F357355

General Info

Members Datasets Scaffolds Average Seq Length
245 112 245 168

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10149632|Ga0157371_101496322
Length 177
Sequence LAAAGGVRVSITYRTATVADVPAIDRVFRASFCDTFAHLYRPQDLTAFLAKFTNRAWTEEITDLRYAFRLAEDDGEAVGYVKLGPSSLPVQANGSAIELRQLYVLSSHLGTGVGAELTDWALAEARRRGVEELYLTVYTDNHRARRFYARYGFEELGPYAFMVGEQADEDIIMRLKL

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.82
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10091526 3300001990 Bacteria 902
2 JGI24735J21928_10045443 3300002067 Bacteria 1275
3 Ga0065715_10254933 3300005293 Bacteria 1155
4 Ga0070658_10001377 3300005327 Bacteria 20794
5 Ga0070658_10155075 3300005327 Bacteria 1919
6 Ga0070658_10157000 3300005327 Bacteria 1907
7 Ga0070658_10309497 3300005327 Bacteria 1348
8 Ga0070658_10555004 3300005327 Bacteria 994
9 Ga0070676_10071115 3300005328 Bacteria 2089
10 Ga0070683_100020418 3300005329 Bacteria 5895
11 Ga0070670_100013105 3300005331 Bacteria 7103
12 Ga0070670_100019951 3300005331 Bacteria 5755
13 Ga0070677_10001320 3300005333 Bacteria 7929
14 Ga0070666_10550421 3300005335 Unclassified 839
15 Ga0070680_100580164 3300005336 Bacteria 962
16 Ga0070660_100003719 3300005339 Bacteria 10539
17 Ga0070660_100006841 3300005339 Bacteria 7911
18 Ga0070660_100057475 3300005339 Bacteria 3013
19 Ga0070660_100064868 3300005339 Bacteria 2842
20 Ga0070660_100137494 3300005339 Bacteria 1958
21 Ga0070660_100350729 3300005339 Bacteria 1215
22 Ga0070660_101090874 3300005339 Bacteria 675
23 Ga0070661_100156256 3300005344 Bacteria 1726
24 Ga0070661_100159766 3300005344 Bacteria 1706
25 Ga0070661_100238291 3300005344 Bacteria 1400
26 Ga0070692_10000978 3300005345 Bacteria 9776
27 Ga0070692_10036243 3300005345 Bacteria 2502
28 Ga0070668_100028258 3300005347 Bacteria 4259
29 Ga0070669_100008938 3300005353 Bacteria 7149
30 Ga0070669_100015859 3300005353 Bacteria 5375
31 Ga0070675_100047512 3300005354 Bacteria 3517
32 Ga0070675_100227355 3300005354 Bacteria 1627
33 Ga0070675_100957903 3300005354 Bacteria 785
34 Ga0070671_100001816 3300005355 Bacteria 16240
35 Ga0070671_100081390 3300005355 Bacteria 2707
36 Ga0070671_100868630 3300005355 Bacteria 787
37 Ga0070674_100091794 3300005356 Bacteria 2194
38 Ga0070673_100160043 3300005364 Bacteria 1914
39 Ga0070673_100238129 3300005364 Bacteria 1581
40 Ga0070673_100479775 3300005364 Bacteria 1122
41 Ga0070659_100003241 3300005366 Bacteria 11581
42 Ga0070667_100205313 3300005367 Bacteria 1749
43 Ga0070663_100038735 3300005455 Bacteria 3327
44 Ga0070678_100015996 3300005456 Bacteria 4783
45 Ga0070678_100128361 3300005456 Bacteria 2010
46 Ga0070662_100077635 3300005457 Bacteria 2465
47 Ga0070662_100088478 3300005457 Bacteria 2321
48 Ga0070681_10090131 3300005458 Bacteria 3017
49 Ga0068867_100058224 3300005459 Bacteria 2863
50 Ga0068867_100616467 3300005459 Bacteria 948
51 Ga0070679_100000008 3300005530 Bacteria 194672
52 Ga0070684_100033668 3300005535 Bacteria 4376
53 Ga0068853_100102660 3300005539 Bacteria 2530
54 Ga0070672_100027584 3300005543 Bacteria 4238
55 Ga0070686_100376597 3300005544 Unclassified 1073
56 Ga0070665_100075981 3300005548 Bacteria 3366
57 Ga0070665_100197227 3300005548 Bacteria 2014
58 Ga0070664_100002940 3300005564 Bacteria 13775
59 Ga0068854_100880247 3300005578 Unclassified 786
60 Ga0068856_100755003 3300005614 Bacteria 993
61 Ga0068852_100024978 3300005616 Bacteria 4836
62 Ga0068870_10064438 3300005840 Bacteria 1979
63 Ga0068863_100779344 3300005841 Bacteria 953
64 Ga0068863_102217733 3300005841 Bacteria 559
65 Ga0157371_10013797 3300013102 Bacteria 6121
66 Ga0157371_10149632 3300013102 Unclassified 1664
67 Ga0157370_10190045 3300013104 Bacteria 1906
68 Ga0157370_11180164 3300013104 Bacteria 691
69 Ga0157369_10008450 3300013105 Bacteria 11809
70 Ga0157369_10032870 3300013105 Bacteria 5702
71 Ga0157374_11680719 3300013296 Unclassified 659
72 Ga0157372_11129403 3300013307 Bacteria 906
73 Ga0157380_10005985 3300014326 Bacteria 8510
74 Ga0157380_10722481 3300014326 Bacteria 1004
75 Ga0206354_10413920 3300020081 Bacteria 1330
76 Ga0206353_11288468 3300020082 Bacteria 4619
77 Ga0213873_10000012 3300021358 Bacteria 210531
78 Ga0213876_10000021 3300021384 Bacteria 260105
79 Ga0213876_10000863 3300021384 Bacteria 20272
80 Ga0213876_10051408 3300021384 Bacteria 2178
81 Ga0207697_10295525 3300025315 Bacteria 718
82 Ga0207682_10007220 3300025893 Bacteria 4443
83 Ga0207682_10037745 3300025893 Bacteria 1958
84 Ga0207688_10080834 3300025901 Bacteria 1855
85 Ga0207688_10163293 3300025901 Bacteria 1321
86 Ga0207645_10371397 3300025907 Bacteria 959
87 Ga0207643_10060508 3300025908 Bacteria 2162
88 Ga0207705_10000002 3300025909 Bacteria 2046852
89 Ga0207705_10002088 3300025909 Bacteria 15529
90 Ga0207705_10019495 3300025909 Bacteria 4850
91 Ga0207705_10021171 3300025909 Bacteria 4638
92 Ga0207705_10335556 3300025909 Bacteria 1163
93 Ga0207705_10353156 3300025909 Bacteria 1133
94 Ga0207705_10403790 3300025909 Bacteria 1057
95 Ga0207705_10436578 3300025909 Bacteria 1014
96 Ga0207707_10007643 3300025912 Bacteria 9417
97 Ga0207660_10008606 3300025917 Bacteria 6600
98 Ga0207660_11001343 3300025917 Bacteria 682
99 Ga0207657_10056280 3300025919 Bacteria 3394
100 Ga0207657_10082400 3300025919 Bacteria 2700
101 Ga0207657_10116535 3300025919 Bacteria 2201
102 Ga0207649_10000038 3300025920 Bacteria 129260
103 Ga0207649_10011003 3300025920 Bacteria 4977
104 Ga0207649_10080584 3300025920 Bacteria 2106
105 Ga0207652_10000008 3300025921 Bacteria 286698
106 Ga0207652_10235169 3300025921 Bacteria 1651
107 Ga0207652_10395371 3300025921 Bacteria 1247
108 Ga0207681_10016147 3300025923 Bacteria 4665
109 Ga0207681_10034991 3300025923 Bacteria 3307
110 Ga0207681_10092722 3300025923 Bacteria 2160
111 Ga0207650_10034190 3300025925 Bacteria 3686
112 Ga0207650_10051589 3300025925 Bacteria 3044
113 Ga0207650_10836627 3300025925 Bacteria 781
114 Ga0207659_10003141 3300025926 Bacteria 9875
115 Ga0207644_10005005 3300025931 Bacteria 8651
116 Ga0207690_10002318 3300025932 Bacteria 11610
117 Ga0207706_10037005 3300025933 Bacteria 4334
118 Ga0207706_10077991 3300025933 Bacteria 2913
119 Ga0207706_10083599 3300025933 Bacteria 2806
120 Ga0207669_10133663 3300025937 Bacteria 1709
121 Ga0207691_10051935 3300025940 Bacteria 3745
122 Ga0207691_10388518 3300025940 Bacteria 1191
123 Ga0207661_10063940 3300025944 Bacteria 2981
124 Ga0207679_10083892 3300025945 Bacteria 2444
125 Ga0207651_10177816 3300025960 Bacteria 1685
126 Ga0207651_10183793 3300025960 Bacteria 1661
127 Ga0207651_10183835 3300025960 Bacteria 1661
128 Ga0207712_10537296 3300025961 Bacteria 1004
129 Ga0207668_10104438 3300025972 Bacteria 2112
130 Ga0207668_10193762 3300025972 Bacteria 1613
131 Ga0207668_10476551 3300025972 Bacteria 1070
132 Ga0207639_10022210 3300026041 Bacteria 4568
133 Ga0207678_10117552 3300026067 Bacteria 2269
134 Ga0207678_10224349 3300026067 Bacteria 1609
135 Ga0207702_10705541 3300026078 Bacteria 994
136 Ga0207648_10424836 3300026089 Bacteria 1207
137 Ga0207676_10197394 3300026095 Bacteria 1775
138 Ga0207683_10003583 3300026121 Bacteria 13540
139 Ga0207683_10103872 3300026121 Bacteria 2539
140 Ga0207698_10028385 3300026142 Bacteria 3990
141 Ga0268266_10032942 3300028379 Bacteria 4404
142 Ga0268266_11276054 3300028379 Bacteria 710
143 Ga0307408_100042605 3300031548 Bacteria 3226
144 Ga0307408_100057504 3300031548 Bacteria 2824
145 Ga0307408_100309801 3300031548 Bacteria 1326
146 Ga0307405_10000893 3300031731 Bacteria 11834
147 Ga0307405_10039177 3300031731 Bacteria 2862
148 Ga0307405_10071682 3300031731 Bacteria 2230
149 Ga0307405_10124488 3300031731 Bacteria 1770
150 Ga0307405_10445630 3300031731 Bacteria 1025
151 Ga0307413_10001276 3300031824 Bacteria 9393
152 Ga0307413_10019877 3300031824 Bacteria 3559
153 Ga0307413_10037738 3300031824 Bacteria 2793
154 Ga0307413_10048321 3300031824 Bacteria 2542
155 Ga0307413_10134306 3300031824 Bacteria 1699
156 Ga0307413_10138776 3300031824 Bacteria 1676
157 Ga0307413_10314841 3300031824 Bacteria 1193
158 Ga0307413_10732718 3300031824 Unclassified 824
159 Ga0307410_10009601 3300031852 Bacteria 5438
160 Ga0307410_10052939 3300031852 Bacteria 2744
161 Ga0307410_10110600 3300031852 Bacteria 1987
162 Ga0307410_10113643 3300031852 Bacteria 1963
163 Ga0307410_10204685 3300031852 Unclassified 1509
164 Ga0307410_10214331 3300031852 Bacteria 1477
165 Ga0307410_10263445 3300031852 Bacteria 1345
166 Ga0307410_11486829 3300031852 Unclassified 596
167 Ga0307406_10002193 3300031901 Bacteria 10634
168 Ga0307406_10048131 3300031901 Bacteria 2691
169 Ga0307406_10054372 3300031901 Bacteria 2555
170 Ga0307406_10283177 3300031901 Unclassified 1265
171 Ga0307407_10004996 3300031903 Bacteria 5707
172 Ga0307407_10054931 3300031903 Bacteria 2299
173 Ga0307412_10002006 3300031911 Bacteria 11290
174 Ga0307412_10004772 3300031911 Bacteria 7564
175 Ga0307412_10036599 3300031911 Bacteria 3146
176 Ga0307409_100014835 3300031995 Bacteria 5086
177 Ga0307409_100029646 3300031995 Bacteria 3919
178 Ga0307409_100063032 3300031995 Bacteria 2905
179 Ga0307409_100114299 3300031995 Bacteria 2270
180 Ga0307409_100190217 3300031995 Bacteria 1826
181 Ga0307409_100217758 3300031995 Bacteria 1721
182 Ga0307409_100355129 3300031995 Unclassified 1384
183 Ga0307409_100525044 3300031995 Bacteria 1157
184 Ga0307409_100556289 3300031995 Bacteria 1127
185 Ga0307409_100731719 3300031995 Unclassified 991
186 Ga0307409_101286078 3300031995 Unclassified 756
187 Ga0307416_100002373 3300032002 Bacteria 10776
188 Ga0307416_100252719 3300032002 Bacteria 1717
189 Ga0307416_100330589 3300032002 Bacteria 1531
190 Ga0307416_101116393 3300032002 Unclassified 893
191 Ga0307414_10008668 3300032004 Bacteria 5787
192 Ga0307414_10066264 3300032004 Bacteria 2580
193 Ga0307414_10094941 3300032004 Bacteria 2227
194 Ga0307414_10135528 3300032004 Bacteria 1919
195 Ga0307414_10149961 3300032004 Bacteria 1838
196 Ga0307414_10209471 3300032004 Bacteria 1592
197 Ga0307414_10370259 3300032004 Unclassified 1235
198 Ga0307411_10003495 3300032005 Bacteria 7299
199 Ga0307411_10025467 3300032005 Bacteria 3545
200 Ga0307411_10040222 3300032005 Bacteria 2964
201 Ga0307411_10076290 3300032005 Bacteria 2291
202 Ga0307411_10124094 3300032005 Unclassified 1874
203 Ga0307411_10233011 3300032005 Unclassified 1436
204 Ga0307411_10237955 3300032005 Bacteria 1423
205 Ga0307411_10259428 3300032005 Bacteria 1371
206 Ga0307411_10435785 3300032005 Bacteria 1092
207 Ga0307411_10743249 3300032005 Bacteria 859
208 Ga0307415_100055363 3300032126 Bacteria 2713
209 Ga0395899_0006947 3300037312 Bacteria 8767
210 Ga0395899_0166709 3300037312 Unclassified 1553
211 Ga0395899_0255638 3300037312 Bacteria 1200
212 Ga0395899_0286218 3300037312 Bacteria 1119
213 Ga0395900_0000336 3300037418 Bacteria 69212
214 Ga0395900_0083504 3300037418 Bacteria 3281
215 Ga0395900_0257815 3300037418 Bacteria 1742
216 Ga0395898_0016208 3300037466 Bacteria 7631
217 Ga0395898_0022790 3300037466 Bacteria 6337
218 Ga0395898_0384952 3300037466 Unclassified 1337
219 Ga0395905_0045997 3300037471 Bacteria 4093
220 Ga0395905_0049188 3300037471 Bacteria 3950
221 Ga0395905_0321723 3300037471 Bacteria 1436
222 Ga0395905_0421061 3300037471 Bacteria 1231
223 Ga0395905_0503944 3300037471 Unclassified 1111
224 Ga0395905_1326231 3300037471 Bacteria 623
225 Ga0395901_0002173 3300038443 Bacteria 20032
226 Ga0395901_0111452 3300038443 Bacteria 2873
227 Ga0395901_0159827 3300038443 Bacteria 2366
228 Ga0436365_1360649 3300039437 Bacteria 21586
229 Ga0436365_1794861 3300039437 Bacteria 40929
230 Ga0436365_1902390 3300039437 Bacteria 4486
231 Ga0439449_0075766 3300042007 Bacteria 1240
232 Ga0466972_0093239 3300044658 Bacteria 1427
233 Ga0466963_0127549 3300044694 Bacteria 1755
234 Ga0466957_0139363 3300044842 Bacteria 1562
235 Ga0466958_0800296 3300045836 Bacteria 615
236 Ga0466967_0096585 3300045976 Bacteria 2696
237 Ga0466967_0175035 3300045976 Bacteria 2021
238 Ga0495643_0245474 3300046522 Bacteria 838
239 Ga0495621_0051769 3300046539 Bacteria 1470
240 Ga0495669_0073073 3300046684 Bacteria 1566
241 Ga0495672_0336478 3300047320 Unclassified 705
242 Ga0496101_0276899 3300048904 Bacteria 1311
243 Ga0496102_0958254 3300048905 Unclassified 777
244 nmdc:mga03683_170370_c1 3300050489 Unclassified 989
245 Ga0590071_065828 3300059421 Bacteria 889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0336478 Ga0495672_0336478_240_695 151
2 3300005355 Ga0070671_100081390 Ga0070671_1000813903 157
3 3300031731 Ga0307405_10000893 Ga0307405_100008938 160
4 3300031824 Ga0307413_10001276 Ga0307413_100012768 160
5 3300031901 Ga0307406_10002193 Ga0307406_100021936 160
6 3300031903 Ga0307407_10004996 Ga0307407_100049961 160
7 3300031911 Ga0307412_10002006 Ga0307412_100020067 160
8 3300031995 Ga0307409_100014835 Ga0307409_1000148354 160
9 3300032002 Ga0307416_100002373 Ga0307416_1000023735 160
10 3300032004 Ga0307414_10008668 Ga0307414_100086685 160
11 3300032005 Ga0307411_10003495 Ga0307411_100034952 160
12 3300032126 Ga0307415_100055363 Ga0307415_1000553633 160
13 3300044842 Ga0466957_0139363 Ga0466957_0139363_126_626 166
14 3300005327 Ga0070658_10001377 Ga0070658_100013776 167
15 3300005329 Ga0070683_100020418 Ga0070683_1000204185 167
16 3300005331 Ga0070670_100013105 Ga0070670_1000131052 167
17 3300005335 Ga0070666_10550421 Ga0070666_105504212 167
18 3300005339 Ga0070660_100057475 Ga0070660_1000574753 167
19 3300005344 Ga0070661_100156256 Ga0070661_1001562563 167
20 3300005344 Ga0070661_100238291 Ga0070661_1002382912 167
21 3300005345 Ga0070692_10036243 Ga0070692_100362433 167
22 3300005354 Ga0070675_100227355 Ga0070675_1002273551 167
23 3300005355 Ga0070671_100001816 Ga0070671_1000018168 167
24 3300005364 Ga0070673_100479775 Ga0070673_1004797752 167
25 3300005456 Ga0070678_100015996 Ga0070678_1000159964 167
26 3300005456 Ga0070678_100128361 Ga0070678_1001283612 167
27 3300005459 Ga0068867_100058224 Ga0068867_1000582243 167
28 3300005535 Ga0070684_100033668 Ga0070684_1000336684 167
29 3300005564 Ga0070664_100002940 Ga0070664_1000029402 167
30 3300005841 Ga0068863_100779344 Ga0068863_1007793442 167
31 3300013104 Ga0157370_10190045 Ga0157370_101900452 167
32 3300013307 Ga0157372_11129403 Ga0157372_111294032 167
33 3300014326 Ga0157380_10722481 Ga0157380_107224812 167
34 3300021384 Ga0213876_10000863 Ga0213876_1000086312 167
35 3300025901 Ga0207688_10080834 Ga0207688_100808342 167
36 3300025909 Ga0207705_10002088 Ga0207705_1000208816 167
37 3300025919 Ga0207657_10056280 Ga0207657_100562803 167
38 3300025920 Ga0207649_10011003 Ga0207649_100110032 167
39 3300025920 Ga0207649_10080584 Ga0207649_100805843 167
40 3300025925 Ga0207650_10051589 Ga0207650_100515893 167
41 3300025931 Ga0207644_10005005 Ga0207644_100050058 167
42 3300025933 Ga0207706_10037005 Ga0207706_100370053 167
43 3300025933 Ga0207706_10083599 Ga0207706_100835992 167
44 3300025940 Ga0207691_10388518 Ga0207691_103885182 167
45 3300025944 Ga0207661_10063940 Ga0207661_100639404 167
46 3300025945 Ga0207679_10083892 Ga0207679_100838922 167
47 3300026067 Ga0207678_10224349 Ga0207678_102243492 167
48 3300026121 Ga0207683_10003583 Ga0207683_100035835 167
49 3300026121 Ga0207683_10103872 Ga0207683_101038723 167
50 3300028379 Ga0268266_11276054 Ga0268266_112760542 167
51 3300037312 Ga0395899_0006947 Ga0395899_0006947_4050_4553 167
52 3300037418 Ga0395900_0000336 Ga0395900_0000336_15267_15770 167
53 3300037466 Ga0395898_0016208 Ga0395898_0016208_3685_4188 167
54 3300037471 Ga0395905_0421061 Ga0395905_0421061_518_1021 167
55 3300038443 Ga0395901_0002173 Ga0395901_0002173_4087_4590 167
56 3300039437 Ga0436365_1360649 Ga0436365_1360649_16464_16970 167
57 3300044694 Ga0466963_0127549 Ga0466963_0127549_420_923 167
58 3300045836 Ga0466958_0800296 Ga0466958_0800296_73_576 167
59 3300045976 Ga0466967_0175035 Ga0466967_0175035_1409_1912 167
60 3300048904 Ga0496101_0276899 Ga0496101_0276899_609_1112 167
61 3300048905 Ga0496102_0958254 Ga0496102_0958254_229_732 167
62 3300005327 Ga0070658_10555004 Ga0070658_105550042 168
63 3300005339 Ga0070660_100003719 Ga0070660_1000037198 168
64 3300005339 Ga0070660_100064868 Ga0070660_1000648682 168
65 3300005345 Ga0070692_10000978 Ga0070692_100009785 168
66 3300005366 Ga0070659_100003241 Ga0070659_1000032418 168
67 3300005458 Ga0070681_10090131 Ga0070681_100901313 168
68 3300005530 Ga0070679_100000008 Ga0070679_10000000815 168
69 3300013105 Ga0157369_10008450 Ga0157369_1000845016 168
70 3300014326 Ga0157380_10005985 Ga0157380_100059858 168
71 3300020081 Ga0206354_10413920 Ga0206354_104139202 168
72 3300020082 Ga0206353_11288468 Ga0206353_112884683 168
73 3300021358 Ga0213873_10000012 Ga0213873_10000012174 168
74 3300021384 Ga0213876_10000021 Ga0213876_1000002135 168
75 3300021384 Ga0213876_10051408 Ga0213876_100514082 168
76 3300025909 Ga0207705_10000002 Ga0207705_10000002242 168
77 3300025909 Ga0207705_10403790 Ga0207705_104037902 168
78 3300025912 Ga0207707_10007643 Ga0207707_100076433 168
79 3300025917 Ga0207660_10008606 Ga0207660_100086065 168
80 3300025919 Ga0207657_10082400 Ga0207657_100824002 168
81 3300025920 Ga0207649_10000038 Ga0207649_1000003815 168
82 3300025921 Ga0207652_10000008 Ga0207652_10000008279 168
83 3300025932 Ga0207690_10002318 Ga0207690_100023188 168
84 3300031731 Ga0307405_10445630 Ga0307405_104456302 168
85 3300031824 Ga0307413_10134306 Ga0307413_101343062 168
86 3300031852 Ga0307410_10263445 Ga0307410_102634452 168
87 3300031901 Ga0307406_10054372 Ga0307406_100543722 168
88 3300037312 Ga0395899_0166709 Ga0395899_0166709_195_701 168
89 3300037312 Ga0395899_0255638 Ga0395899_0255638_492_998 168
90 3300037312 Ga0395899_0286218 Ga0395899_0286218_514_1020 168
91 3300037418 Ga0395900_0083504 Ga0395900_0083504_1854_2360 168
92 3300037418 Ga0395900_0257815 Ga0395900_0257815_514_1020 168
93 3300037466 Ga0395898_0022790 Ga0395898_0022790_811_1317 168
94 3300037466 Ga0395898_0384952 Ga0395898_0384952_329_835 168
95 3300037471 Ga0395905_0045997 Ga0395905_0045997_1734_2240 168
96 3300037471 Ga0395905_0049188 Ga0395905_0049188_1854_2360 168
97 3300037471 Ga0395905_0321723 Ga0395905_0321723_498_1004 168
98 3300037471 Ga0395905_1326231 Ga0395905_1326231_22_528 168
99 3300038443 Ga0395901_0111452 Ga0395901_0111452_1854_2360 168
100 3300038443 Ga0395901_0159827 Ga0395901_0159827_1008_1514 168
101 3300039437 Ga0436365_1794861 Ga0436365_1794861_28149_28658 168
102 3300039437 Ga0436365_1902390 Ga0436365_1902390_969_1475 168
103 3300001990 JGI24737J22298_10091526 JGI24737J22298_100915262 169
104 3300002067 JGI24735J21928_10045443 JGI24735J21928_100454432 169
105 3300005293 Ga0065715_10254933 Ga0065715_102549331 169
106 3300005327 Ga0070658_10155075 Ga0070658_101550752 169
107 3300005327 Ga0070658_10157000 Ga0070658_101570003 169
108 3300005327 Ga0070658_10309497 Ga0070658_103094972 169
109 3300005328 Ga0070676_10071115 Ga0070676_100711152 169
110 3300005331 Ga0070670_100019951 Ga0070670_1000199516 169
111 3300005333 Ga0070677_10001320 Ga0070677_100013207 169
112 3300005336 Ga0070680_100580164 Ga0070680_1005801642 169
113 3300005339 Ga0070660_100006841 Ga0070660_1000068416 169
114 3300005339 Ga0070660_100137494 Ga0070660_1001374942 169
115 3300005339 Ga0070660_100350729 Ga0070660_1003507292 169
116 3300005339 Ga0070660_101090874 Ga0070660_1010908742 169
117 3300005344 Ga0070661_100159766 Ga0070661_1001597662 169
118 3300005347 Ga0070668_100028258 Ga0070668_1000282584 169
119 3300005353 Ga0070669_100008938 Ga0070669_1000089383 169
120 3300005353 Ga0070669_100015859 Ga0070669_1000158593 169
121 3300005354 Ga0070675_100047512 Ga0070675_1000475122 169
122 3300005354 Ga0070675_100957903 Ga0070675_1009579032 169
123 3300005355 Ga0070671_100868630 Ga0070671_1008686302 169
124 3300005356 Ga0070674_100091794 Ga0070674_1000917942 169
125 3300005364 Ga0070673_100160043 Ga0070673_1001600431 169
126 3300005364 Ga0070673_100238129 Ga0070673_1002381292 169
127 3300005367 Ga0070667_100205313 Ga0070667_1002053132 169
128 3300005455 Ga0070663_100038735 Ga0070663_1000387354 169
129 3300005457 Ga0070662_100077635 Ga0070662_1000776353 169
130 3300005457 Ga0070662_100088478 Ga0070662_1000884782 169
131 3300005459 Ga0068867_100616467 Ga0068867_1006164671 169
132 3300005539 Ga0068853_100102660 Ga0068853_1001026602 169
133 3300005543 Ga0070672_100027584 Ga0070672_1000275844 169
134 3300005544 Ga0070686_100376597 Ga0070686_1003765972 169
135 3300005548 Ga0070665_100075981 Ga0070665_1000759814 169
136 3300005548 Ga0070665_100197227 Ga0070665_1001972272 169
137 3300005578 Ga0068854_100880247 Ga0068854_1008802472 169
138 3300005614 Ga0068856_100755003 Ga0068856_1007550031 169
139 3300005616 Ga0068852_100024978 Ga0068852_1000249785 169
140 3300005840 Ga0068870_10064438 Ga0068870_100644382 169
141 3300005841 Ga0068863_102217733 Ga0068863_1022177331 169
142 3300013102 Ga0157371_10013797 Ga0157371_100137975 169
143 3300013102 Ga0157371_10149632 Ga0157371_101496322 169
144 3300013104 Ga0157370_11180164 Ga0157370_111801642 169
145 3300013105 Ga0157369_10032870 Ga0157369_100328705 169
146 3300013296 Ga0157374_11680719 Ga0157374_116807192 169
147 3300025315 Ga0207697_10295525 Ga0207697_102955251 169
148 3300025893 Ga0207682_10007220 Ga0207682_100072203 169
149 3300025893 Ga0207682_10037745 Ga0207682_100377452 169
150 3300025901 Ga0207688_10163293 Ga0207688_101632932 169
151 3300025907 Ga0207645_10371397 Ga0207645_103713972 169
152 3300025908 Ga0207643_10060508 Ga0207643_100605082 169
153 3300025909 Ga0207705_10019495 Ga0207705_100194956 169
154 3300025909 Ga0207705_10021171 Ga0207705_100211716 169
155 3300025909 Ga0207705_10335556 Ga0207705_103355562 169
156 3300025909 Ga0207705_10353156 Ga0207705_103531562 169
157 3300025909 Ga0207705_10436578 Ga0207705_104365782 169
158 3300025917 Ga0207660_11001343 Ga0207660_110013432 169
159 3300025919 Ga0207657_10116535 Ga0207657_101165352 169
160 3300025921 Ga0207652_10235169 Ga0207652_102351693 169
161 3300025921 Ga0207652_10395371 Ga0207652_103953712 169
162 3300025923 Ga0207681_10016147 Ga0207681_100161473 169
163 3300025923 Ga0207681_10034991 Ga0207681_100349914 169
164 3300025923 Ga0207681_10092722 Ga0207681_100927222 169
165 3300025925 Ga0207650_10034190 Ga0207650_100341904 169
166 3300025925 Ga0207650_10836627 Ga0207650_108366272 169
167 3300025926 Ga0207659_10003141 Ga0207659_100031414 169
168 3300025933 Ga0207706_10077991 Ga0207706_100779913 169
169 3300025937 Ga0207669_10133663 Ga0207669_101336633 169
170 3300025940 Ga0207691_10051935 Ga0207691_100519352 169
171 3300025960 Ga0207651_10177816 Ga0207651_101778163 169
172 3300025960 Ga0207651_10183793 Ga0207651_101837932 169
173 3300025960 Ga0207651_10183835 Ga0207651_101838352 169
174 3300025961 Ga0207712_10537296 Ga0207712_105372961 169
175 3300025972 Ga0207668_10104438 Ga0207668_101044382 169
176 3300025972 Ga0207668_10193762 Ga0207668_101937622 169
177 3300025972 Ga0207668_10476551 Ga0207668_104765512 169
178 3300026041 Ga0207639_10022210 Ga0207639_100222102 169
179 3300026067 Ga0207678_10117552 Ga0207678_101175522 169
180 3300026078 Ga0207702_10705541 Ga0207702_107055412 169
181 3300026089 Ga0207648_10424836 Ga0207648_104248362 169
182 3300026095 Ga0207676_10197394 Ga0207676_101973942 169
183 3300026142 Ga0207698_10028385 Ga0207698_100283854 169
184 3300028379 Ga0268266_10032942 Ga0268266_100329423 169
185 3300031548 Ga0307408_100042605 Ga0307408_1000426053 169
186 3300031548 Ga0307408_100057504 Ga0307408_1000575043 169
187 3300031548 Ga0307408_100309801 Ga0307408_1003098012 169
188 3300031731 Ga0307405_10039177 Ga0307405_100391773 169
189 3300031731 Ga0307405_10071682 Ga0307405_100716822 169
190 3300031731 Ga0307405_10124488 Ga0307405_101244882 169
191 3300031824 Ga0307413_10019877 Ga0307413_100198772 169
192 3300031824 Ga0307413_10037738 Ga0307413_100377383 169
193 3300031824 Ga0307413_10048321 Ga0307413_100483213 169
194 3300031824 Ga0307413_10138776 Ga0307413_101387762 169
195 3300031824 Ga0307413_10314841 Ga0307413_103148412 169
196 3300031824 Ga0307413_10732718 Ga0307413_107327182 169
197 3300031852 Ga0307410_10009601 Ga0307410_100096014 169
198 3300031852 Ga0307410_10052939 Ga0307410_100529392 169
199 3300031852 Ga0307410_10110600 Ga0307410_101106002 169
200 3300031852 Ga0307410_10113643 Ga0307410_101136432 169
201 3300031852 Ga0307410_10204685 Ga0307410_102046852 169
202 3300031852 Ga0307410_10214331 Ga0307410_102143312 169
203 3300031852 Ga0307410_11486829 Ga0307410_114868291 169
204 3300031901 Ga0307406_10048131 Ga0307406_100481313 169
205 3300031901 Ga0307406_10283177 Ga0307406_102831772 169
206 3300031903 Ga0307407_10054931 Ga0307407_100549313 169
207 3300031911 Ga0307412_10004772 Ga0307412_100047726 169
208 3300031911 Ga0307412_10036599 Ga0307412_100365993 169
209 3300031995 Ga0307409_100029646 Ga0307409_1000296463 169
210 3300031995 Ga0307409_100063032 Ga0307409_1000630323 169
211 3300031995 Ga0307409_100114299 Ga0307409_1001142993 169
212 3300031995 Ga0307409_100190217 Ga0307409_1001902173 169
213 3300031995 Ga0307409_100217758 Ga0307409_1002177582 169
214 3300031995 Ga0307409_100355129 Ga0307409_1003551292 169
215 3300031995 Ga0307409_100525044 Ga0307409_1005250442 169
216 3300031995 Ga0307409_100556289 Ga0307409_1005562891 169
217 3300031995 Ga0307409_100731719 Ga0307409_1007317192 169
218 3300031995 Ga0307409_101286078 Ga0307409_1012860782 169
219 3300032002 Ga0307416_100252719 Ga0307416_1002527192 169
220 3300032002 Ga0307416_100330589 Ga0307416_1003305892 169
221 3300032002 Ga0307416_101116393 Ga0307416_1011163932 169
222 3300032004 Ga0307414_10066264 Ga0307414_100662643 169
223 3300032004 Ga0307414_10094941 Ga0307414_100949412 169
224 3300032004 Ga0307414_10135528 Ga0307414_101355282 169
225 3300032004 Ga0307414_10149961 Ga0307414_101499612 169
226 3300032004 Ga0307414_10209471 Ga0307414_102094712 169
227 3300032004 Ga0307414_10370259 Ga0307414_103702591 169
228 3300032005 Ga0307411_10025467 Ga0307411_100254674 169
229 3300032005 Ga0307411_10040222 Ga0307411_100402223 169
230 3300032005 Ga0307411_10076290 Ga0307411_100762902 169
231 3300032005 Ga0307411_10124094 Ga0307411_101240942 169
232 3300032005 Ga0307411_10233011 Ga0307411_102330112 169
233 3300032005 Ga0307411_10237955 Ga0307411_102379552 169
234 3300032005 Ga0307411_10259428 Ga0307411_102594282 169
235 3300032005 Ga0307411_10435785 Ga0307411_104357852 169
236 3300032005 Ga0307411_10743249 Ga0307411_107432492 169
237 3300037471 Ga0395905_0503944 Ga0395905_0503944_427_936 169
238 3300042007 Ga0439449_0075766 Ga0439449_0075766_178_687 169
239 3300044658 Ga0466972_0093239 Ga0466972_0093239_785_1294 169
240 3300045976 Ga0466967_0096585 Ga0466967_0096585_1357_1866 169
241 3300046522 Ga0495643_0245474 Ga0495643_0245474_283_804 169
242 3300046539 Ga0495621_0051769 Ga0495621_0051769_883_1392 169
243 3300046684 Ga0495669_0073073 Ga0495669_0073073_732_1241 169
244 3300050489 nmdc:mga03683_170370_c1 nmdc:mga03683_170370_c1_212_721 169
245 3300059421 Ga0590071_065828 Ga0590071_065828_367_876 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

36

164

0.92

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

65

155

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

28

153

0.8

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

10

154

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.9111 123 168
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.905 2 168
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.895 2 168
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.8926 2 168
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.8835 2 168
ID Description Score Start End Superfamily
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8987 4 168 3.40.630.30
af_Q2G0G4_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8935 3 164 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8804 123 168 3.30.572.10
af_Q9SI32_150_379_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.8801 58 74 2.40.160.200
3fncA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.879 2 168 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7H0GAG2-F1-model_v4 deleted 0.9911 1 168
AF-A0A7H0GAG2-F1-model_v4 deleted 0.9853 1 168
AF-A0A5C7L0V2-F1-model_v4 deleted 0.9791 3 168
AF-A0A2D7XR87-F1-model_v4 GNAT family N-acetyltransferase 0.9766 1 168 GO:0016747
AF-A0A1V1PU57-F1-model_v4 Acetyltransferase, GNAT family 0.9748 3 168 GO:0016747

Feature Viewer

pLDDT pTM Quality
95.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map