F357382

General Info

Members Datasets Scaffolds Average Seq Length
245 159 490 366

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10058003|Ga0157372_100580034
Length 383
Sequence MFFTAPAIETTPLSTIAKPEIVRTEGIPTTMQAAVYHGQDDVRLETVPVPEIGPGEVLIRVHTCGICGTDLKKIATGSHSAPRIFGHETAGKIVAVGAGVEKFRIGDRVMVFHHIPCGECFYCRHKVFAQCPVYKKVGATAGFEPSGGGFAEYVRAMDWIVRQGVVRIPDGISYEQASFVEPVNTCMKAIESLRVETGEVAFIIGQGPIGIMLAVLAKRAGATVVTSDLYPQRLRISGSYGLMHNVDASQADPAALVRRLTDGRGADVVILATAGNSLIRPAMDAARPGGRVMLFAQTQRSEAVIDPAAVCMDEKMLLGSYSASVDLQEENVRLVFSGEIDFARLVTHRFSLQQAVEALRLAAHPAPDSMKVVIQPGMEWDRN

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.12
Rhizosphere 93.06
Stem 0
Stem Tuber 0
Unclassified 19.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10058003 3300013307 Unclassified 4328
2 Ga0058863_11275149 3300004799 Unclassified 3156
3 Ga0070658_10106381 3300005327 Bacteria 2321
4 Ga0070683_100105453 3300005329 Bacteria 2657
5 Ga0070680_100006703 3300005336 Bacteria 8769
6 Ga0068868_100009674 3300005338 Bacteria 6958
7 Ga0070709_10030117 3300005434 Bacteria 3253
8 Ga0070714_100020195 3300005435 Bacteria 5437
9 Ga0070713_100001367 3300005436 Bacteria 15599
10 Ga0070713_100067425 3300005436 Bacteria 3013
11 Ga0070710_10031902 3300005437 Bacteria 2849
12 Ga0070711_100020538 3300005439 Bacteria 4257
13 Ga0070711_100105667 3300005439 Bacteria 2057
14 Ga0070708_100065113 3300005445 Bacteria 3267
15 Ga0070681_10001954 3300005458 Bacteria 18621
16 Ga0070681_10025159 3300005458 Bacteria 5990
17 Ga0070681_10228008 3300005458 Bacteria 1777
18 Ga0070681_10345762 3300005458 Unclassified 1397
19 Ga0070681_10468235 3300005458 Unclassified 1173
20 Ga0070679_100017349 3300005530 Bacteria 6969
21 Ga0070679_100051073 3300005530 Unclassified 4118
22 Ga0070679_100153535 3300005530 Bacteria 2278
23 Ga0070679_100233801 3300005530 Bacteria 1797
24 Ga0070684_100028447 3300005535 Bacteria 4728
25 Ga0068855_100069148 3300005563 Bacteria 4109
26 Ga0068855_100195510 3300005563 Bacteria 2279
27 Ga0068857_100190266 3300005577 Unclassified 1869
28 Ga0068856_100021737 3300005614 Bacteria 6234
29 Ga0068852_100017759 3300005616 Bacteria 5589
30 Ga0068863_100001843 3300005841 Bacteria 21076
31 Ga0068863_100016571 3300005841 Bacteria 7071
32 Ga0068858_100122087 3300005842 Bacteria 2437
33 Ga0070717_10008710 3300006028 Bacteria 7591
34 Ga0070717_10098569 3300006028 Bacteria 2478
35 Ga0070717_10171103 3300006028 Bacteria 1889
36 Ga0070717_10176261 3300006028 Unclassified 1862
37 Ga0070716_100000657 3300006173 Bacteria 14704
38 Ga0070712_100022330 3300006175 Bacteria 4168
39 Ga0070712_100026388 3300006175 Bacteria 3869
40 Ga0068871_100016429 3300006358 Bacteria 5573
41 Ga0075428_100348224 3300006844 Unclassified 1590
42 Ga0075434_100005103 3300006871 Bacteria 11925
43 Ga0075434_100005612 3300006871 Bacteria 11436
44 Ga0075434_100083686 3300006871 Bacteria 3188
45 Ga0075434_100318710 3300006871 Bacteria 1575
46 Ga0075436_100021019 3300006914 Bacteria 4478
47 Ga0075436_100048735 3300006914 Bacteria 2923
48 Ga0075435_100025355 3300007076 Bacteria 4615
49 Ga0075435_100079614 3300007076 Bacteria 2689
50 Ga0099794_10007195 3300007265 Bacteria 4557
51 Ga0099794_10016907 3300007265 Bacteria 3243
52 Ga0099794_10019172 3300007265 Unclassified 3077
53 Ga0099794_10035715 3300007265 Bacteria 2347
54 Ga0105240_10153578 3300009093 Bacteria 2740
55 Ga0105240_10212565 3300009093 Unclassified 2259
56 Ga0114129_10000412 3300009147 Bacteria 50533
57 Ga0105241_10064612 3300009174 Bacteria 2826
58 Ga0105241_10107027 3300009174 Unclassified 2233
59 Ga0105241_10115374 3300009174 Bacteria 2156
60 Ga0105237_10294681 3300009545 Bacteria 1625
61 Ga0105238_10072339 3300009551 Bacteria 3444
62 Ga0099796_10000805 3300010159 Bacteria 5688
63 Ga0105239_10036427 3300010375 Bacteria 5402
64 Ga0157370_10071359 3300013104 Unclassified 3276
65 Ga0157370_10257000 3300013104 Bacteria 1615
66 Ga0157369_10058885 3300013105 Unclassified 4143
67 Ga0157374_10088287 3300013296 Unclassified 2953
68 Ga0157374_10348639 3300013296 Bacteria 1471
69 Ga0157378_10012843 3300013297 Bacteria 7330
70 Ga0157375_10350898 3300013308 Bacteria 1641
71 Ga0163163_10033240 3300014325 Bacteria 4988
72 Ga0157379_10040303 3300014968 Bacteria 4168
73 Ga0157376_10000016 3300014969 Bacteria 271570
74 Ga0182007_10022868 3300015262 Bacteria 2203
75 Ga0206350_10882384 3300020080 Unclassified 1474
76 Ga0154015_1015379 3300020610 Bacteria 2766
77 Ga0224572_1020267 3300024225 Bacteria 1277
78 Ga0207692_10028525 3300025898 Bacteria 2641
79 Ga0207699_10025769 3300025906 Bacteria 3233
80 Ga0207699_10040590 3300025906 Bacteria 2682
81 Ga0207699_10060069 3300025906 Bacteria 2281
82 Ga0207699_10180904 3300025906 Unclassified 1417
83 Ga0207707_10000757 3300025912 Bacteria 31814
84 Ga0207707_10167782 3300025912 Bacteria 1918
85 Ga0207693_10032696 3300025915 Unclassified 4105
86 Ga0207663_10025183 3300025916 Bacteria 3435
87 Ga0207663_10036876 3300025916 Bacteria 2943
88 Ga0207663_10102544 3300025916 Unclassified 1925
89 Ga0207663_10213055 3300025916 Bacteria 1401
90 Ga0207660_10000685 3300025917 Bacteria 22663
91 Ga0207652_10013016 3300025921 Bacteria 6734
92 Ga0207652_10232143 3300025921 Bacteria 1663
93 Ga0207646_10075614 3300025922 Bacteria 3009
94 Ga0207694_10062256 3300025924 Unclassified 2905
95 Ga0207687_10010313 3300025927 Bacteria 6105
96 Ga0207687_10017389 3300025927 Unclassified 4734
97 Ga0207700_10004508 3300025928 Bacteria 8224
98 Ga0207700_10013249 3300025928 Bacteria 5356
99 Ga0207700_10052841 3300025928 Bacteria 3040
100 Ga0207700_10187186 3300025928 Bacteria 1737
101 Ga0207664_10011386 3300025929 Bacteria 6320
102 Ga0207664_10027544 3300025929 Unclassified 4310
103 Ga0207664_10293873 3300025929 Unclassified 1428
104 Ga0207686_10073214 3300025934 Bacteria 2210
105 Ga0207665_10005426 3300025939 Bacteria 8514
106 Ga0207665_10012655 3300025939 Bacteria 5547
107 Ga0207667_10149941 3300025949 Bacteria 2400
108 Ga0207667_10181149 3300025949 Unclassified 2164
109 Ga0207667_10342153 3300025949 Unclassified 1526
110 Ga0207677_10099318 3300026023 Unclassified 2137
111 Ga0207703_10129514 3300026035 Bacteria 2177
112 Ga0207703_10235468 3300026035 Bacteria 1643
113 Ga0207674_10048204 3300026116 Bacteria 4361
114 Ga0207698_10027363 3300026142 Unclassified 4047
115 Ga0209588_1014628 3300027671 Bacteria 2405
116 Ga0265319_1000256 3300028563 Bacteria 40127
117 Ga0265318_10000240 3300028577 Bacteria 47828
118 Ga0265330_10038034 3300031235 Bacteria 2140
119 Ga0265332_10001438 3300031238 Bacteria 13354
120 Ga0265320_10000124 3300031240 Bacteria 67180
121 Ga0265329_10001399 3300031242 Bacteria 11692
122 Ga0265340_10000460 3300031247 Bacteria 22056
123 Ga0265339_10000628 3300031249 Bacteria 27303
124 Ga0265331_10000232 3300031250 Bacteria 67206
125 Ga0265316_10001230 3300031344 Bacteria 27548
126 Ga0265316_10148297 3300031344 Unclassified 1758
127 Ga0265313_10001694 3300031595 Bacteria 20336
128 Ga0265313_10031099 3300031595 Unclassified 2739
129 Ga0265314_10033836 3300031711 Unclassified 3740
130 Ga0265314_10048591 3300031711 Unclassified 2977
131 Ga0265342_10000198 3300031712 Bacteria 67185
132 Ga0373934_0000422 3300035086 Bacteria 14814
133 Ga0373945_0025162 3300035116 Bacteria 2067
134 Ga0373953_0000711 3300035117 Bacteria 9218
135 Ga0373954_0000420 3300035118 Bacteria 15832
136 Ga0373954_0068912 3300035118 Bacteria 1679
137 Ga0373957_0008397 3300035120 Bacteria 3343
138 Ga0373943_0032810 3300035170 Bacteria 2470
139 Ga0373946_0006538 3300035171 Unclassified 4229
140 Ga0373946_0038533 3300035171 Bacteria 1947
141 Ga0373955_0030077 3300035172 Bacteria 2831
142 Ga0373924_0000689 3300035410 Bacteria 10503
143 Ga0373924_0041948 3300035410 Unclassified 1876
144 Ga0373927_0010496 3300035695 Bacteria 6174
145 Ga0373933_0001987 3300035724 Bacteria 11801
146 Ga0373947_0092730 3300035725 Bacteria 1886
147 Ga0373937_0000422 3300036401 Bacteria 39461
148 Ga0373937_0004554 3300036401 Bacteria 11767
149 Ga0373937_0008779 3300036401 Bacteria 8771
150 Ga0373937_0078874 3300036401 Bacteria 3043
151 Ga0373937_0089044 3300036401 Bacteria 2858
152 Ga0373925_0001928 3300037068 Bacteria 17179
153 Ga0373925_0130638 3300037068 Bacteria 1958
154 Ga0395898_0067817 3300037466 Bacteria 3453
155 Ga0395905_0014958 3300037471 Bacteria 7400
156 Ga0395905_0046343 3300037471 Bacteria 4076
157 Ga0395905_0108474 3300037471 Bacteria 2606
158 Ga0395901_0241973 3300038443 Bacteria 1882
159 Ga0395901_0308293 3300038443 Unclassified 1640
160 Ga0436360_1128166 3300039438 Unclassified 1665
161 Ga0436363_0186529 3300039450 Bacteria 6407
162 Ga0436363_1601568 3300039450 Bacteria 6992
163 Ga0436362_0430170 3300039453 Bacteria 2209
164 Ga0451577_0000157 3300042876 Bacteria 151953
165 Ga0453683_0049650 3300044673 Unclassified 2630
166 Ga0466963_0000297 3300044694 Bacteria 22355
167 Ga0466963_0194059 3300044694 Bacteria 1419
168 Ga0453684_0001152 3300044712 Bacteria 82543
169 Ga0466957_0171380 3300044842 Bacteria 1414
170 Ga0466959_0067072 3300045049 Bacteria 2602
171 Ga0451576_0027039 3300045051 Bacteria 6166
172 Ga0466967_0002509 3300045976 Bacteria 11470
173 Ga0466967_0091561 3300045976 Bacteria 2764
174 Ga0466967_0096398 3300045976 Bacteria 2698
175 Ga0495592_0070132 3300046454 Unclassified 2555
176 Ga0495603_0018008 3300046455 Bacteria 4274
177 Ga0495641_0032521 3300046461 Bacteria 2482
178 Ga0495651_0022136 3300046462 Bacteria 4942
179 Ga0495651_0206247 3300046462 Bacteria 1372
180 Ga0495580_0045273 3300046472 Bacteria 3126
181 Ga0495580_0064775 3300046472 Bacteria 2561
182 Ga0495580_0121256 3300046472 Bacteria 1815
183 Ga0495582_0024831 3300046473 Bacteria 3282
184 Ga0495582_0092060 3300046473 Bacteria 1691
185 Ga0495639_0014790 3300046475 Bacteria 3381
186 Ga0495639_0056896 3300046475 Bacteria 1786
187 Ga0495664_0180705 3300046477 Bacteria 1279
188 Ga0495594_0048408 3300046499 Bacteria 2335
189 Ga0495628_0080323 3300046516 Bacteria 2535
190 Ga0495630_0029266 3300046517 Unclassified 4094
191 Ga0495666_0016139 3300046526 Bacteria 3718
192 Ga0495665_0028509 3300046531 Bacteria 2994
193 Ga0495640_0116241 3300046533 Bacteria 1742
194 Ga0495587_0006152 3300046536 Bacteria 7834
195 Ga0495587_0187795 3300046536 Bacteria 1171
196 Ga0495645_0040928 3300046543 Bacteria 3379
197 Ga0495634_0095799 3300046642 Bacteria 1922
198 Ga0495635_0049095 3300046663 Bacteria 2909
199 Ga0495635_0181758 3300046663 Bacteria 1429
200 Ga0495657_0129129 3300046675 Unclassified 1585
201 Ga0495599_0123264 3300046678 Bacteria 1611
202 Ga0495623_0034209 3300046679 Bacteria 3259
203 Ga0495647_0010907 3300046681 Bacteria 3104
204 Ga0495658_0002169 3300046683 Bacteria 9926
205 Ga0495669_0028389 3300046684 Unclassified 2451
206 Ga0495669_0032202 3300046684 Bacteria 2304
207 Ga0495613_0007859 3300046689 Bacteria 7931
208 Ga0495613_0029799 3300046689 Bacteria 4056
209 Ga0495581_0007708 3300047315 Bacteria 6230
210 Ga0495581_0012072 3300047315 Bacteria 4999
211 Ga0495581_0013138 3300047315 Bacteria 4801
212 Ga0495604_0010966 3300047317 Bacteria 7194
213 Ga0495604_0084973 3300047317 Unclassified 2362
214 Ga0495674_0128272 3300047319 Bacteria 2138
215 Ga0495675_0012765 3300047444 Bacteria 5291
216 Ga0495675_0102429 3300047444 Bacteria 1791
217 Ga0495684_0004713 3300047471 Bacteria 10647
218 Ga0495684_0011327 3300047471 Bacteria 6885
219 Ga0495602_0012835 3300048088 Bacteria 8588
220 Ga0495602_0213399 3300048088 Unclassified 1463
221 Ga0495602_0241891 3300048088 Bacteria 1350
222 Ga0495614_0009880 3300048089 Bacteria 4213
223 Ga0496102_0090788 3300048905 Unclassified 2827
224 Ga0496103_0096662 3300048906 Unclassified 1866
225 Ga0496103_0223559 3300048906 Unclassified 1211
226 Ga0496105_0144648 3300048908 Bacteria 1955
227 Ga0496108_0042641 3300048911 Bacteria 3788
228 Ga0496109_0075721 3300048912 Unclassified 3094
229 Ga0496110_0037608 3300048913 Bacteria 4207
230 Ga0496111_0000856 3300048914 Bacteria 16481
231 Ga0496112_0000986 3300048915 Bacteria 20797
232 Ga0496112_0003452 3300048915 Bacteria 13055
233 Ga0496112_0086568 3300048915 Bacteria 3100
234 Ga0496113_0001708 3300048916 Bacteria 12430
235 Ga0496114_0014991 3300048917 Bacteria 6231
236 Ga0496115_0030660 3300048918 Bacteria 4232
237 Ga0496115_0060698 3300048918 Bacteria 3047
238 Ga0501073_0036262 3300049589 Unclassified 3504
239 nmdc:mga05p37_2616_c1 3300050507 Bacteria 20950
240 nmdc:mga0n895_13572_c1 3300050512 Bacteria 7359
241 nmdc:mga0n895_2334_c1 3300050512 Bacteria 14785
242 nmdc:mga0rr50_38703_c1 3300050513 Bacteria 3453
243 Ga0495601_0033871 3300053077 Bacteria 3183
244 Ga0495619_0020694 3300053085 Bacteria 4194
245 Ga0495619_0095254 3300053085 Unclassified 2020
246 Ga0157372_10058003
247 Ga0058863_11275149
248 Ga0070658_10106381
249 Ga0070683_100105453
250 Ga0070680_100006703
251 Ga0068868_100009674
252 Ga0070709_10030117
253 Ga0070714_100020195
254 Ga0070713_100001367
255 Ga0070713_100067425
256 Ga0070710_10031902
257 Ga0070711_100020538
258 Ga0070711_100105667
259 Ga0070708_100065113
260 Ga0070681_10001954
261 Ga0070681_10025159
262 Ga0070681_10228008
263 Ga0070681_10345762
264 Ga0070681_10468235
265 Ga0070679_100017349
266 Ga0070679_100051073
267 Ga0070679_100153535
268 Ga0070679_100233801
269 Ga0070684_100028447
270 Ga0068855_100069148
271 Ga0068855_100195510
272 Ga0068857_100190266
273 Ga0068856_100021737
274 Ga0068852_100017759
275 Ga0068863_100001843
276 Ga0068863_100016571
277 Ga0068858_100122087
278 Ga0070717_10008710
279 Ga0070717_10098569
280 Ga0070717_10171103
281 Ga0070717_10176261
282 Ga0070716_100000657
283 Ga0070712_100022330
284 Ga0070712_100026388
285 Ga0068871_100016429
286 Ga0075428_100348224
287 Ga0075434_100005103
288 Ga0075434_100005612
289 Ga0075434_100083686
290 Ga0075434_100318710
291 Ga0075436_100021019
292 Ga0075436_100048735
293 Ga0075435_100025355
294 Ga0075435_100079614
295 Ga0099794_10007195
296 Ga0099794_10016907
297 Ga0099794_10019172
298 Ga0099794_10035715
299 Ga0105240_10153578
300 Ga0105240_10212565
301 Ga0114129_10000412
302 Ga0105241_10064612
303 Ga0105241_10107027
304 Ga0105241_10115374
305 Ga0105237_10294681
306 Ga0105238_10072339
307 Ga0099796_10000805
308 Ga0105239_10036427
309 Ga0157370_10071359
310 Ga0157370_10257000
311 Ga0157369_10058885
312 Ga0157374_10088287
313 Ga0157374_10348639
314 Ga0157378_10012843
315 Ga0157375_10350898
316 Ga0163163_10033240
317 Ga0157379_10040303
318 Ga0157376_10000016
319 Ga0182007_10022868
320 Ga0206350_10882384
321 Ga0154015_1015379
322 Ga0224572_1020267
323 Ga0207692_10028525
324 Ga0207699_10025769
325 Ga0207699_10040590
326 Ga0207699_10060069
327 Ga0207699_10180904
328 Ga0207707_10000757
329 Ga0207707_10167782
330 Ga0207693_10032696
331 Ga0207663_10025183
332 Ga0207663_10036876
333 Ga0207663_10102544
334 Ga0207663_10213055
335 Ga0207660_10000685
336 Ga0207652_10013016
337 Ga0207652_10232143
338 Ga0207646_10075614
339 Ga0207694_10062256
340 Ga0207687_10010313
341 Ga0207687_10017389
342 Ga0207700_10004508
343 Ga0207700_10013249
344 Ga0207700_10052841
345 Ga0207700_10187186
346 Ga0207664_10011386
347 Ga0207664_10027544
348 Ga0207664_10293873
349 Ga0207686_10073214
350 Ga0207665_10005426
351 Ga0207665_10012655
352 Ga0207667_10149941
353 Ga0207667_10181149
354 Ga0207667_10342153
355 Ga0207677_10099318
356 Ga0207703_10129514
357 Ga0207703_10235468
358 Ga0207674_10048204
359 Ga0207698_10027363
360 Ga0209588_1014628
361 Ga0265319_1000256
362 Ga0265318_10000240
363 Ga0265330_10038034
364 Ga0265332_10001438
365 Ga0265320_10000124
366 Ga0265329_10001399
367 Ga0265340_10000460
368 Ga0265339_10000628
369 Ga0265331_10000232
370 Ga0265316_10001230
371 Ga0265316_10148297
372 Ga0265313_10001694
373 Ga0265313_10031099
374 Ga0265314_10033836
375 Ga0265314_10048591
376 Ga0265342_10000198
377 Ga0373934_0000422
378 Ga0373945_0025162
379 Ga0373953_0000711
380 Ga0373954_0000420
381 Ga0373954_0068912
382 Ga0373957_0008397
383 Ga0373943_0032810
384 Ga0373946_0006538
385 Ga0373946_0038533
386 Ga0373955_0030077
387 Ga0373924_0000689
388 Ga0373924_0041948
389 Ga0373927_0010496
390 Ga0373933_0001987
391 Ga0373947_0092730
392 Ga0373937_0000422
393 Ga0373937_0004554
394 Ga0373937_0008779
395 Ga0373937_0078874
396 Ga0373937_0089044
397 Ga0373925_0001928
398 Ga0373925_0130638
399 Ga0395898_0067817
400 Ga0395905_0014958
401 Ga0395905_0046343
402 Ga0395905_0108474
403 Ga0395901_0241973
404 Ga0395901_0308293
405 Ga0436360_1128166
406 Ga0436363_0186529
407 Ga0436363_1601568
408 Ga0436362_0430170
409 Ga0451577_0000157
410 Ga0453683_0049650
411 Ga0466963_0000297
412 Ga0466963_0194059
413 Ga0453684_0001152
414 Ga0466957_0171380
415 Ga0466959_0067072
416 Ga0451576_0027039
417 Ga0466967_0002509
418 Ga0466967_0091561
419 Ga0466967_0096398
420 Ga0495592_0070132
421 Ga0495603_0018008
422 Ga0495641_0032521
423 Ga0495651_0022136
424 Ga0495651_0206247
425 Ga0495580_0045273
426 Ga0495580_0064775
427 Ga0495580_0121256
428 Ga0495582_0024831
429 Ga0495582_0092060
430 Ga0495639_0014790
431 Ga0495639_0056896
432 Ga0495664_0180705
433 Ga0495594_0048408
434 Ga0495628_0080323
435 Ga0495630_0029266
436 Ga0495666_0016139
437 Ga0495665_0028509
438 Ga0495640_0116241
439 Ga0495587_0006152
440 Ga0495587_0187795
441 Ga0495645_0040928
442 Ga0495634_0095799
443 Ga0495635_0049095
444 Ga0495635_0181758
445 Ga0495657_0129129
446 Ga0495599_0123264
447 Ga0495623_0034209
448 Ga0495647_0010907
449 Ga0495658_0002169
450 Ga0495669_0028389
451 Ga0495669_0032202
452 Ga0495613_0007859
453 Ga0495613_0029799
454 Ga0495581_0007708
455 Ga0495581_0012072
456 Ga0495581_0013138
457 Ga0495604_0010966
458 Ga0495604_0084973
459 Ga0495674_0128272
460 Ga0495675_0012765
461 Ga0495675_0102429
462 Ga0495684_0004713
463 Ga0495684_0011327
464 Ga0495602_0012835
465 Ga0495602_0213399
466 Ga0495602_0241891
467 Ga0495614_0009880
468 Ga0496102_0090788
469 Ga0496103_0096662
470 Ga0496103_0223559
471 Ga0496105_0144648
472 Ga0496108_0042641
473 Ga0496109_0075721
474 Ga0496110_0037608
475 Ga0496111_0000856
476 Ga0496112_0000986
477 Ga0496112_0003452
478 Ga0496112_0086568
479 Ga0496113_0001708
480 Ga0496114_0014991
481 Ga0496115_0030660
482 Ga0496115_0060698
483 Ga0501073_0036262
484 nmdc:mga05p37_2616_c1
485 nmdc:mga0n895_13572_c1
486 nmdc:mga0n895_2334_c1
487 nmdc:mga0rr50_38703_c1
488 Ga0495601_0033871
489 Ga0495619_0020694
490 Ga0495619_0095254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

208

337

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

53

170

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bz0-assembly2.cif.gz_C 1.83 angstrom resolution crystal structure of dihydrolipoyl dehydrogenase from acinetobacter baumannii in complex with fad. 0.9588 169 199
6hg8-assembly1.cif.gz_A crystal structure of the r460g disease-causing mutant of the human dihydrolipoamide dehydrogenase. 0.9558 169 200
7psc-assembly1.cif.gz_B crystal structure of the disease-causing i358t mutant of the human dihydrolipoamide dehydrogenase 0.9553 169 200
2f5z-assembly5.cif.gz_I crystal structure of human dihydrolipoamide dehydrogenase (e3) complexed to the e3-binding domain of human e3-binding protein 0.9499 169 200
2hqm-assembly1.cif.gz_B crystal structure of glutathione reductase glr1 from the yeast saccharomyces cerevisiae 0.9255 169 201
ID Description Score Start End Superfamily
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9838 169 201 3.50.50.60
af_A0A1D6LFB7_44_430_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9328 167 198 3.50.50.60
af_Q54GT1_13_197_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9327 169 201 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9124 169 201 3.50.50.60
af_A0A1D6HR89_2_270_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.911 166 201 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2V7Y1K7-F1-model_v4 Zn-dependent alcohol dehydrogenase 0.9803 1 227 GO:0016491
AF-A0A2V7Y1K7-F1-model_v4 Zn-dependent alcohol dehydrogenase 0.976 1 227 GO:0016491
AF-A0A2V9ZY70-F1-model_v4 Zn-dependent alcohol dehydrogenase 0.971 1 87 GO:0008270
GO:0016491
AF-A0A419JSK7-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.964 163 262
AF-A0A0T6A570-F1-model_v4 Alcohol dehydrogenase (EC 1.1.1.1) 0.9515 1 345 GO:0004022
GO:0008270

Map