F357194

General Info

Members Datasets Scaffolds Average Seq Length
245 129 242 383

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100047244|Ga0068855_1000472442
Length 432
Sequence MPKLQPSAVADIPTLDLKRQYVDIEGEVRAAIGRVCASQQFVLGPEVEAFEQELAQFVGAKHAVGCASGTDALWLALAAAGVGPGDRVITTPFSFFASASSIVRAGAEPVFVDIEPETMNLDPANVRDFLKKTSGFLDSNNQSVVGSMRFAQNDRRKRGQSQVAGRIKAILPVHLYGQCADMTAFQRIASEHDIVLIEDAAQAIGAKCNGNPAGSMGVAAAFSFYPTKNLSAYGDAGMVTTNDPALADHMRRLRNHGSPERYLHTEFGWNARMDAIQAAVLRVKLKHINRWNDRRRNHAETYSLLLKKAGLVAEGFSPEENAGSADRANRSGFPLQLLHTSPYAFHIFHQYVIRAERRDELRAFLKSRGIASEVYYPLPLHLQPVFAYLGYKRGDLPETEKAPNEVLALPMFPELTREEIARVVAEIADFYS

Samples

Sample ID Description Type Environment
1 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
2 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
3 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0.82
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 99.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058862_11807904 3300004803 Bacteria 1373
2 Ga0070658_10006394 3300005327 Bacteria 9547
3 Ga0070683_100002790 3300005329 Bacteria 13968
4 Ga0070683_100030282 3300005329 Bacteria 4910
5 Ga0070683_100066714 3300005329 Bacteria 3352
6 Ga0070683_100119417 3300005329 Bacteria 2490
7 Ga0070683_100217657 3300005329 Bacteria 1815
8 Ga0070683_100308349 3300005329 Bacteria 1506
9 Ga0070690_100010141 3300005330 Bacteria 5473
10 Ga0070670_100021827 3300005331 Bacteria 5506
11 Ga0068869_100004345 3300005334 Bacteria 8798
12 Ga0070666_10008882 3300005335 Bacteria 6249
13 Ga0070666_10034334 3300005335 Unclassified 3362
14 Ga0070666_10179262 3300005335 Bacteria 1485
15 Ga0070680_100096521 3300005336 Bacteria 2451
16 Ga0068868_100005747 3300005338 Bacteria 8731
17 Ga0068868_100010746 3300005338 Bacteria 6637
18 Ga0068868_100027920 3300005338 Unclassified 4309
19 Ga0068868_100249960 3300005338 Bacteria 1492
20 Ga0070691_10032960 3300005341 Bacteria 2435
21 Ga0070668_100053992 3300005347 Bacteria 3099
22 Ga0070669_100156019 3300005353 Bacteria 1770
23 Ga0070671_100009821 3300005355 Bacteria 7681
24 Ga0070671_100028715 3300005355 Bacteria 4583
25 Ga0070673_100159144 3300005364 Bacteria 1919
26 Ga0070711_100079675 3300005439 Unclassified 2330
27 Ga0070681_10000293 3300005458 Bacteria 40403
28 Ga0070681_10001656 3300005458 Bacteria 19888
29 Ga0070681_10013374 3300005458 Bacteria 8155
30 Ga0070681_10031897 3300005458 Bacteria 5289
31 Ga0068867_100029593 3300005459 Unclassified 3947
32 Ga0068867_100102944 3300005459 Bacteria 2183
33 Ga0070707_100058015 3300005468 Bacteria 3713
34 Ga0070679_100012622 3300005530 Bacteria 8080
35 Ga0070679_100142374 3300005530 Unclassified 2377
36 Ga0070684_100030225 3300005535 Bacteria 4601
37 Ga0070684_100175963 3300005535 Bacteria 1945
38 Ga0070684_100193697 3300005535 Bacteria 1850
39 Ga0070696_100000297 3300005546 Bacteria 29960
40 Ga0070696_100003363 3300005546 Bacteria 10669
41 Ga0070693_100057451 3300005547 Unclassified 2249
42 Ga0068855_100000500 3300005563 Bacteria 48457
43 Ga0068855_100005759 3300005563 Bacteria 15132
44 Ga0068855_100007031 3300005563 Bacteria 13655
45 Ga0068855_100047244 3300005563 Bacteria 5086
46 Ga0070664_100116184 3300005564 Bacteria 2339
47 Ga0070664_100277561 3300005564 Bacteria 1511
48 Ga0068857_100006186 3300005577 Bacteria 10232
49 Ga0068857_100007994 3300005577 Bacteria 9127
50 Ga0068857_100019991 3300005577 Bacteria 5886
51 Ga0068857_100039937 3300005577 Unclassified 4159
52 Ga0068854_100018021 3300005578 Bacteria 4734
53 Ga0068856_100001116 3300005614 Bacteria 28358
54 Ga0068856_100003796 3300005614 Bacteria 15133
55 Ga0068856_100005044 3300005614 Bacteria 13071
56 Ga0068856_100080676 3300005614 Bacteria 3227
57 Ga0068856_100204842 3300005614 Unclassified 1987
58 Ga0068859_100045324 3300005617 Bacteria 4418
59 Ga0068859_100206268 3300005617 Bacteria 2051
60 Ga0068864_100005947 3300005618 Bacteria 10007
61 Ga0068863_100007622 3300005841 Bacteria 10585
62 Ga0068858_100012496 3300005842 Bacteria 8009
63 Ga0068858_100032776 3300005842 Unclassified 4825
64 Ga0068860_100030892 3300005843 Bacteria 5150
65 Ga0068860_100071497 3300005843 Bacteria 3297
66 Ga0081539_10000104 3300005985 Bacteria 197478
67 Ga0081539_10048191 3300005985 Bacteria 2426
68 Ga0097621_100000217 3300006237 Bacteria 38129
69 Ga0097621_100001907 3300006237 Bacteria 14243
70 Ga0097621_100002831 3300006237 Bacteria 11896
71 Ga0097621_100003352 3300006237 Bacteria 11021
72 Ga0097621_100040582 3300006237 Unclassified 3742
73 Ga0068871_100000637 3300006358 Bacteria 24086
74 Ga0068871_100001524 3300006358 Bacteria 15524
75 Ga0068871_100033381 3300006358 Unclassified 4075
76 Ga0075430_100026226 3300006846 Bacteria 4959
77 Ga0075434_100102765 3300006871 Bacteria 2866
78 Ga0068865_100023260 3300006881 Bacteria 4056
79 Ga0075436_100007193 3300006914 Bacteria 7612
80 Ga0097620_100045323 3300006931 Bacteria 4418
81 Ga0097620_100206274 3300006931 Bacteria 2051
82 Ga0105240_10031410 3300009093 Bacteria 6888
83 Ga0105240_10032464 3300009093 Bacteria 6760
84 Ga0105240_10037778 3300009093 Bacteria 6204
85 Ga0105240_10168549 3300009093 Bacteria 2595
86 Ga0105240_10428544 3300009093 Bacteria 1484
87 Ga0105245_10004649 3300009098 Bacteria 12129
88 Ga0105245_10007504 3300009098 Bacteria 9558
89 Ga0105245_10100607 3300009098 Bacteria 2674
90 Ga0114129_10051318 3300009147 Bacteria 5791
91 Ga0105242_10032260 3300009176 Unclassified 4188
92 Ga0105242_10070578 3300009176 Bacteria 2896
93 Ga0105242_10229252 3300009176 Bacteria 1664
94 Ga0105248_10009716 3300009177 Bacteria 10594
95 Ga0105248_10160802 3300009177 Unclassified 2533
96 Ga0105248_10395733 3300009177 Bacteria 1556
97 Ga0105237_10094053 3300009545 Bacteria 2986
98 Ga0105238_10000198 3300009551 Bacteria 66586
99 Ga0105239_10068208 3300010375 Unclassified 3908
100 Ga0105239_10220255 3300010375 Unclassified 2128
101 Ga0105246_10079091 3300011119 Bacteria 2337
102 Ga0105246_10116272 3300011119 Bacteria 1974
103 Ga0157373_10093157 3300013100 Bacteria 2122
104 Ga0157373_10107697 3300013100 Unclassified 1959
105 Ga0157371_10081895 3300013102 Bacteria 2285
106 Ga0157370_10011442 3300013104 Bacteria 9275
107 Ga0157370_10041000 3300013104 Bacteria 4469
108 Ga0157370_10087975 3300013104 Unclassified 2917
109 Ga0157369_10001064 3300013105 Bacteria 34528
110 Ga0157369_10006874 3300013105 Bacteria 13126
111 Ga0157369_10024173 3300013105 Bacteria 6762
112 Ga0157369_10255058 3300013105 Bacteria 1830
113 Ga0157374_10001451 3300013296 Bacteria 20030
114 Ga0157374_10001766 3300013296 Bacteria 18181
115 Ga0157374_10012849 3300013296 Bacteria 7292
116 Ga0157374_10131350 3300013296 Unclassified 2424
117 Ga0157374_10363845 3300013296 Unclassified 1439
118 Ga0157378_10000279 3300013297 Bacteria 49611
119 Ga0157378_10000549 3300013297 Bacteria 35656
120 Ga0157378_10006140 3300013297 Bacteria 10526
121 Ga0157378_10033197 3300013297 Bacteria 4561
122 Ga0157378_10297504 3300013297 Bacteria 1561
123 Ga0163162_10005937 3300013306 Bacteria 11818
124 Ga0157372_10002495 3300013307 Bacteria 19953
125 Ga0157372_10006511 3300013307 Bacteria 12434
126 Ga0157372_10009691 3300013307 Bacteria 10239
127 Ga0157372_10040273 3300013307 Bacteria 5160
128 Ga0157372_10264155 3300013307 Bacteria 1999
129 Ga0157375_10120279 3300013308 Bacteria 2735
130 Ga0157375_10297728 3300013308 Bacteria 1777
131 Ga0163163_10042250 3300014325 Bacteria 4464
132 Ga0163163_10188464 3300014325 Unclassified 2111
133 Ga0157379_10095588 3300014968 Bacteria 2666
134 Ga0157376_10027596 3300014969 Bacteria 4503
135 Ga0157376_10060468 3300014969 Bacteria 3182
136 Ga0157376_10128884 3300014969 Bacteria 2254
137 Ga0206353_11856375 3300020082 Bacteria 1661
138 Ga0228598_1002517 3300024227 Bacteria 3987
139 Ga0207680_10048932 3300025903 Bacteria 2513
140 Ga0207645_10141834 3300025907 Bacteria 1566
141 Ga0207684_10011828 3300025910 Bacteria 7608
142 Ga0207707_10005183 3300025912 Bacteria 11425
143 Ga0207707_10008080 3300025912 Bacteria 9134
144 Ga0207707_10040274 3300025912 Bacteria 4081
145 Ga0207695_10001042 3300025913 Bacteria 48764
146 Ga0207695_10212418 3300025913 Bacteria 1845
147 Ga0207660_10288019 3300025917 Bacteria 1305
148 Ga0207649_10021811 3300025920 Bacteria 3694
149 Ga0207652_10076193 3300025921 Unclassified 2924
150 Ga0207652_10083465 3300025921 Bacteria 2798
151 Ga0207652_10108116 3300025921 Unclassified 2464
152 Ga0207652_10224264 3300025921 Bacteria 1693
153 Ga0207694_10003795 3300025924 Bacteria 11950
154 Ga0207694_10106799 3300025924 Unclassified 2224
155 Ga0207650_10022001 3300025925 Bacteria 4512
156 Ga0207687_10005939 3300025927 Bacteria 8074
157 Ga0207687_10025733 3300025927 Unclassified 3938
158 Ga0207700_10311180 3300025928 Unclassified 1362
159 Ga0207644_10004083 3300025931 Bacteria 9469
160 Ga0207644_10186212 3300025931 Bacteria 1630
161 Ga0207686_10013004 3300025934 Unclassified 4594
162 Ga0207686_10051581 3300025934 Bacteria 2563
163 Ga0207704_10114825 3300025938 Unclassified 1829
164 Ga0207691_10052773 3300025940 Bacteria 3713
165 Ga0207711_10015045 3300025941 Bacteria 6425
166 Ga0207711_10023422 3300025941 Bacteria 5169
167 Ga0207689_10030239 3300025942 Bacteria 4513
168 Ga0207661_10017927 3300025944 Bacteria 5251
169 Ga0207661_10023366 3300025944 Bacteria 4670
170 Ga0207661_10076149 3300025944 Bacteria 2755
171 Ga0207679_10009347 3300025945 Bacteria 6279
172 Ga0207667_10002346 3300025949 Bacteria 23722
173 Ga0207667_10014488 3300025949 Bacteria 8987
174 Ga0207667_10031914 3300025949 Bacteria 5681
175 Ga0207651_10075212 3300025960 Unclassified 2409
176 Ga0207640_10146853 3300025981 Bacteria 1727
177 Ga0207677_10005368 3300026023 Bacteria 6952
178 Ga0207677_10018090 3300026023 Unclassified 4223
179 Ga0207677_10027135 3300026023 Bacteria 3602
180 Ga0207677_10069487 3300026023 Bacteria 2477
181 Ga0207703_10067778 3300026035 Unclassified 2938
182 Ga0207703_10084729 3300026035 Bacteria 2651
183 Ga0207639_10036627 3300026041 Bacteria 3637
184 Ga0207702_10001121 3300026078 Bacteria 27356
185 Ga0207702_10001291 3300026078 Bacteria 25054
186 Ga0207702_10159922 3300026078 Bacteria 2056
187 Ga0207641_10003848 3300026088 Bacteria 13142
188 Ga0207641_10211272 3300026088 Bacteria 1795
189 Ga0207648_10042766 3300026089 Unclassified 3978
190 Ga0207648_10118625 3300026089 Bacteria 2325
191 Ga0207676_10046932 3300026095 Bacteria 3345
192 Ga0207676_10263071 3300026095 Bacteria 1558
193 Ga0207674_10006472 3300026116 Bacteria 13769
194 Ga0207674_10031848 3300026116 Bacteria 5535
195 Ga0207674_10033425 3300026116 Bacteria 5385
196 Ga0207675_100052692 3300026118 Bacteria 3797
197 Ga0268264_10113546 3300028381 Bacteria 2377
198 Ga0265339_10020961 3300031249 Unclassified 3812
199 Ga0265316_10025618 3300031344 Unclassified 4919
200 Ga0307408_100016850 3300031548 Bacteria 4884
201 Ga0265314_10002485 3300031711 Bacteria 18841
202 Ga0265314_10073247 3300031711 Unclassified 2284
203 Ga0265314_10086717 3300031711 Unclassified 2048
204 Ga0316576_10043593 3300031727 Bacteria 3237
205 Ga0316576_10207320 3300031727 Bacteria 1476
206 Ga0307405_10001139 3300031731 Bacteria 10911
207 Ga0307413_10081317 3300031824 Bacteria 2077
208 Ga0307413_10111195 3300031824 Bacteria 1834
209 Ga0307410_10000633 3300031852 Bacteria 14512
210 Ga0307410_10126825 3300031852 Bacteria 1869
211 Ga0307406_10012851 3300031901 Bacteria 4782
212 Ga0307407_10001813 3300031903 Bacteria 8008
213 Ga0307407_10035274 3300031903 Bacteria 2747
214 Ga0307407_10044425 3300031903 Bacteria 2504
215 Ga0307412_10012646 3300031911 Bacteria 4926
216 Ga0307409_100000059 3300031995 Bacteria 39752
217 Ga0307409_100095491 3300031995 Bacteria 2450
218 Ga0307409_100167648 3300031995 Bacteria 1929
219 Ga0307416_100016335 3300032002 Bacteria 5155
220 Ga0307416_100096461 3300032002 Bacteria 2557
221 Ga0307414_10230778 3300032004 Bacteria 1526
222 Ga0307411_10000079 3300032005 Bacteria 30144
223 Ga0307415_100000396 3300032126 Bacteria 18556
224 Ga0373931_0020640 3300035691 Unclassified 3298
225 Ga0451577_0011067 3300042876 Bacteria 8568
226 Ga0451577_0035870 3300042876 Bacteria 4466
227 Ga0451577_0290132 3300042876 Bacteria 1482
228 Ga0453684_0001810 3300044712 Bacteria 56611
229 Ga0453684_0034318 3300044712 Bacteria 7044
230 Ga0453684_0084408 3300044712 Bacteria 3949
231 Ga0495628_0046144 3300046516 Bacteria 3462
232 Ga0495586_0035516 3300046535 Bacteria 2678
233 Ga0495581_0205753 3300047315 Bacteria 1151
234 Ga0495674_0012367 3300047319 Bacteria 8039
235 Ga0495684_0030184 3300047471 Bacteria 4162
236 Ga0495602_0242710 3300048088 Bacteria 1347
237 Ga0496112_0009753 3300048915 Bacteria 8669
238 Ga0501037_0108623 3300049573 Bacteria 1999
239 nmdc:mga06r32_123207_c1 3300050510 Bacteria 2558
240 nmdc:mga06r32_298618_c1 3300050510 Bacteria 1597
241 nmdc:mga0n895_41556_c1 3300050512 Bacteria 4471
242 nmdc:mga08x19_14997_c1 3300050514 Bacteria 4706

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0205753 Ga0495581_0205753_15_1052 309
2 3300031344 Ga0265316_10025618 Ga0265316_100256182 347
3 3300005546 Ga0070696_100003363 Ga0070696_1000033639 348
4 iso_pu_bacteria 2913036834 2913040317 348
5 3300031903 Ga0307407_10035274 Ga0307407_100352741 351
6 3300042876 Ga0451577_0290132 Ga0451577_0290132_304_1374 352
7 3300044712 Ga0453684_0034318 Ga0453684_0034318_3743_4813 352
8 3300005985 Ga0081539_10048191 Ga0081539_100481912 353
9 3300005985 Ga0081539_10000104 Ga0081539_1000010483 356
10 3300031727 Ga0316576_10043593 Ga0316576_100435932 358
11 3300042876 Ga0451577_0011067 Ga0451577_0011067_6254_7366 359
12 3300044712 Ga0453684_0001810 Ga0453684_0001810_8176_9288 359
13 iso_pu_bacteria 2775506925 2776371711 359
14 iso_pu_bacteria 2863067949 2863072806 359
15 3300005329 Ga0070683_100308349 Ga0070683_1003083492 360
16 3300046516 Ga0495628_0046144 Ga0495628_0046144_1209_2414 360
17 3300047319 Ga0495674_0012367 Ga0495674_0012367_5178_6383 360
18 3300047471 Ga0495684_0030184 Ga0495684_0030184_2281_3486 360
19 3300048088 Ga0495602_0242710 Ga0495602_0242710_122_1327 360
20 3300005355 Ga0070671_100009821 Ga0070671_1000098215 361
21 3300005364 Ga0070673_100159144 Ga0070673_1001591442 361
22 3300005842 Ga0068858_100032776 Ga0068858_1000327763 361
23 3300006237 Ga0097621_100003352 Ga0097621_1000033523 361
24 3300006358 Ga0068871_100033381 Ga0068871_1000333812 361
25 3300025927 Ga0207687_10025733 Ga0207687_100257333 361
26 3300025931 Ga0207644_10004083 Ga0207644_100040835 361
27 3300026035 Ga0207703_10067778 Ga0207703_100677783 361
28 3300005335 Ga0070666_10008882 Ga0070666_100088823 362
29 3300005458 Ga0070681_10013374 Ga0070681_100133745 362
30 3300005530 Ga0070679_100142374 Ga0070679_1001423742 362
31 3300005546 Ga0070696_100000297 Ga0070696_1000002978 362
32 3300005577 Ga0068857_100007994 Ga0068857_1000079945 362
33 3300005577 Ga0068857_100039937 Ga0068857_1000399372 362
34 3300005843 Ga0068860_100030892 Ga0068860_1000308924 362
35 3300006237 Ga0097621_100002831 Ga0097621_10000283111 362
36 3300006237 Ga0097621_100040582 Ga0097621_1000405823 362
37 3300009093 Ga0105240_10428544 Ga0105240_104285441 362
38 3300009098 Ga0105245_10004649 Ga0105245_100046496 362
39 3300009176 Ga0105242_10070578 Ga0105242_100705782 362
40 3300009545 Ga0105237_10094053 Ga0105237_100940532 362
41 3300011119 Ga0105246_10079091 Ga0105246_100790912 362
42 3300013296 Ga0157374_10131350 Ga0157374_101313502 362
43 3300013306 Ga0163162_10005937 Ga0163162_100059377 362
44 3300014325 Ga0163163_10042250 Ga0163163_100422502 362
45 3300014325 Ga0163163_10188464 Ga0163163_101884642 362
46 3300014968 Ga0157379_10095588 Ga0157379_100955881 362
47 3300014969 Ga0157376_10128884 Ga0157376_101288842 362
48 3300025903 Ga0207680_10048932 Ga0207680_100489322 362
49 3300025917 Ga0207660_10288019 Ga0207660_102880191 362
50 3300025921 Ga0207652_10108116 Ga0207652_101081162 362
51 3300025927 Ga0207687_10005939 Ga0207687_100059392 362
52 3300025934 Ga0207686_10013004 Ga0207686_100130044 362
53 3300025941 Ga0207711_10023422 Ga0207711_100234223 362
54 3300026023 Ga0207677_10027135 Ga0207677_100271352 362
55 3300026035 Ga0207703_10084729 Ga0207703_100847293 362
56 3300026116 Ga0207674_10006472 Ga0207674_100064727 362
57 3300028381 Ga0268264_10113546 Ga0268264_101135462 362
58 3300005468 Ga0070707_100058015 Ga0070707_1000580152 363
59 3300005535 Ga0070684_100175963 Ga0070684_1001759632 364
60 3300009176 Ga0105242_10229252 Ga0105242_102292522 364
61 3300013307 Ga0157372_10264155 Ga0157372_102641552 364
62 3300031711 Ga0265314_10002485 Ga0265314_100024852 364
63 3300005329 Ga0070683_100119417 Ga0070683_1001194172 365
64 3300005329 Ga0070683_100217657 Ga0070683_1002176571 365
65 3300005331 Ga0070670_100021827 Ga0070670_1000218272 365
66 3300005334 Ga0068869_100004345 Ga0068869_1000043454 365
67 3300005335 Ga0070666_10034334 Ga0070666_100343343 365
68 3300005336 Ga0070680_100096521 Ga0070680_1000965212 365
69 3300005338 Ga0068868_100005747 Ga0068868_1000057475 365
70 3300005338 Ga0068868_100010746 Ga0068868_1000107464 365
71 3300005338 Ga0068868_100027920 Ga0068868_1000279203 365
72 3300005458 Ga0070681_10000293 Ga0070681_100002935 365
73 3300005458 Ga0070681_10031897 Ga0070681_100318974 365
74 3300005459 Ga0068867_100029593 Ga0068867_1000295932 365
75 3300005459 Ga0068867_100102944 Ga0068867_1001029442 365
76 3300005530 Ga0070679_100012622 Ga0070679_1000126222 365
77 3300005535 Ga0070684_100030225 Ga0070684_1000302252 365
78 3300005547 Ga0070693_100057451 Ga0070693_1000574513 365
79 3300005563 Ga0068855_100000500 Ga0068855_10000050017 365
80 3300005563 Ga0068855_100005759 Ga0068855_1000057591 365
81 3300005563 Ga0068855_100007031 Ga0068855_1000070311 365
82 3300005563 Ga0068855_100047244 Ga0068855_1000472442 365
83 3300005577 Ga0068857_100006186 Ga0068857_1000061861 365
84 3300005578 Ga0068854_100018021 Ga0068854_1000180212 365
85 3300005614 Ga0068856_100001116 Ga0068856_1000011162 365
86 3300005614 Ga0068856_100003796 Ga0068856_1000037968 365
87 3300005614 Ga0068856_100005044 Ga0068856_1000050446 365
88 3300005614 Ga0068856_100080676 Ga0068856_1000806762 365
89 3300005614 Ga0068856_100204842 Ga0068856_1002048422 365
90 3300005617 Ga0068859_100045324 Ga0068859_1000453244 365
91 3300005618 Ga0068864_100005947 Ga0068864_1000059474 365
92 3300005841 Ga0068863_100007622 Ga0068863_1000076222 365
93 3300005842 Ga0068858_100012496 Ga0068858_1000124965 365
94 3300005843 Ga0068860_100071497 Ga0068860_1000714971 365
95 3300006237 Ga0097621_100000217 Ga0097621_10000021718 365
96 3300006237 Ga0097621_100001907 Ga0097621_1000019078 365
97 3300006358 Ga0068871_100000637 Ga0068871_1000006377 365
98 3300006358 Ga0068871_100001524 Ga0068871_1000015245 365
99 3300006881 Ga0068865_100023260 Ga0068865_1000232602 365
100 3300006931 Ga0097620_100045323 Ga0097620_1000453234 365
101 3300009093 Ga0105240_10031410 Ga0105240_100314103 365
102 3300009098 Ga0105245_10007504 Ga0105245_100075044 365
103 3300009176 Ga0105242_10032260 Ga0105242_100322603 365
104 3300009177 Ga0105248_10009716 Ga0105248_100097165 365
105 3300009177 Ga0105248_10160802 Ga0105248_101608022 365
106 3300009551 Ga0105238_10000198 Ga0105238_1000019814 365
107 3300010375 Ga0105239_10068208 Ga0105239_100682082 365
108 3300010375 Ga0105239_10220255 Ga0105239_102202552 365
109 3300011119 Ga0105246_10116272 Ga0105246_101162722 365
110 3300013100 Ga0157373_10107697 Ga0157373_101076971 365
111 3300013102 Ga0157371_10081895 Ga0157371_100818952 365
112 3300013104 Ga0157370_10087975 Ga0157370_100879752 365
113 3300013105 Ga0157369_10001064 Ga0157369_1000106425 365
114 3300013105 Ga0157369_10024173 Ga0157369_100241737 365
115 3300013105 Ga0157369_10255058 Ga0157369_102550582 365
116 3300013296 Ga0157374_10001451 Ga0157374_1000145110 365
117 3300013296 Ga0157374_10001766 Ga0157374_100017664 365
118 3300013296 Ga0157374_10012849 Ga0157374_100128495 365
119 3300013297 Ga0157378_10000279 Ga0157378_1000027913 365
120 3300013297 Ga0157378_10000549 Ga0157378_100005493 365
121 3300013297 Ga0157378_10006140 Ga0157378_100061407 365
122 3300013297 Ga0157378_10033197 Ga0157378_100331972 365
123 3300013307 Ga0157372_10002495 Ga0157372_100024958 365
124 3300013307 Ga0157372_10006511 Ga0157372_100065115 365
125 3300013307 Ga0157372_10009691 Ga0157372_100096912 365
126 3300013308 Ga0157375_10297728 Ga0157375_102977282 365
127 3300014969 Ga0157376_10027596 Ga0157376_100275963 365
128 3300024227 Ga0228598_1002517 Ga0228598_10025173 365
129 3300025912 Ga0207707_10005183 Ga0207707_100051834 365
130 3300025912 Ga0207707_10040274 Ga0207707_100402742 365
131 3300025921 Ga0207652_10076193 Ga0207652_100761933 365
132 3300025921 Ga0207652_10083465 Ga0207652_100834652 365
133 3300025924 Ga0207694_10003795 Ga0207694_100037954 365
134 3300025924 Ga0207694_10106799 Ga0207694_101067992 365
135 3300025925 Ga0207650_10022001 Ga0207650_100220012 365
136 3300025928 Ga0207700_10311180 Ga0207700_103111801 365
137 3300025938 Ga0207704_10114825 Ga0207704_101148251 365
138 3300025941 Ga0207711_10015045 Ga0207711_100150455 365
139 3300025942 Ga0207689_10030239 Ga0207689_100302394 365
140 3300025944 Ga0207661_10017927 Ga0207661_100179272 365
141 3300025944 Ga0207661_10076149 Ga0207661_100761492 365
142 3300025949 Ga0207667_10002346 Ga0207667_100023465 365
143 3300025949 Ga0207667_10014488 Ga0207667_100144882 365
144 3300025949 Ga0207667_10031914 Ga0207667_100319143 365
145 3300025960 Ga0207651_10075212 Ga0207651_100752121 365
146 3300026023 Ga0207677_10005368 Ga0207677_100053685 365
147 3300026023 Ga0207677_10018090 Ga0207677_100180903 365
148 3300026078 Ga0207702_10001121 Ga0207702_100011216 365
149 3300026078 Ga0207702_10001291 Ga0207702_100012913 365
150 3300026088 Ga0207641_10003848 Ga0207641_100038485 365
151 3300026088 Ga0207641_10211272 Ga0207641_102112722 365
152 3300026089 Ga0207648_10042766 Ga0207648_100427662 365
153 3300026089 Ga0207648_10118625 Ga0207648_101186253 365
154 3300026095 Ga0207676_10046932 Ga0207676_100469322 365
155 3300026095 Ga0207676_10263071 Ga0207676_102630712 365
156 3300026116 Ga0207674_10033425 Ga0207674_100334253 365
157 3300031249 Ga0265339_10020961 Ga0265339_100209612 365
158 3300031711 Ga0265314_10073247 Ga0265314_100732472 365
159 3300031711 Ga0265314_10086717 Ga0265314_100867172 365
160 3300031824 Ga0307413_10081317 Ga0307413_100813172 365
161 3300035691 Ga0373931_0020640 Ga0373931_0020640_580_1749 365
162 3300048915 Ga0496112_0009753 Ga0496112_0009753_2493_3662 365
163 3300009093 Ga0105240_10032464 Ga0105240_100324642 366
164 3300009093 Ga0105240_10168549 Ga0105240_101685492 366
165 3300013104 Ga0157370_10041000 Ga0157370_100410002 366
166 3300031727 Ga0316576_10207320 Ga0316576_102073201 366
167 3300050514 nmdc:mga08x19_14997_c1 nmdc:mga08x19_14997_c1_421_1521 366
168 3300026118 Ga0207675_100052692 Ga0207675_1000526923 367
169 3300031852 Ga0307410_10126825 Ga0307410_101268252 369
170 3300031903 Ga0307407_10044425 Ga0307407_100444252 369
171 3300031995 Ga0307409_100095491 Ga0307409_1000954912 369
172 3300031995 Ga0307409_100167648 Ga0307409_1001676482 369
173 3300032002 Ga0307416_100096461 Ga0307416_1000964612 369
174 3300004803 Ga0058862_11807904 Ga0058862_118079041 370
175 3300005327 Ga0070658_10006394 Ga0070658_100063946 370
176 3300005329 Ga0070683_100002790 Ga0070683_10000279014 370
177 3300005329 Ga0070683_100030282 Ga0070683_1000302822 370
178 3300005329 Ga0070683_100066714 Ga0070683_1000667143 370
179 3300005330 Ga0070690_100010141 Ga0070690_1000101415 370
180 3300005335 Ga0070666_10179262 Ga0070666_101792622 370
181 3300005338 Ga0068868_100249960 Ga0068868_1002499602 370
182 3300005341 Ga0070691_10032960 Ga0070691_100329602 370
183 3300005347 Ga0070668_100053992 Ga0070668_1000539923 370
184 3300005353 Ga0070669_100156019 Ga0070669_1001560192 370
185 3300005355 Ga0070671_100028715 Ga0070671_1000287153 370
186 3300005439 Ga0070711_100079675 Ga0070711_1000796752 370
187 3300005458 Ga0070681_10001656 Ga0070681_100016562 370
188 3300005535 Ga0070684_100193697 Ga0070684_1001936972 370
189 3300005564 Ga0070664_100116184 Ga0070664_1001161842 370
190 3300005564 Ga0070664_100277561 Ga0070664_1002775611 370
191 3300005577 Ga0068857_100019991 Ga0068857_1000199915 370
192 3300005617 Ga0068859_100206268 Ga0068859_1002062682 370
193 3300006846 Ga0075430_100026226 Ga0075430_1000262265 370
194 3300006871 Ga0075434_100102765 Ga0075434_1001027652 370
195 3300006914 Ga0075436_100007193 Ga0075436_1000071932 370
196 3300006931 Ga0097620_100206274 Ga0097620_1002062741 370
197 3300009093 Ga0105240_10037778 Ga0105240_100377784 370
198 3300009098 Ga0105245_10100607 Ga0105245_101006072 370
199 3300009147 Ga0114129_10051318 Ga0114129_100513184 370
200 3300009177 Ga0105248_10395733 Ga0105248_103957331 370
201 3300013100 Ga0157373_10093157 Ga0157373_100931572 370
202 3300013104 Ga0157370_10011442 Ga0157370_100114425 370
203 3300013105 Ga0157369_10006874 Ga0157369_100068742 370
204 3300013296 Ga0157374_10363845 Ga0157374_103638452 370
205 3300013297 Ga0157378_10297504 Ga0157378_102975042 370
206 3300013307 Ga0157372_10040273 Ga0157372_100402733 370
207 3300013308 Ga0157375_10120279 Ga0157375_101202792 370
208 3300014969 Ga0157376_10060468 Ga0157376_100604683 370
209 3300020082 Ga0206353_11856375 Ga0206353_118563752 370
210 3300025907 Ga0207645_10141834 Ga0207645_101418342 370
211 3300025910 Ga0207684_10011828 Ga0207684_100118282 370
212 3300025912 Ga0207707_10008080 Ga0207707_100080802 370
213 3300025913 Ga0207695_10001042 Ga0207695_100010423 370
214 3300025913 Ga0207695_10212418 Ga0207695_102124182 370
215 3300025920 Ga0207649_10021811 Ga0207649_100218112 370
216 3300025921 Ga0207652_10224264 Ga0207652_102242642 370
217 3300025931 Ga0207644_10186212 Ga0207644_101862122 370
218 3300025934 Ga0207686_10051581 Ga0207686_100515812 370
219 3300025940 Ga0207691_10052773 Ga0207691_100527732 370
220 3300025944 Ga0207661_10023366 Ga0207661_100233664 370
221 3300025945 Ga0207679_10009347 Ga0207679_100093476 370
222 3300025981 Ga0207640_10146853 Ga0207640_101468531 370
223 3300026023 Ga0207677_10069487 Ga0207677_100694872 370
224 3300026041 Ga0207639_10036627 Ga0207639_100366272 370
225 3300026078 Ga0207702_10159922 Ga0207702_101599222 370
226 3300026116 Ga0207674_10031848 Ga0207674_100318482 370
227 3300031548 Ga0307408_100016850 Ga0307408_1000168504 370
228 3300031731 Ga0307405_10001139 Ga0307405_100011394 370
229 3300031824 Ga0307413_10111195 Ga0307413_101111952 370
230 3300031852 Ga0307410_10000633 Ga0307410_1000063311 370
231 3300031901 Ga0307406_10012851 Ga0307406_100128512 370
232 3300031903 Ga0307407_10001813 Ga0307407_100018134 370
233 3300031911 Ga0307412_10012646 Ga0307412_100126462 370
234 3300031995 Ga0307409_100000059 Ga0307409_1000000594 370
235 3300032002 Ga0307416_100016335 Ga0307416_1000163352 370
236 3300032004 Ga0307414_10230778 Ga0307414_102307782 370
237 3300032005 Ga0307411_10000079 Ga0307411_1000007917 370
238 3300032126 Ga0307415_100000396 Ga0307415_1000003964 370
239 3300042876 Ga0451577_0035870 Ga0451577_0035870_1077_2189 370
240 3300044712 Ga0453684_0084408 Ga0453684_0084408_529_1641 370
241 3300046535 Ga0495586_0035516 Ga0495586_0035516_1302_2414 370
242 3300049573 Ga0501037_0108623 Ga0501037_0108623_540_1652 370
243 3300050510 nmdc:mga06r32_123207_c1 nmdc:mga06r32_123207_c1_69_1217 370
244 3300050510 nmdc:mga06r32_298618_c1 nmdc:mga06r32_298618_c1_252_1400 370
245 3300050512 nmdc:mga0n895_41556_c1 nmdc:mga0n895_41556_c1_530_1642 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

155

428

0.94

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

22

145

0.94

PF00155

Aminotran_1_2

Aminotransferase class I and II

28

141

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3frk-assembly1.cif.gz_B x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine 0.9795 1 366
3frk-assembly1.cif.gz_B x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine 0.9742 1 366
2oga-assembly1.cif.gz_A x-ray crystal structure of s. venezuelae desv in complex with ketimine intermediate 0.9736 2 370
7b0d-assembly1.cif.gz_B sugar transaminase from archaeoglobus veneficus 0.9729 1 368
3nu7-assembly1.cif.gz_A wbpe, an aminotransferase from pseudomonas aeruginosa involved in o-antigen assembly in complex with the cofactor pmp 0.9684 3 364
ID Description Score Start End Superfamily
3frkB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9696 250 366 3.90.1150.10
3uwcA02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9647 250 368 3.90.1150.10
2ogaB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9643 250 367 3.90.1150.10
af_Q58466_257_386_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9578 251 366 3.90.1150.10
2ogeD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9542 1 247 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A6M4IN30-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9972 1 370 GO:0000271
GO:0008483
GO:0030170
AF-A0A847XTC3-F1-model_v4 Transcriptional regulator 0.992 180 368 GO:0000271
GO:0008483
GO:0030170
AF-A0A0F4W2L2-F1-model_v4 deleted 0.9896 244 365
AF-A0A2M8Q735-F1-model_v4 Aminotransferase DegT 0.9895 18 145 GO:0000271
GO:0008483
GO:0030170
AF-A0A7W1L4E0-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9886 190 367 GO:0000271
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
96.32 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map