Bacteria 16257
124 Ga0207675_100000338 3300026118 Bacteria 44988
125 Ga0207675_100011676 3300026118 Bacteria 8214
126 Ga0268266_10055594 3300028379 Bacteria 3403
127 Ga0268265_10009640 3300028380 Bacteria 6520
128 Ga0265318_10000176 3300028577 Bacteria 57171
129 Ga0265323_10017911 3300028653 Bacteria 2747
130 Ga0265324_10001018 3300029957 Bacteria 17229
131 Ga0265330_10000246 3300031235 Bacteria 40817
132 Ga0265330_10001195 3300031235 Bacteria 15396
133 Ga0265330_10001697 3300031235 Bacteria 12463
134 Ga0265332_10000564 3300031238 Bacteria 24749
135 Ga0265332_10004486 3300031238 Bacteria 6542
136 Ga0265328_10001790 3300031239 Bacteria 9800
137 Ga0265320_10000153 3300031240 Bacteria 57424
138 Ga0265320_10020572 3300031240 Bacteria 3572
139 Ga0265340_10020519 3300031247 Bacteria 3395
140 Ga0265339_10000002 3300031249 Bacteria 416322
141 Ga0265339_10016623 3300031249 Bacteria 4379
142 Ga0265331_10000448 3300031250 Bacteria 40119
143 Ga0265316_10003836 3300031344 Bacteria 15088
144 Ga0265316_10025577 3300031344 Bacteria 4924
145 Ga0265316_10040270 3300031344 Bacteria 3747
146 Ga0265316_10056590 3300031344 Bacteria 3061
147 Ga0307408_100007759 3300031548 Bacteria 7095
148 Ga0265313_10000264 3300031595 Bacteria 57324
149 Ga0265313_10017051 3300031595 Bacteria 4147
150 Ga0265314_10000228 3300031711 Bacteria 83634
151 Ga0265314_10029417 3300031711 Bacteria 4083
152 Ga0265342_10000423 3300031712 Bacteria 46377
153 Ga0265342_10006550 3300031712 Bacteria 8663
154 Ga0265342_10008992 3300031712 Bacteria 7094
155 Ga0265342_10014796 3300031712 Bacteria 5165
156 Ga0307410_10045903 3300031852 Bacteria 2912
157 Ga0307409_100070614 3300031995 Bacteria 2773
158 Ga0373950_0000006 3300034818 Bacteria 395608
159 Ga0373950_0000013 3300034818 Bacteria 344674
160 Ga0373954_0003542 3300035118 Bacteria 6637
161 Ga0373954_0004268 3300035118 Bacteria 6144
162 Ga0373956_0008197 3300035119 Bacteria 4229
163 Ga0373933_0000090 3300035724 Bacteria 58300
164 Ga0373937_0002339 3300036401 Bacteria 15801
165 Ga0373937_0004499 3300036401 Bacteria 11838
166 Ga0451577_0000227 3300042876 Bacteria 114840
167 Ga0451577_0039210 3300042876 Bacteria 4257
168 Ga0453683_0003866 3300044673 Bacteria 10858
169 Ga0453684_0000033 3300044712 Bacteria 734012
170 Ga0453684_0000067 3300044712 Bacteria 461903
171 Ga0453684_0000116 3300044712 Bacteria 352304
172 Ga0453684_0024660 3300044712 Bacteria 8775
173 Ga0451576_0004964 3300045051 Bacteria 16930
174 Ga0451576_0008389 3300045051 Bacteria 12131
175 Ga0451576_0027021 3300045051 Bacteria 6168
176 Ga0495592_0000006 3300046454 Bacteria 192981
177 Ga0495580_0110798 3300046472 Bacteria 1906
178 Ga0495662_0032621 3300046476 Bacteria 2516
179 Ga0495664_0024161 3300046477 Bacteria 3530
180 Ga0495618_0001565 3300046514 Bacteria 15334
181 Ga0495628_0000541 3300046516 Bacteria 34733
182 Ga0495652_0013589 3300046529 Bacteria 7328
183 Ga0495586_0001167 3300046535 Bacteria 14727
184 Ga0495634_0001620 3300046642 Bacteria 19602
185 Ga0495674_0002025 3300047319 Bacteria 19911
186 Ga0495674_0005374 3300047319 Bacteria 12298
187 Ga0496101_0096549 3300048904 Bacteria 2206
188 Ga0496105_0065216 3300048908 Bacteria 3006
189 Ga0496109_0020827 3300048912 Bacteria 5794
190 Ga0496112_0053927 3300048915 Bacteria 3950
191 Ga0496114_0000692 3300048917 Bacteria 25119
192 Ga0496114_0001148 3300048917 Bacteria 20009
193 Ga0496114_0004189 3300048917 Bacteria 11167
194 Ga0496114_0082639 3300048917 Bacteria 2715
195 Ga0496115_0024026 3300048918 Bacteria 4735
196 Ga0501034_0000093 3300049571 Bacteria 163663
197 Ga0501034_0002143 3300049571 Bacteria 24526
198 Ga0501040_0054384 3300049576 Bacteria 2744
199 Ga0501041_0025725 3300049577 Bacteria 3538
200 Ga0501043_0000767 3300049579 Bacteria 28559
201 Ga0501046_0001039 3300049580 Bacteria 27136
202 Ga0501047_0000500 3300049581 Bacteria 42529
203 Ga0501048_0004567 3300049582 Bacteria 10532
204 Ga0501048_0048839 3300049582 Bacteria 3017
205 Ga0501067_0000022 3300049583 Bacteria 95820
206 Ga0501068_0005753 3300049584 Bacteria 6799
207 Ga0501069_0024287 3300049585 Bacteria 3305
208 Ga0501070_0000023 3300049586 Bacteria 164053
209 Ga0501070_0000355 3300049586 Bacteria 41608
210 Ga0501072_0000049 3300049588 Bacteria 89925
211 Ga0501073_0001309 3300049589 Bacteria 18311
212 Ga0501073_0018543 3300049589 Bacteria 5031
213 Ga0501074_0003858 3300049590 Bacteria 10675
214 Ga0501077_0000337 3300049593 Bacteria 27630
215 Ga0501079_0001818 3300049741 Bacteria 15261
216 Ga0501079_0004858 3300049741 Bacteria 9959
217 Ga0501079_0021279 3300049741 Bacteria 4961
218 Ga0501079_0024300 3300049741 Bacteria 4649
219 Ga0501079_0029842 3300049741 Bacteria 4189
220 Ga0501079_0077572 3300049741 Bacteria 2570
221 Ga0501080_0002044 3300049742 Bacteria 17467
222 Ga0501080_0049133 3300049742 Bacteria 3926
223 Ga0501080_0188744 3300049742 Bacteria 1894
224 Ga0501083_0000424 3300049744 Bacteria 27147
225 Ga0501083_0009853 3300049744 Bacteria 6744
226 Ga0501035_0000173 3300049822 Bacteria 78891
227 Ga0501044_0125567 3300049823 Bacteria 2564
228 nmdc:mga05p37_91004_c1 3300050507 Bacteria 3760
229 nmdc:mga0qj67_148026_c1 3300050509 Bacteria 1904
230 nmdc:mga0qj67_55118_c1 3300050509 Bacteria 3149
231 nmdc:mga0qj67_57329_c1 3300050509 Bacteria 3088
232 nmdc:mga0qj67_63716_c1 3300050509 Bacteria 2931
233 nmdc:mga06r32_42017_c1 3300050510 Bacteria 4345
234 nmdc:mga06r32_96856_c1 3300050510 Bacteria 2890
235 nmdc:mga08y16_7995_c1 3300050511 Bacteria 11067
236 nmdc:mga0n895_33264_c1 3300050512 Bacteria 4954
237 nmdc:mga0n895_6056_c1 3300050512 Bacteria 10197
238 nmdc:mga0rr50_73800_c1 3300050513 Bacteria 2609
239 nmdc:mga08x19_38439_c1 3300050514 Bacteria 3041
240 nmdc:mga0a205_52708_c1 3300050515 Bacteria 3926
241 Ga0495601_0073001 3300053077 Bacteria 2193
242 Ga0501084_0000411 3300054114 Bacteria 33125
243 Ga0501082_0015357 3300060353 Bacteria 6590
244 Ga0501082_0095629 3300060353 Bacteria 2567
245 Ga0207671_10065958
246 Ga0070683_100087178
247 Ga0070690_100008041
248 Ga0068868_100009517
249 Ga0068868_100042954
250 Ga0070689_100000004
251 Ga0070689_100006493
252 Ga0070689_100037989
253 Ga0070691_10009241
254 Ga0070687_100002696
255 Ga0070692_10030671
256 Ga0070669_100009455
257 Ga0070669_100019280
258 Ga0070675_100003463
259 Ga0070675_100066081
260 Ga0070674_100057396
261 Ga0070673_100001040
262 Ga0070688_100003222
263 Ga0070659_100016865
264 Ga0070667_100017679
265 Ga0070701_10002364
266 Ga0070701_10007181
267 Ga0070705_100002208
268 Ga0070694_100037856
269 Ga0070708_100037943
270 Ga0070681_10002141
271 Ga0068867_100031029
272 Ga0070685_10022339
273 Ga0070707_100001619
274 Ga0070698_100019832
275 Ga0070679_100007163
276 Ga0070679_100007763
277 Ga0070684_100002995
278 Ga0070684_100006448
279 Ga0070684_100028903
280 Ga0068853_100000505
281 Ga0070672_100006914
282 Ga0070672_100007630
283 Ga0070672_100009744
284 Ga0070696_100028930
285 Ga0070665_100000170
286 Ga0070664_100031222
287 Ga0068857_100016219
288 Ga0068854_100091622
289 Ga0068852_100068282
290 Ga0068859_100038230
291 Ga0068859_100080628
292 Ga0068861_100006233
293 Ga0068861_100025064
294 Ga0068863_100020425
295 Ga0068858_100021213
296 Ga0068858_100095425
297 Ga0068860_100025642
298 Ga0068862_100087023
299 Ga0070712_100090683
300 Ga0075428_100038149
301 Ga0075428_100096996
302 Ga0075430_100050948
303 Ga0075430_100060819
304 Ga0075431_100038139
305 Ga0075431_100059480
306 Ga0075434_100012959
307 Ga0075434_100053860
308 Ga0075434_100066319
309 Ga0075429_100007078
310 Ga0075429_100008198
311 Ga0075429_100009326
312 Ga0068865_100001057
313 Ga0097620_100038229
314 Ga0097620_100080628
315 Ga0111539_10003269
316 Ga0114129_10004036
317 Ga0105243_10037838
318 Ga0105242_10038383
319 Ga0105248_10009885
320 Ga0105237_10000047
321 Ga0105238_10011347
322 Ga0105239_10018272
323 Ga0163162_10009720
324 Ga0157375_10004574
325 Ga0157380_10008969
326 Ga0207680_10026283
327 Ga0207645_10002693
328 Ga0207645_10010368
329 Ga0207707_10001826
330 Ga0207693_10042710
331 Ga0207662_10001182
332 Ga0207662_10019753
333 Ga0207649_10009367
334 Ga0207649_10044897
335 Ga0207652_10022712
336 Ga0207646_10034977
337 Ga0207646_10112620
338 Ga0207694_10012803
339 Ga0207650_10024345
340 Ga0207659_10033060
341 Ga0207659_10047099
342 Ga0207644_10068047
343 Ga0207690_10027682
344 Ga0207690_10080916
345 Ga0207706_10005789
346 Ga0207706_10077575
347 Ga0207709_10015982
348 Ga0207670_10000007
349 Ga0207670_10017526
350 Ga0207670_10081033
351 Ga0207669_10056270
352 Ga0207704_10003393
353 Ga0207691_10002331
354 Ga0207691_10004059
355 Ga0207661_10011757
356 Ga0207679_10006287
357 Ga0207667_10062982
358 Ga0207651_10049881
359 Ga0207712_10018486
360 Ga0207639_10001700
361 Ga0207678_10004743
362 Ga0207708_10006733
363 Ga0207708_10016430
364 Ga0207648_10008660
365 Ga0207676_10082662
366 Ga0207674_10002583
367 Ga0207674_10004771
368 Ga0207675_100000338
369 Ga0207675_100011676
370 Ga0268266_10055594
371 Ga0268265_10009640
372 Ga0265318_10000176
373 Ga0265323_10017911
374 Ga0265324_10001018
375 Ga0265330_10000246
376 Ga0265330_10001195
377 Ga0265330_10001697
378 Ga0265332_10000564
379 Ga0265332_10004486
380 Ga0265328_10001790
381 Ga0265320_10000153
382 Ga0265320_10020572
383 Ga0265340_10020519
384 Ga0265339_10000002
385 Ga0265339_10016623
386 Ga0265331_10000448
387 Ga0265316_10003836
388 Ga0265316_10025577
389 Ga0265316_10040270
390 Ga0265316_10056590
391 Ga0307408_100007759
392 Ga0265313_10000264
393 Ga0265313_10017051
394 Ga0265314_10000228
395 Ga0265314_10029417
396 Ga0265342_10000423
397 Ga0265342_10006550
398 Ga0265342_10008992
399 Ga0265342_10014796
400 Ga0307410_10045903
401 Ga0307409_100070614
402 Ga0373950_0000006
403 Ga0373950_0000013
404 Ga0373954_0003542
405 Ga0373954_0004268
406 Ga0373956_0008197
407 Ga0373933_0000090
408 Ga0373937_0002339
409 Ga0373937_0004499
410 Ga0451577_0000227
411 Ga0451577_0039210
412 Ga0453683_0003866
413 Ga0453684_0000033
414 Ga0453684_0000067
415 Ga0453684_0000116
416 Ga0453684_0024660
417 Ga0451576_0004964
418 Ga0451576_0008389
419 Ga0451576_0027021
420 Ga0495592_0000006
421 Ga0495580_0110798
422 Ga0495662_0032621
423 Ga0495664_0024161
424 Ga0495618_0001565
425 Ga0495628_0000541
426 Ga0495652_0013589
427 Ga0495586_0001167
428 Ga0495634_0001620
429 Ga0495674_0002025
430 Ga0495674_0005374
431 Ga0496101_0096549
432 Ga0496105_0065216
433 Ga0496109_0020827
434 Ga0496112_0053927
435 Ga0496114_0000692
436 Ga0496114_0001148
437 Ga0496114_0004189
438 Ga0496114_0082639
439 Ga0496115_0024026
440 Ga0501034_0000093
441 Ga0501034_0002143
442 Ga0501040_0054384
443 Ga0501041_0025725
444 Ga0501043_0000767
445 Ga0501046_0001039
446 Ga0501047_0000500
447 Ga0501048_0004567
448 Ga0501048_0048839
449 Ga0501067_0000022
450 Ga0501068_0005753
451 Ga0501069_0024287
452 Ga0501070_0000023
453 Ga0501070_0000355
454 Ga0501072_0000049
455 Ga0501073_0001309
456 Ga0501073_0018543
457 Ga0501074_0003858
458 Ga0501077_0000337
459 Ga0501079_0001818
460 Ga0501079_0004858
461 Ga0501079_0021279
462 Ga0501079_0024300
463 Ga0501079_0029842
464 Ga0501079_0077572
465 Ga0501080_0002044
466 Ga0501080_0049133
467 Ga0501080_0188744
468 Ga0501083_0000424
469 Ga0501083_0009853
470 Ga0501035_0000173
471 Ga0501044_0125567
472 nmdc:mga05p37_91004_c1
473 nmdc:mga0qj67_148026_c1
474 nmdc:mga0qj67_55118_c1
475 nmdc:mga0qj67_57329_c1
476 nmdc:mga0qj67_63716_c1
477 nmdc:mga06r32_42017_c1
478 nmdc:mga06r32_96856_c1
479 nmdc:mga08y16_7995_c1
480 nmdc:mga0n895_33264_c1
481 nmdc:mga0n895_6056_c1
482 nmdc:mga0rr50_73800_c1
483 nmdc:mga08x19_38439_c1
484 nmdc:mga0a205_52708_c1
485 Ga0495601_0073001
486 Ga0501084_0000411
487 Ga0501082_0015357
488 Ga0501082_0095629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02080

TrkA_C

TrkA-C domain

648

715

0.95

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

45

198

0.94

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

192

374

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jxo-assembly1.cif.gz_B crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima 0.9309 600 672
7b5u-assembly1.cif.gz_B rck_c domain dimer of s.agalactiae busr in complex with c-di-amp 0.9215 600 669
4j91-assembly1.cif.gz_B-2 diamond-shaped octameric structure of ktra with adp bound 0.8722 597 665
4bwz-assembly1.cif.gz_A crystal structure of the sodium proton antiporter, napa 0.8681 5 389
5f29-assembly1.cif.gz_A structure of rck domain with cda 0.8666 600 670
ID Description Score Start End Superfamily
af_Q58752_261_343_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9655 600 670 3.30.70.1450
af_O05882_87_159_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9593 601 670 3.30.70.1450
4j91A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9451 611 665 3.30.70.1450
2bkpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9337 600 669 3.30.70.1450
2fy8C03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9238 600 669 3.30.70.1450
ID Description Score Start End GO Terms
AF-A0A7V4IXA6-F1-model_v4 Cation/H+ exchanger domain-containing protein 0.9641 1 379 GO:0015297
GO:0016020
GO:1902600
AF-A0A4Q5UJ92-F1-model_v4 Cation:proton antiporter 0.9564 6 278 GO:0015297
GO:0016020
GO:1902600
AF-A0A836Q9I4-F1-model_v4 Portal protein 0.9515 11 391 GO:0015297
GO:0016020
GO:1902600
AF-A0A7W9W4Q6-F1-model_v4 CPA2 family monovalent cation:H+ antiporter-2 0.9461 4 405 GO:0006813
GO:0015297
GO:0016020
GO:1902600
AF-A0A6N0NMW3-F1-model_v4 deleted 0.9437 10 388

Map