F357229

General Info

Members Datasets Scaffolds Average Seq Length
245 196 234 119

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10006383|Ga0075368_100063832
Length 115
Sequence MTITLYGIPNCDTVKKARTWLDGKGVAYTFHDFKKLGLPKPLAQAWLNSLGADTVINRKGTTWRGLDDAAKAQADSSAGALALITTQPSLVKRPVLDRDGALSVGFTPKTYAKYF

Samples

Sample ID Description Type Environment
1 2643221557 Ensifer sp. Root558 Isolate Unclassified
2 2643221610 Ensifer sp. Root74 Isolate Unclassified
3 2643221668 Ensifer sp. Root423 Isolate Unclassified
4 2643221675 Ensifer sp. Root1298 Isolate Unclassified
5 2643221680 Ensifer sp. Root1312 Isolate Unclassified
6 2643221726 Ensifer sp. Root954 Isolate Unclassified
7 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
8 2773857925 Microvirga vignae BR3299 Isolate Unclassified
9 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
10 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
89 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.51
Metatranscriptomes 0
Isolates 4.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.1
Nodule 0.41
Rhizoplane 6.12
Rhizosphere 70.61
Stem 0
Stem Tuber 0
Unclassified 7.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055525_1020454 3300003759 Bacteria 563
2 Ga0070661_100445102 3300005344 Unclassified 1030
3 Ga0070659_100376852 3300005366 Bacteria 1194
4 Ga0070681_10054102 3300005458 Bacteria 3999
5 Ga0068867_102097819 3300005459 Unclassified 535
6 Ga0070698_100006503 3300005471 Bacteria 12674
7 Ga0070679_100616343 3300005530 Bacteria 1028
8 Ga0068853_100159935 3300005539 Bacteria 2032
9 Ga0068853_100164855 3300005539 Bacteria 2002
10 Ga0070695_100343343 3300005545 Unclassified 1116
11 Ga0070696_101131913 3300005546 Bacteria 659
12 Ga0070696_101638946 3300005546 Bacteria 553
13 Ga0070665_100117248 3300005548 Bacteria 2665
14 Ga0068855_100025136 3300005563 Bacteria 7130
15 Ga0068857_100425703 3300005577 Bacteria 1238
16 Ga0068856_100849365 3300005614 Bacteria 932
17 Ga0068852_100742896 3300005616 Bacteria 993
18 Ga0068861_100414233 3300005719 Bacteria 1199
19 Ga0081455_10022021 3300005937 Bacteria 5966
20 Ga0081455_10230938 3300005937 Bacteria 1365
21 Ga0081539_10078774 3300005985 Bacteria 1739
22 Ga0075365_10011552 3300006038 Bacteria 5197
23 Ga0075365_11067707 3300006038 Bacteria 569
24 Ga0075368_10006383 3300006042 Bacteria 4116
25 Ga0075363_100027861 3300006048 Bacteria 2901
26 Ga0075363_100362279 3300006048 Bacteria 848
27 Ga0075364_10028915 3300006051 Bacteria 3550
28 Ga0075362_10004277 3300006177 Bacteria 5104
29 Ga0075362_10017047 3300006177 Bacteria 2987
30 Ga0075362_10062460 3300006177 Bacteria 1687
31 Ga0075362_10066460 3300006177 Bacteria 1638
32 Ga0075367_10054636 3300006178 Bacteria 2368
33 Ga0075367_10131215 3300006178 Bacteria 1549
34 Ga0075369_10046624 3300006186 Bacteria 1866
35 Ga0075369_10125777 3300006186 Bacteria 1163
36 Ga0097621_100418188 3300006237 Bacteria 1203
37 Ga0075370_10066977 3300006353 Bacteria 2049
38 Ga0075370_10228238 3300006353 Bacteria 1101
39 Ga0068871_100382762 3300006358 Bacteria 1250
40 Ga0075434_100306322 3300006871 Bacteria 1609
41 Ga0075434_100747760 3300006871 Bacteria 995
42 Ga0068865_100081122 3300006881 Bacteria 2329
43 Ga0099795_10013723 3300007788 Bacteria 2494
44 Ga0105240_10006293 3300009093 Bacteria 17469
45 Ga0111539_12884156 3300009094 Bacteria 556
46 Ga0105243_12763225 3300009148 Bacteria 531
47 Ga0105241_10020194 3300009174 Bacteria 4921
48 Ga0105241_10778399 3300009174 Bacteria 880
49 Ga0105237_10044897 3300009545 Bacteria 4449
50 Ga0105238_10340234 3300009551 Bacteria 1488
51 Ga0105238_10553993 3300009551 Bacteria 1154
52 Ga0105238_11017576 3300009551 Bacteria 850
53 Ga0105249_11226754 3300009553 Bacteria 821
54 Ga0099796_10007799 3300010159 Bacteria 2818
55 Ga0105239_10053110 3300010375 Bacteria 4445
56 Ga0105239_10110765 3300010375 Bacteria 3043
57 Ga0157373_10001044 3300013100 Bacteria 21339
58 Ga0157374_10378805 3300013296 Bacteria 1409
59 Ga0157372_10084437 3300013307 Bacteria 3599
60 Ga0157376_10265299 3300014969 Bacteria 1611
61 Ga0183363_1038 3300015690 Bacteria 43720
62 Ga0213876_10000508 3300021384 Bacteria 30285
63 Ga0213876_10013923 3300021384 Bacteria 4263
64 Ga0209563_112588 3300025230 Bacteria 1151
65 Ga0209256_1000027 3300025299 Bacteria 423283
66 Ga0207692_10381918 3300025898 Bacteria 875
67 Ga0207699_10787723 3300025906 Bacteria 699
68 Ga0207707_10383929 3300025912 Bacteria 1207
69 Ga0207695_10069147 3300025913 Bacteria 3615
70 Ga0207671_10199051 3300025914 Bacteria 1564
71 Ga0207663_10714738 3300025916 Bacteria 794
72 Ga0207694_10691098 3300025924 Bacteria 860
73 Ga0207700_10130503 3300025928 Bacteria 2051
74 Ga0207690_10596419 3300025932 Bacteria 901
75 Ga0207704_10039218 3300025938 Bacteria 2756
76 Ga0207665_10710822 3300025939 Bacteria 790
77 Ga0207712_10965694 3300025961 Bacteria 755
78 Ga0207658_11871745 3300025986 Bacteria 547
79 Ga0207639_10158556 3300026041 Bacteria 1904
80 Ga0207639_10374177 3300026041 Bacteria 1278
81 Ga0207708_10964047 3300026075 Bacteria 740
82 Ga0207648_11825007 3300026089 Unclassified 570
83 Ga0207674_10498910 3300026116 Unclassified 1176
84 Ga0207698_11291840 3300026142 Bacteria 744
85 Ga0209179_1004757 3300027512 Bacteria 2074
86 Ga0268266_10033124 3300028379 Bacteria 4393
87 Ga0268264_10569405 3300028381 Bacteria 1113
88 Ga0265318_10000436 3300028577 Bacteria 31719
89 Ga0265339_10228379 3300031249 Bacteria 908
90 Ga0307413_10518029 3300031824 Bacteria 961
91 Ga0307409_100934589 3300031995 Bacteria 882
92 Ga0307416_100321194 3300032002 Bacteria 1550
93 Ga0307411_11982101 3300032005 Bacteria 543
94 Ga0373936_0078497 3300035113 Bacteria 1371
95 Ga0373945_0019775 3300035116 Bacteria 2300
96 Ga0373954_0001009 3300035118 Bacteria 11129
97 Ga0373956_0299899 3300035119 Bacteria 765
98 Ga0373956_0308309 3300035119 Unclassified 754
99 Ga0373943_0003224 3300035170 Bacteria 7405
100 Ga0373946_0001157 3300035171 Bacteria 9131
101 Ga0373946_0478035 3300035171 Bacteria 637
102 Ga0373955_0000205 3300035172 Bacteria 24554
103 Ga0373935_0000009 3300035692 Bacteria 94996
104 Ga0373927_0006559 3300035695 Bacteria 7925
105 Ga0373927_0025832 3300035695 Bacteria 3839
106 Ga0373933_0001874 3300035724 Bacteria 12148
107 Ga0373947_0083528 3300035725 Bacteria 1980
108 Ga0373937_0000525 3300036401 Bacteria 34247
109 Ga0373937_0133519 3300036401 Bacteria 2320
110 Ga0373925_0000130 3300037068 Bacteria 79911
111 Ga0395898_0973464 3300037466 Bacteria 785
112 Ga0436364_0013203 3300037853 Bacteria 790
113 Ga0436365_0840670 3300039437 Bacteria 47211
114 Ga0436365_0995138 3300039437 Bacteria 570
115 Ga0436365_1105513 3300039437 Bacteria 5040
116 Ga0436362_0589292 3300039453 Bacteria 640
117 Ga0495592_0000361 3300046454 Bacteria 36277
118 Ga0495603_0032915 3300046455 Bacteria 3119
119 Ga0495603_0194050 3300046455 Bacteria 1174
120 Ga0495641_0426371 3300046461 Bacteria 602
121 Ga0495651_0001853 3300046462 Bacteria 16362
122 Ga0495653_0000043 3300046463 Bacteria 115966
123 Ga0495582_0580696 3300046473 Bacteria 648
124 Ga0495664_0000006 3300046477 Bacteria 407031
125 Ga0495594_0020793 3300046499 Bacteria 3498
126 Ga0495616_0097928 3300046513 Bacteria 1379
127 Ga0495618_0000001 3300046514 Bacteria 282202
128 Ga0495628_0000004 3300046516 Bacteria 462184
129 Ga0495630_0014225 3300046517 Bacteria 5794
130 Ga0495666_0550135 3300046526 Bacteria 515
131 Ga0495652_0000007 3300046529 Bacteria 418163
132 Ga0495665_0096678 3300046531 Bacteria 1551
133 Ga0495640_0000046 3300046533 Bacteria 64563
134 Ga0495586_0652146 3300046535 Bacteria 608
135 Ga0495587_0000002 3300046536 Bacteria 425485
136 Ga0495645_0000047 3300046543 Bacteria 89323
137 Ga0495667_0000006 3300046559 Bacteria 257523
138 Ga0495634_0000001 3300046642 Bacteria 303746
139 Ga0495635_0000080 3300046663 Bacteria 59439
140 Ga0495657_0002810 3300046675 Bacteria 14466
141 Ga0495599_0000102 3300046678 Bacteria 59866
142 Ga0495623_0000228 3300046679 Bacteria 36207
143 Ga0495646_0000001 3300046680 Bacteria 403396
144 Ga0495647_0193707 3300046681 Bacteria 889
145 Ga0495658_0022334 3300046683 Bacteria 3345
146 Ga0495613_0008012 3300046689 Bacteria 7860
147 Ga0495600_0000050 3300046809 Bacteria 69900
148 Ga0495581_0011125 3300047315 Bacteria 5200
149 Ga0495604_0000003 3300047317 Bacteria 464246
150 Ga0495674_0000006 3300047319 Bacteria 341772
151 Ga0495672_0097593 3300047320 Bacteria 1600
152 Ga0495676_0052076 3300047321 Bacteria 3270
153 Ga0495676_1022607 3300047321 Bacteria 527
154 Ga0495680_0272405 3300047322 Bacteria 1195
155 Ga0495675_0000198 3300047444 Bacteria 43875
156 Ga0495684_0000003 3300047471 Bacteria 331335
157 Ga0495593_0001816 3300047673 Bacteria 12688
158 Ga0495602_0000011 3300048088 Bacteria 212024
159 Ga0496100_0048367 3300048903 Bacteria 2745
160 Ga0496102_0359279 3300048905 Bacteria 1371
161 Ga0496104_0001606 3300048907 Bacteria 19467
162 Ga0496104_0001863 3300048907 Bacteria 18258
163 Ga0496105_0008691 3300048908 Bacteria 7902
164 Ga0496105_0018273 3300048908 Bacteria 5631
165 Ga0496106_0463920 3300048909 Bacteria 1017
166 Ga0496108_0307675 3300048911 Bacteria 1381
167 Ga0496110_1606641 3300048913 Bacteria 560
168 Ga0496112_0673799 3300048915 Bacteria 963
169 Ga0496112_0774910 3300048915 Bacteria 885
170 Ga0496112_1329631 3300048915 Bacteria 634
171 Ga0496113_0221934 3300048916 Bacteria 1506
172 Ga0496114_0096896 3300048917 Bacteria 2512
173 Ga0496115_0122068 3300048918 Bacteria 2144
174 Ga0496124_0613816 3300048927 Bacteria 705
175 Ga0496125_0447254 3300048928 Bacteria 741
176 Ga0496126_0002668 3300048929 Bacteria 23630
177 Ga0501031_0072242 3300049568 Bacteria 2247
178 Ga0501032_0000060 3300049569 Bacteria 95279
179 Ga0501032_0242339 3300049569 Bacteria 1171
180 Ga0501033_0000490 3300049570 Bacteria 37274
181 Ga0501034_0000262 3300049571 Bacteria 95293
182 Ga0501034_0067717 3300049571 Bacteria 3582
183 Ga0501034_0366044 3300049571 Bacteria 1368
184 Ga0501036_0001263 3300049572 Bacteria 19374
185 Ga0501036_0388201 3300049572 Bacteria 1165
186 Ga0501036_0559174 3300049572 Bacteria 950
187 Ga0501037_0000788 3300049573 Bacteria 23856
188 Ga0501037_0075391 3300049573 Bacteria 2450
189 Ga0501037_0915692 3300049573 Bacteria 574
190 Ga0501038_0000051 3300049574 Bacteria 95293
191 Ga0501039_0000051 3300049575 Bacteria 95293
192 Ga0501041_0200422 3300049577 Bacteria 1251
193 Ga0501042_0643583 3300049578 Bacteria 771
194 Ga0501043_0000288 3300049579 Bacteria 45317
195 Ga0501046_0217748 3300049580 Bacteria 1415
196 Ga0501047_0042274 3300049581 Bacteria 4404
197 Ga0501048_0403851 3300049582 Bacteria 977
198 Ga0501067_0017006 3300049583 Bacteria 4019
199 Ga0501069_0226981 3300049585 Bacteria 1086
200 Ga0501070_0064377 3300049586 Bacteria 3036
201 Ga0501073_0114822 3300049589 Bacteria 1866
202 Ga0501073_0427210 3300049589 Bacteria 916
203 Ga0501074_0168966 3300049590 Bacteria 1561
204 Ga0501080_0437495 3300049742 Bacteria 1173
205 Ga0501083_0102788 3300049744 Bacteria 1884
206 Ga0501035_0000119 3300049822 Bacteria 95271
207 Ga0501035_0018532 3300049822 Bacteria 6413
208 Ga0501044_0003795 3300049823 Bacteria 16970
209 Ga0501044_0254296 3300049823 Bacteria 1697
210 nmdc:mga03683_111397_c1 3300050489 Bacteria 1210
211 nmdc:mga03683_2355_c1 3300050489 Bacteria 5851
212 nmdc:mga03683_44268_c1 3300050489 Bacteria 1839
213 nmdc:mga03683_492855_c1 3300050489 Bacteria 593
214 nmdc:mga00v17_291602_c1 3300050491 Bacteria 1059
215 nmdc:mga00v17_40549_c1 3300050491 Bacteria 2794
216 nmdc:mga00v17_959076_c1 3300050491 Bacteria 540
217 nmdc:mga0yw44_1190482_c1 3300050492 Bacteria 514
218 nmdc:mga0yw44_60684_c1 3300050492 Bacteria 2317
219 nmdc:mga0k408_77766_c2 3300050493 Bacteria 851
220 nmdc:mga0k408_87038_c1 3300050493 Bacteria 1835
221 nmdc:mga06z11_68626_c1 3300050494 Bacteria 1869
222 nmdc:mga07m45_222919_c1 3300050496 Bacteria 1097
223 nmdc:mga07m45_31817_c1 3300050496 Bacteria 2924
224 nmdc:mga07m45_79785_c1 3300050496 Bacteria 1868
225 nmdc:mga0rr50_506787_c1 3300050513 Bacteria 1026
226 nmdc:mga0sz30_17471_c1 3300050516 Bacteria 2861
227 Ga0495601_0000004 3300053077 Bacteria 449178
228 Ga0495612_0000008 3300053078 Bacteria 232633
229 Ga0495595_0000095 3300053084 Bacteria 41864
230 Ga0495619_0000005 3300053085 Bacteria 418061
231 Ga0500644_0141672 3300053088 Bacteria 956
232 Ga0500577_0102714 3300053142 Bacteria 1171
233 Ga0501084_0045736 3300054114 Bacteria 3664
234 Ga0501082_0039796 3300060353 Bacteria 4056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2989349275 2989351840 110
2 iso_pu_bacteria 8054558443 8054561597 111
3 3300046513 Ga0495616_0097928 Ga0495616_0097928_681_1022 112
4 iso_pu_bacteria 2643221557 2643805870 112
5 iso_pu_bacteria 2643221610 2644066047 112
6 iso_pu_bacteria 2643221668 2644380351 112
7 iso_pu_bacteria 2643221675 2644417378 112
8 iso_pu_bacteria 2643221680 2644450774 112
9 iso_pu_bacteria 2643221726 2644692802 112
10 iso_pu_bacteria 2739367756 2739791527 112
11 3300013100 Ga0157373_10001044 Ga0157373_1000104425 113
12 3300031824 Ga0307413_10518029 Ga0307413_105180292 113
13 3300031995 Ga0307409_100934589 Ga0307409_1009345892 113
14 3300032002 Ga0307416_100321194 Ga0307416_1003211942 113
15 3300032005 Ga0307411_11982101 Ga0307411_119821012 113
16 iso_pu_bacteria 2844533157 2844533531 113
17 3300006042 Ga0075368_10006383 Ga0075368_100063832 114
18 3300006048 Ga0075363_100027861 Ga0075363_1000278612 114
19 3300006051 Ga0075364_10028915 Ga0075364_100289152 114
20 3300006177 Ga0075362_10062460 Ga0075362_100624602 114
21 3300006178 Ga0075367_10054636 Ga0075367_100546362 114
22 3300006186 Ga0075369_10125777 Ga0075369_101257772 114
23 3300006353 Ga0075370_10066977 Ga0075370_100669772 114
24 3300009551 Ga0105238_10340234 Ga0105238_103402342 114
25 3300015690 Ga0183363_1038 Ga0183363_103814 114
26 3300048928 Ga0496125_0447254 Ga0496125_0447254_57_401 114
27 3300048929 Ga0496126_0002668 Ga0496126_0002668_4962_5306 114
28 3300049571 Ga0501034_0366044 Ga0501034_0366044_59_406 114
29 3300050489 nmdc:mga03683_44268_c1 nmdc:mga03683_44268_c1_650_997 114
30 3300050491 nmdc:mga00v17_40549_c1 nmdc:mga00v17_40549_c1_138_485 114
31 3300050491 nmdc:mga00v17_959076_c1 nmdc:mga00v17_959076_c1_175_522 114
32 3300050493 nmdc:mga0k408_87038_c1 nmdc:mga0k408_87038_c1_948_1295 114
33 3300050496 nmdc:mga07m45_222919_c1 nmdc:mga07m45_222919_c1_119_466 114
34 3300050496 nmdc:mga07m45_31817_c1 nmdc:mga07m45_31817_c1_2493_2840 114
35 3300005344 Ga0070661_100445102 Ga0070661_1004451022 115
36 3300005366 Ga0070659_100376852 Ga0070659_1003768521 115
37 3300005458 Ga0070681_10054102 Ga0070681_100541024 115
38 3300005459 Ga0068867_102097819 Ga0068867_1020978191 115
39 3300005530 Ga0070679_100616343 Ga0070679_1006163432 115
40 3300005539 Ga0068853_100164855 Ga0068853_1001648553 115
41 3300005545 Ga0070695_100343343 Ga0070695_1003433432 115
42 3300005546 Ga0070696_101131913 Ga0070696_1011319132 115
43 3300005546 Ga0070696_101638946 Ga0070696_1016389461 115
44 3300005563 Ga0068855_100025136 Ga0068855_1000251362 115
45 3300005577 Ga0068857_100425703 Ga0068857_1004257032 115
46 3300005614 Ga0068856_100849365 Ga0068856_1008493652 115
47 3300005616 Ga0068852_100742896 Ga0068852_1007428962 115
48 3300005937 Ga0081455_10022021 Ga0081455_100220213 115
49 3300006038 Ga0075365_10011552 Ga0075365_100115525 115
50 3300006048 Ga0075363_100362279 Ga0075363_1003622792 115
51 3300006177 Ga0075362_10004277 Ga0075362_100042773 115
52 3300006177 Ga0075362_10017047 Ga0075362_100170472 115
53 3300006177 Ga0075362_10066460 Ga0075362_100664604 115
54 3300006178 Ga0075367_10131215 Ga0075367_101312151 115
55 3300006186 Ga0075369_10046624 Ga0075369_100466243 115
56 3300006237 Ga0097621_100418188 Ga0097621_1004181882 115
57 3300006353 Ga0075370_10228238 Ga0075370_102282382 115
58 3300006358 Ga0068871_100382762 Ga0068871_1003827621 115
59 3300009094 Ga0111539_12884156 Ga0111539_128841562 115
60 3300009148 Ga0105243_12763225 Ga0105243_127632252 115
61 3300009174 Ga0105241_10020194 Ga0105241_100201943 115
62 3300009545 Ga0105237_10044897 Ga0105237_100448975 115
63 3300009551 Ga0105238_10553993 Ga0105238_105539932 115
64 3300009553 Ga0105249_11226754 Ga0105249_112267542 115
65 3300010375 Ga0105239_10053110 Ga0105239_100531103 115
66 3300013307 Ga0157372_10084437 Ga0157372_100844372 115
67 3300021384 Ga0213876_10000508 Ga0213876_1000050813 115
68 3300021384 Ga0213876_10013923 Ga0213876_100139231 115
69 3300025912 Ga0207707_10383929 Ga0207707_103839292 115
70 3300025914 Ga0207671_10199051 Ga0207671_101990512 115
71 3300025932 Ga0207690_10596419 Ga0207690_105964192 115
72 3300025961 Ga0207712_10965694 Ga0207712_109656942 115
73 3300026041 Ga0207639_10158556 Ga0207639_101585562 115
74 3300026041 Ga0207639_10374177 Ga0207639_103741771 115
75 3300026089 Ga0207648_11825007 Ga0207648_118250072 115
76 3300026116 Ga0207674_10498910 Ga0207674_104989102 115
77 3300026142 Ga0207698_11291840 Ga0207698_112918402 115
78 3300028381 Ga0268264_10569405 Ga0268264_105694052 115
79 3300035119 Ga0373956_0308309 Ga0373956_0308309_23_373 115
80 3300035171 Ga0373946_0478035 Ga0373946_0478035_228_575 115
81 3300036401 Ga0373937_0133519 Ga0373937_0133519_388_738 115
82 3300039437 Ga0436365_0840670 Ga0436365_0840670_36179_36538 115
83 3300039437 Ga0436365_1105513 Ga0436365_1105513_3805_4152 115
84 3300047322 Ga0495680_0272405 Ga0495680_0272405_230_580 115
85 3300049568 Ga0501031_0072242 Ga0501031_0072242_1361_1711 115
86 3300049569 Ga0501032_0000060 Ga0501032_0000060_82666_83016 115
87 3300049570 Ga0501033_0000490 Ga0501033_0000490_32689_33039 115
88 3300049571 Ga0501034_0000262 Ga0501034_0000262_82666_83016 115
89 3300049572 Ga0501036_0001263 Ga0501036_0001263_11495_11845 115
90 3300049573 Ga0501037_0000788 Ga0501037_0000788_11229_11579 115
91 3300049574 Ga0501038_0000051 Ga0501038_0000051_12278_12628 115
92 3300049575 Ga0501039_0000051 Ga0501039_0000051_82666_83016 115
93 3300049577 Ga0501041_0200422 Ga0501041_0200422_602_952 115
94 3300049579 Ga0501043_0000288 Ga0501043_0000288_32690_33040 115
95 3300049580 Ga0501046_0217748 Ga0501046_0217748_854_1204 115
96 3300049822 Ga0501035_0000119 Ga0501035_0000119_12271_12621 115
97 3300049823 Ga0501044_0003795 Ga0501044_0003795_3145_3495 115
98 3300050489 nmdc:mga03683_111397_c1 nmdc:mga03683_111397_c1_735_1088 115
99 3300050489 nmdc:mga03683_2355_c1 nmdc:mga03683_2355_c1_184_537 115
100 3300050489 nmdc:mga03683_492855_c1 nmdc:mga03683_492855_c1_38_385 115
101 3300050491 nmdc:mga00v17_291602_c1 nmdc:mga00v17_291602_c1_663_1016 115
102 3300050492 nmdc:mga0yw44_60684_c1 nmdc:mga0yw44_60684_c1_1347_1700 115
103 3300050493 nmdc:mga0k408_77766_c2 nmdc:mga0k408_77766_c2_457_810 115
104 3300050494 nmdc:mga06z11_68626_c1 nmdc:mga06z11_68626_c1_1186_1539 115
105 3300050496 nmdc:mga07m45_79785_c1 nmdc:mga07m45_79785_c1_37_390 115
106 3300050516 nmdc:mga0sz30_17471_c1 nmdc:mga0sz30_17471_c1_2140_2493 115
107 3300053088 Ga0500644_0141672 Ga0500644_0141672_118_471 115
108 3300053142 Ga0500577_0102714 Ga0500577_0102714_522_875 115
109 iso_pu_bacteria 2773857925 2774868521 115
110 3300003759 Ga0055525_1020454 Ga0055525_10204542 116
111 3300005471 Ga0070698_100006503 Ga0070698_1000065035 116
112 3300005539 Ga0068853_100159935 Ga0068853_1001599352 116
113 3300005548 Ga0070665_100117248 Ga0070665_1001172483 116
114 3300005719 Ga0068861_100414233 Ga0068861_1004142332 116
115 3300005937 Ga0081455_10230938 Ga0081455_102309382 116
116 3300005985 Ga0081539_10078774 Ga0081539_100787742 116
117 3300006038 Ga0075365_11067707 Ga0075365_110677071 116
118 3300006871 Ga0075434_100306322 Ga0075434_1003063222 116
119 3300006871 Ga0075434_100747760 Ga0075434_1007477602 116
120 3300006881 Ga0068865_100081122 Ga0068865_1000811223 116
121 3300007788 Ga0099795_10013723 Ga0099795_100137232 116
122 3300009093 Ga0105240_10006293 Ga0105240_100062933 116
123 3300009174 Ga0105241_10778399 Ga0105241_107783992 116
124 3300009551 Ga0105238_11017576 Ga0105238_110175762 116
125 3300010159 Ga0099796_10007799 Ga0099796_100077993 116
126 3300010375 Ga0105239_10110765 Ga0105239_101107653 116
127 3300013296 Ga0157374_10378805 Ga0157374_103788053 116
128 3300014969 Ga0157376_10265299 Ga0157376_102652992 116
129 3300025230 Ga0209563_112588 Ga0209563_1125882 116
130 3300025299 Ga0209256_1000027 Ga0209256_100002745 116
131 3300025898 Ga0207692_10381918 Ga0207692_103819181 116
132 3300025906 Ga0207699_10787723 Ga0207699_107877231 116
133 3300025913 Ga0207695_10069147 Ga0207695_100691473 116
134 3300025916 Ga0207663_10714738 Ga0207663_107147381 116
135 3300025924 Ga0207694_10691098 Ga0207694_106910981 116
136 3300025928 Ga0207700_10130503 Ga0207700_101305032 116
137 3300025938 Ga0207704_10039218 Ga0207704_100392183 116
138 3300025939 Ga0207665_10710822 Ga0207665_107108222 116
139 3300025986 Ga0207658_11871745 Ga0207658_118717451 116
140 3300026075 Ga0207708_10964047 Ga0207708_109640472 116
141 3300027512 Ga0209179_1004757 Ga0209179_10047573 116
142 3300028379 Ga0268266_10033124 Ga0268266_100331244 116
143 3300028577 Ga0265318_10000436 Ga0265318_1000043631 116
144 3300031249 Ga0265339_10228379 Ga0265339_102283792 116
145 3300035113 Ga0373936_0078497 Ga0373936_0078497_762_1130 116
146 3300035116 Ga0373945_0019775 Ga0373945_0019775_1185_1541 116
147 3300035118 Ga0373954_0001009 Ga0373954_0001009_66_431 116
148 3300035119 Ga0373956_0299899 Ga0373956_0299899_79_444 116
149 3300035170 Ga0373943_0003224 Ga0373943_0003224_6373_6738 116
150 3300035171 Ga0373946_0001157 Ga0373946_0001157_5957_6322 116
151 3300035172 Ga0373955_0000205 Ga0373955_0000205_18579_18944 116
152 3300035692 Ga0373935_0000009 Ga0373935_0000009_20739_21104 116
153 3300035695 Ga0373927_0006559 Ga0373927_0006559_29_394 116
154 3300035695 Ga0373927_0025832 Ga0373927_0025832_951_1307 116
155 3300035724 Ga0373933_0001874 Ga0373933_0001874_11406_11771 116
156 3300035725 Ga0373947_0083528 Ga0373947_0083528_1504_1860 116
157 3300036401 Ga0373937_0000525 Ga0373937_0000525_20286_20651 116
158 3300037068 Ga0373925_0000130 Ga0373925_0000130_22288_22653 116
159 3300037466 Ga0395898_0973464 Ga0395898_0973464_141_506 116
160 3300037853 Ga0436364_0013203 Ga0436364_0013203_145_507 116
161 3300039437 Ga0436365_0995138 Ga0436365_0995138_186_542 116
162 3300039453 Ga0436362_0589292 Ga0436362_0589292_175_531 116
163 3300046454 Ga0495592_0000361 Ga0495592_0000361_35863_36228 116
164 3300046455 Ga0495603_0032915 Ga0495603_0032915_1204_1560 116
165 3300046455 Ga0495603_0194050 Ga0495603_0194050_593_955 116
166 3300046461 Ga0495641_0426371 Ga0495641_0426371_126_488 116
167 3300046462 Ga0495651_0001853 Ga0495651_0001853_15951_16316 116
168 3300046463 Ga0495653_0000043 Ga0495653_0000043_35860_36225 116
169 3300046473 Ga0495582_0580696 Ga0495582_0580696_215_571 116
170 3300046477 Ga0495664_0000006 Ga0495664_0000006_376302_376667 116
171 3300046499 Ga0495594_0020793 Ga0495594_0020793_548_904 116
172 3300046514 Ga0495618_0000001 Ga0495618_0000001_233192_233557 116
173 3300046516 Ga0495628_0000004 Ga0495628_0000004_51744_52109 116
174 3300046517 Ga0495630_0014225 Ga0495630_0014225_3408_3773 116
175 3300046526 Ga0495666_0550135 Ga0495666_0550135_121_483 116
176 3300046529 Ga0495652_0000007 Ga0495652_0000007_41326_41691 116
177 3300046531 Ga0495665_0096678 Ga0495665_0096678_1146_1514 116
178 3300046533 Ga0495640_0000046 Ga0495640_0000046_23214_23579 116
179 3300046535 Ga0495586_0652146 Ga0495586_0652146_115_480 116
180 3300046536 Ga0495587_0000002 Ga0495587_0000002_48680_49045 116
181 3300046543 Ga0495645_0000047 Ga0495645_0000047_43990_44355 116
182 3300046559 Ga0495667_0000006 Ga0495667_0000006_48667_49032 116
183 3300046642 Ga0495634_0000001 Ga0495634_0000001_26766_27131 116
184 3300046663 Ga0495635_0000080 Ga0495635_0000080_10382_10747 116
185 3300046675 Ga0495657_0002810 Ga0495657_0002810_14047_14412 116
186 3300046678 Ga0495599_0000102 Ga0495599_0000102_23609_23974 116
187 3300046679 Ga0495623_0000228 Ga0495623_0000228_35798_36163 116
188 3300046680 Ga0495646_0000001 Ga0495646_0000001_376359_376724 116
189 3300046681 Ga0495647_0193707 Ga0495647_0193707_204_560 116
190 3300046683 Ga0495658_0022334 Ga0495658_0022334_159_515 116
191 3300046689 Ga0495613_0008012 Ga0495613_0008012_7459_7824 116
192 3300046809 Ga0495600_0000050 Ga0495600_0000050_12319_12684 116
193 3300047315 Ga0495581_0011125 Ga0495581_0011125_2651_3016 116
194 3300047317 Ga0495604_0000003 Ga0495604_0000003_376224_376589 116
195 3300047319 Ga0495674_0000006 Ga0495674_0000006_91250_91615 116
196 3300047320 Ga0495672_0097593 Ga0495672_0097593_815_1180 116
197 3300047321 Ga0495676_0052076 Ga0495676_0052076_1356_1712 116
198 3300047321 Ga0495676_1022607 Ga0495676_1022607_138_500 116
199 3300047444 Ga0495675_0000198 Ga0495675_0000198_20522_20887 116
200 3300047471 Ga0495684_0000003 Ga0495684_0000003_289678_290043 116
201 3300047673 Ga0495593_0001816 Ga0495593_0001816_669_1034 116
202 3300048088 Ga0495602_0000011 Ga0495602_0000011_175767_176132 116
203 3300048903 Ga0496100_0048367 Ga0496100_0048367_551_973 116
204 3300048905 Ga0496102_0359279 Ga0496102_0359279_898_1320 116
205 3300048907 Ga0496104_0001606 Ga0496104_0001606_8126_8494 116
206 3300048907 Ga0496104_0001863 Ga0496104_0001863_17067_17489 116
207 3300048908 Ga0496105_0008691 Ga0496105_0008691_5309_5677 116
208 3300048908 Ga0496105_0018273 Ga0496105_0018273_734_1156 116
209 3300048909 Ga0496106_0463920 Ga0496106_0463920_316_684 116
210 3300048911 Ga0496108_0307675 Ga0496108_0307675_499_870 116
211 3300048913 Ga0496110_1606641 Ga0496110_1606641_90_458 116
212 3300048915 Ga0496112_0673799 Ga0496112_0673799_359_727 116
213 3300048915 Ga0496112_0774910 Ga0496112_0774910_26_391 116
214 3300048915 Ga0496112_1329631 Ga0496112_1329631_32_403 116
215 3300048916 Ga0496113_0221934 Ga0496113_0221934_267_635 116
216 3300048917 Ga0496114_0096896 Ga0496114_0096896_1215_1637 116
217 3300048918 Ga0496115_0122068 Ga0496115_0122068_126_494 116
218 3300048927 Ga0496124_0613816 Ga0496124_0613816_177_536 116
219 3300049569 Ga0501032_0242339 Ga0501032_0242339_283_639 116
220 3300049571 Ga0501034_0067717 Ga0501034_0067717_1685_2041 116
221 3300049572 Ga0501036_0388201 Ga0501036_0388201_156_512 116
222 3300049572 Ga0501036_0559174 Ga0501036_0559174_33_386 116
223 3300049573 Ga0501037_0075391 Ga0501037_0075391_1107_1457 116
224 3300049573 Ga0501037_0915692 Ga0501037_0915692_76_429 116
225 3300049578 Ga0501042_0643583 Ga0501042_0643583_141_497 116
226 3300049581 Ga0501047_0042274 Ga0501047_0042274_807_1163 116
227 3300049582 Ga0501048_0403851 Ga0501048_0403851_602_952 116
228 3300049583 Ga0501067_0017006 Ga0501067_0017006_422_778 116
229 3300049585 Ga0501069_0226981 Ga0501069_0226981_248_604 116
230 3300049586 Ga0501070_0064377 Ga0501070_0064377_389_745 116
231 3300049589 Ga0501073_0114822 Ga0501073_0114822_121_477 116
232 3300049589 Ga0501073_0427210 Ga0501073_0427210_73_426 116
233 3300049590 Ga0501074_0168966 Ga0501074_0168966_859_1215 116
234 3300049742 Ga0501080_0437495 Ga0501080_0437495_316_672 116
235 3300049744 Ga0501083_0102788 Ga0501083_0102788_841_1197 116
236 3300049822 Ga0501035_0018532 Ga0501035_0018532_4300_4656 116
237 3300049823 Ga0501044_0254296 Ga0501044_0254296_482_838 116
238 3300050492 nmdc:mga0yw44_1190482_c1 nmdc:mga0yw44_1190482_c1_104_457 116
239 3300050513 nmdc:mga0rr50_506787_c1 nmdc:mga0rr50_506787_c1_122_484 116
240 3300053077 Ga0495601_0000004 Ga0495601_0000004_72363_72728 116
241 3300053078 Ga0495612_0000008 Ga0495612_0000008_140534_140899 116
242 3300053084 Ga0495595_0000095 Ga0495595_0000095_89_454 116
243 3300053085 Ga0495619_0000005 Ga0495619_0000005_376365_376730 116
244 3300054114 Ga0501084_0045736 Ga0501084_0045736_646_1002 116
245 3300060353 Ga0501082_0039796 Ga0501082_0039796_653_1009 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

6

114

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9873 3 112
1rw1-assembly1.cif.gz_A yffb (pa3664) protein 0.9448 3 112
2pbj-assembly1.cif.gz_B gsh-heme bound microsomal prostaglandin e synthase 0.9248 1 31
3gkx-assembly3.cif.gz_B crystal structure of putative arsc family related protein from bacteroides fragilis 0.8746 1 112
3ihq-assembly1.cif.gz_A crystal structure of reduced c10s spx in complex with the alpha c-terminal domain of rna polymeras 0.8734 3 113
ID Description Score Start End Superfamily
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9867 3 112 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9507 3 31 3.40.30.10
1rw1A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9431 3 112 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9326 3 116 3.40.30.10
af_Q4CWB7_73_169_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.921 2 32 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4P7QNT6-F1-model_v4 deleted 0.9959 3 115
AF-A0A418YRV8-F1-model_v4 ArsC family reductase 0.9959 3 115
AF-A0A2A5YIW8-F1-model_v4 ArsC family reductase 0.9957 3 115
AF-A0A529SJB9-F1-model_v4 Arsenate reductase 0.9954 1 98
AF-A0A2E3BI20-F1-model_v4 ArsC family reductase 0.9952 3 115

Feature Viewer

pLDDT pTM Quality
95.11 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map