F357194
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 245 | 129 | 242 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100047244|Ga0068855_1000472442 |
| Length | 432 |
| Sequence | MPKLQPSAVADIPTLDLKRQYVDIEGEVRAAIGRVCASQQFVLGPEVEAFEQELAQFVGAKHAVGCASGTDALWLALAAAGVGPGDRVITTPFSFFASASSIVRAGAEPVFVDIEPETMNLDPANVRDFLKKTSGFLDSNNQSVVGSMRFAQNDRRKRGQSQVAGRIKAILPVHLYGQCADMTAFQRIASEHDIVLIEDAAQAIGAKCNGNPAGSMGVAAAFSFYPTKNLSAYGDAGMVTTNDPALADHMRRLRNHGSPERYLHTEFGWNARMDAIQAAVLRVKLKHINRWNDRRRNHAETYSLLLKKAGLVAEGFSPEENAGSADRANRSGFPLQLLHTSPYAFHIFHQYVIRAERRDELRAFLKSRGIASEVYYPLPLHLQPVFAYLGYKRGDLPETEKAPNEVLALPMFPELTREEIARVVAEIADFYS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 2 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 3 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 107 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 119 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 126 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.96 |
| Metatranscriptomes | 0.82 |
| Isolates | 1.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.41 |
| Rhizosphere | 99.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058862_11807904 | 3300004803 | Bacteria | 1373 |
| 2 | Ga0070658_10006394 | 3300005327 | Bacteria | 9547 |
| 3 | Ga0070683_100002790 | 3300005329 | Bacteria | 13968 |
| 4 | Ga0070683_100030282 | 3300005329 | Bacteria | 4910 |
| 5 | Ga0070683_100066714 | 3300005329 | Bacteria | 3352 |
| 6 | Ga0070683_100119417 | 3300005329 | Bacteria | 2490 |
| 7 | Ga0070683_100217657 | 3300005329 | Bacteria | 1815 |
| 8 | Ga0070683_100308349 | 3300005329 | Bacteria | 1506 |
| 9 | Ga0070690_100010141 | 3300005330 | Bacteria | 5473 |
| 10 | Ga0070670_100021827 | 3300005331 | Bacteria | 5506 |
| 11 | Ga0068869_100004345 | 3300005334 | Bacteria | 8798 |
| 12 | Ga0070666_10008882 | 3300005335 | Bacteria | 6249 |
| 13 | Ga0070666_10034334 | 3300005335 | Unclassified | 3362 |
| 14 | Ga0070666_10179262 | 3300005335 | Bacteria | 1485 |
| 15 | Ga0070680_100096521 | 3300005336 | Bacteria | 2451 |
| 16 | Ga0068868_100005747 | 3300005338 | Bacteria | 8731 |
| 17 | Ga0068868_100010746 | 3300005338 | Bacteria | 6637 |
| 18 | Ga0068868_100027920 | 3300005338 | Unclassified | 4309 |
| 19 | Ga0068868_100249960 | 3300005338 | Bacteria | 1492 |
| 20 | Ga0070691_10032960 | 3300005341 | Bacteria | 2435 |
| 21 | Ga0070668_100053992 | 3300005347 | Bacteria | 3099 |
| 22 | Ga0070669_100156019 | 3300005353 | Bacteria | 1770 |
| 23 | Ga0070671_100009821 | 3300005355 | Bacteria | 7681 |
| 24 | Ga0070671_100028715 | 3300005355 | Bacteria | 4583 |
| 25 | Ga0070673_100159144 | 3300005364 | Bacteria | 1919 |
| 26 | Ga0070711_100079675 | 3300005439 | Unclassified | 2330 |
| 27 | Ga0070681_10000293 | 3300005458 | Bacteria | 40403 |
| 28 | Ga0070681_10001656 | 3300005458 | Bacteria | 19888 |
| 29 | Ga0070681_10013374 | 3300005458 | Bacteria | 8155 |
| 30 | Ga0070681_10031897 | 3300005458 | Bacteria | 5289 |
| 31 | Ga0068867_100029593 | 3300005459 | Unclassified | 3947 |
| 32 | Ga0068867_100102944 | 3300005459 | Bacteria | 2183 |
| 33 | Ga0070707_100058015 | 3300005468 | Bacteria | 3713 |
| 34 | Ga0070679_100012622 | 3300005530 | Bacteria | 8080 |
| 35 | Ga0070679_100142374 | 3300005530 | Unclassified | 2377 |
| 36 | Ga0070684_100030225 | 3300005535 | Bacteria | 4601 |
| 37 | Ga0070684_100175963 | 3300005535 | Bacteria | 1945 |
| 38 | Ga0070684_100193697 | 3300005535 | Bacteria | 1850 |
| 39 | Ga0070696_100000297 | 3300005546 | Bacteria | 29960 |
| 40 | Ga0070696_100003363 | 3300005546 | Bacteria | 10669 |
| 41 | Ga0070693_100057451 | 3300005547 | Unclassified | 2249 |
| 42 | Ga0068855_100000500 | 3300005563 | Bacteria | 48457 |
| 43 | Ga0068855_100005759 | 3300005563 | Bacteria | 15132 |
| 44 | Ga0068855_100007031 | 3300005563 | Bacteria | 13655 |
| 45 | Ga0068855_100047244 | 3300005563 | Bacteria | 5086 |
| 46 | Ga0070664_100116184 | 3300005564 | Bacteria | 2339 |
| 47 | Ga0070664_100277561 | 3300005564 | Bacteria | 1511 |
| 48 | Ga0068857_100006186 | 3300005577 | Bacteria | 10232 |
| 49 | Ga0068857_100007994 | 3300005577 | Bacteria | 9127 |
| 50 | Ga0068857_100019991 | 3300005577 | Bacteria | 5886 |
| 51 | Ga0068857_100039937 | 3300005577 | Unclassified | 4159 |
| 52 | Ga0068854_100018021 | 3300005578 | Bacteria | 4734 |
| 53 | Ga0068856_100001116 | 3300005614 | Bacteria | 28358 |
| 54 | Ga0068856_100003796 | 3300005614 | Bacteria | 15133 |
| 55 | Ga0068856_100005044 | 3300005614 | Bacteria | 13071 |
| 56 | Ga0068856_100080676 | 3300005614 | Bacteria | 3227 |
| 57 | Ga0068856_100204842 | 3300005614 | Unclassified | 1987 |
| 58 | Ga0068859_100045324 | 3300005617 | Bacteria | 4418 |
| 59 | Ga0068859_100206268 | 3300005617 | Bacteria | 2051 |
| 60 | Ga0068864_100005947 | 3300005618 | Bacteria | 10007 |
| 61 | Ga0068863_100007622 | 3300005841 | Bacteria | 10585 |
| 62 | Ga0068858_100012496 | 3300005842 | Bacteria | 8009 |
| 63 | Ga0068858_100032776 | 3300005842 | Unclassified | 4825 |
| 64 | Ga0068860_100030892 | 3300005843 | Bacteria | 5150 |
| 65 | Ga0068860_100071497 | 3300005843 | Bacteria | 3297 |
| 66 | Ga0081539_10000104 | 3300005985 | Bacteria | 197478 |
| 67 | Ga0081539_10048191 | 3300005985 | Bacteria | 2426 |
| 68 | Ga0097621_100000217 | 3300006237 | Bacteria | 38129 |
| 69 | Ga0097621_100001907 | 3300006237 | Bacteria | 14243 |
| 70 | Ga0097621_100002831 | 3300006237 | Bacteria | 11896 |
| 71 | Ga0097621_100003352 | 3300006237 | Bacteria | 11021 |
| 72 | Ga0097621_100040582 | 3300006237 | Unclassified | 3742 |
| 73 | Ga0068871_100000637 | 3300006358 | Bacteria | 24086 |
| 74 | Ga0068871_100001524 | 3300006358 | Bacteria | 15524 |
| 75 | Ga0068871_100033381 | 3300006358 | Unclassified | 4075 |
| 76 | Ga0075430_100026226 | 3300006846 | Bacteria | 4959 |
| 77 | Ga0075434_100102765 | 3300006871 | Bacteria | 2866 |
| 78 | Ga0068865_100023260 | 3300006881 | Bacteria | 4056 |
| 79 | Ga0075436_100007193 | 3300006914 | Bacteria | 7612 |
| 80 | Ga0097620_100045323 | 3300006931 | Bacteria | 4418 |
| 81 | Ga0097620_100206274 | 3300006931 | Bacteria | 2051 |
| 82 | Ga0105240_10031410 | 3300009093 | Bacteria | 6888 |
| 83 | Ga0105240_10032464 | 3300009093 | Bacteria | 6760 |
| 84 | Ga0105240_10037778 | 3300009093 | Bacteria | 6204 |
| 85 | Ga0105240_10168549 | 3300009093 | Bacteria | 2595 |
| 86 | Ga0105240_10428544 | 3300009093 | Bacteria | 1484 |
| 87 | Ga0105245_10004649 | 3300009098 | Bacteria | 12129 |
| 88 | Ga0105245_10007504 | 3300009098 | Bacteria | 9558 |
| 89 | Ga0105245_10100607 | 3300009098 | Bacteria | 2674 |
| 90 | Ga0114129_10051318 | 3300009147 | Bacteria | 5791 |
| 91 | Ga0105242_10032260 | 3300009176 | Unclassified | 4188 |
| 92 | Ga0105242_10070578 | 3300009176 | Bacteria | 2896 |
| 93 | Ga0105242_10229252 | 3300009176 | Bacteria | 1664 |
| 94 | Ga0105248_10009716 | 3300009177 | Bacteria | 10594 |
| 95 | Ga0105248_10160802 | 3300009177 | Unclassified | 2533 |
| 96 | Ga0105248_10395733 | 3300009177 | Bacteria | 1556 |
| 97 | Ga0105237_10094053 | 3300009545 | Bacteria | 2986 |
| 98 | Ga0105238_10000198 | 3300009551 | Bacteria | 66586 |
| 99 | Ga0105239_10068208 | 3300010375 | Unclassified | 3908 |
| 100 | Ga0105239_10220255 | 3300010375 | Unclassified | 2128 |
| 101 | Ga0105246_10079091 | 3300011119 | Bacteria | 2337 |
| 102 | Ga0105246_10116272 | 3300011119 | Bacteria | 1974 |
| 103 | Ga0157373_10093157 | 3300013100 | Bacteria | 2122 |
| 104 | Ga0157373_10107697 | 3300013100 | Unclassified | 1959 |
| 105 | Ga0157371_10081895 | 3300013102 | Bacteria | 2285 |
| 106 | Ga0157370_10011442 | 3300013104 | Bacteria | 9275 |
| 107 | Ga0157370_10041000 | 3300013104 | Bacteria | 4469 |
| 108 | Ga0157370_10087975 | 3300013104 | Unclassified | 2917 |
| 109 | Ga0157369_10001064 | 3300013105 | Bacteria | 34528 |
| 110 | Ga0157369_10006874 | 3300013105 | Bacteria | 13126 |
| 111 | Ga0157369_10024173 | 3300013105 | Bacteria | 6762 |
| 112 | Ga0157369_10255058 | 3300013105 | Bacteria | 1830 |
| 113 | Ga0157374_10001451 | 3300013296 | Bacteria | 20030 |
| 114 | Ga0157374_10001766 | 3300013296 | Bacteria | 18181 |
| 115 | Ga0157374_10012849 | 3300013296 | Bacteria | 7292 |
| 116 | Ga0157374_10131350 | 3300013296 | Unclassified | 2424 |
| 117 | Ga0157374_10363845 | 3300013296 | Unclassified | 1439 |
| 118 | Ga0157378_10000279 | 3300013297 | Bacteria | 49611 |
| 119 | Ga0157378_10000549 | 3300013297 | Bacteria | 35656 |
| 120 | Ga0157378_10006140 | 3300013297 | Bacteria | 10526 |
| 121 | Ga0157378_10033197 | 3300013297 | Bacteria | 4561 |
| 122 | Ga0157378_10297504 | 3300013297 | Bacteria | 1561 |
| 123 | Ga0163162_10005937 | 3300013306 | Bacteria | 11818 |
| 124 | Ga0157372_10002495 | 3300013307 | Bacteria | 19953 |
| 125 | Ga0157372_10006511 | 3300013307 | Bacteria | 12434 |
| 126 | Ga0157372_10009691 | 3300013307 | Bacteria | 10239 |
| 127 | Ga0157372_10040273 | 3300013307 | Bacteria | 5160 |
| 128 | Ga0157372_10264155 | 3300013307 | Bacteria | 1999 |
| 129 | Ga0157375_10120279 | 3300013308 | Bacteria | 2735 |
| 130 | Ga0157375_10297728 | 3300013308 | Bacteria | 1777 |
| 131 | Ga0163163_10042250 | 3300014325 | Bacteria | 4464 |
| 132 | Ga0163163_10188464 | 3300014325 | Unclassified | 2111 |
| 133 | Ga0157379_10095588 | 3300014968 | Bacteria | 2666 |
| 134 | Ga0157376_10027596 | 3300014969 | Bacteria | 4503 |
| 135 | Ga0157376_10060468 | 3300014969 | Bacteria | 3182 |
| 136 | Ga0157376_10128884 | 3300014969 | Bacteria | 2254 |
| 137 | Ga0206353_11856375 | 3300020082 | Bacteria | 1661 |
| 138 | Ga0228598_1002517 | 3300024227 | Bacteria | 3987 |
| 139 | Ga0207680_10048932 | 3300025903 | Bacteria | 2513 |
| 140 | Ga0207645_10141834 | 3300025907 | Bacteria | 1566 |
| 141 | Ga0207684_10011828 | 3300025910 | Bacteria | 7608 |
| 142 | Ga0207707_10005183 | 3300025912 | Bacteria | 11425 |
| 143 | Ga0207707_10008080 | 3300025912 | Bacteria | 9134 |
| 144 | Ga0207707_10040274 | 3300025912 | Bacteria | 4081 |
| 145 | Ga0207695_10001042 | 3300025913 | Bacteria | 48764 |
| 146 | Ga0207695_10212418 | 3300025913 | Bacteria | 1845 |
| 147 | Ga0207660_10288019 | 3300025917 | Bacteria | 1305 |
| 148 | Ga0207649_10021811 | 3300025920 | Bacteria | 3694 |
| 149 | Ga0207652_10076193 | 3300025921 | Unclassified | 2924 |
| 150 | Ga0207652_10083465 | 3300025921 | Bacteria | 2798 |
| 151 | Ga0207652_10108116 | 3300025921 | Unclassified | 2464 |
| 152 | Ga0207652_10224264 | 3300025921 | Bacteria | 1693 |
| 153 | Ga0207694_10003795 | 3300025924 | Bacteria | 11950 |
| 154 | Ga0207694_10106799 | 3300025924 | Unclassified | 2224 |
| 155 | Ga0207650_10022001 | 3300025925 | Bacteria | 4512 |
| 156 | Ga0207687_10005939 | 3300025927 | Bacteria | 8074 |
| 157 | Ga0207687_10025733 | 3300025927 | Unclassified | 3938 |
| 158 | Ga0207700_10311180 | 3300025928 | Unclassified | 1362 |
| 159 | Ga0207644_10004083 | 3300025931 | Bacteria | 9469 |
| 160 | Ga0207644_10186212 | 3300025931 | Bacteria | 1630 |
| 161 | Ga0207686_10013004 | 3300025934 | Unclassified | 4594 |
| 162 | Ga0207686_10051581 | 3300025934 | Bacteria | 2563 |
| 163 | Ga0207704_10114825 | 3300025938 | Unclassified | 1829 |
| 164 | Ga0207691_10052773 | 3300025940 | Bacteria | 3713 |
| 165 | Ga0207711_10015045 | 3300025941 | Bacteria | 6425 |
| 166 | Ga0207711_10023422 | 3300025941 | Bacteria | 5169 |
| 167 | Ga0207689_10030239 | 3300025942 | Bacteria | 4513 |
| 168 | Ga0207661_10017927 | 3300025944 | Bacteria | 5251 |
| 169 | Ga0207661_10023366 | 3300025944 | Bacteria | 4670 |
| 170 | Ga0207661_10076149 | 3300025944 | Bacteria | 2755 |
| 171 | Ga0207679_10009347 | 3300025945 | Bacteria | 6279 |
| 172 | Ga0207667_10002346 | 3300025949 | Bacteria | 23722 |
| 173 | Ga0207667_10014488 | 3300025949 | Bacteria | 8987 |
| 174 | Ga0207667_10031914 | 3300025949 | Bacteria | 5681 |
| 175 | Ga0207651_10075212 | 3300025960 | Unclassified | 2409 |
| 176 | Ga0207640_10146853 | 3300025981 | Bacteria | 1727 |
| 177 | Ga0207677_10005368 | 3300026023 | Bacteria | 6952 |
| 178 | Ga0207677_10018090 | 3300026023 | Unclassified | 4223 |
| 179 | Ga0207677_10027135 | 3300026023 | Bacteria | 3602 |
| 180 | Ga0207677_10069487 | 3300026023 | Bacteria | 2477 |
| 181 | Ga0207703_10067778 | 3300026035 | Unclassified | 2938 |
| 182 | Ga0207703_10084729 | 3300026035 | Bacteria | 2651 |
| 183 | Ga0207639_10036627 | 3300026041 | Bacteria | 3637 |
| 184 | Ga0207702_10001121 | 3300026078 | Bacteria | 27356 |
| 185 | Ga0207702_10001291 | 3300026078 | Bacteria | 25054 |
| 186 | Ga0207702_10159922 | 3300026078 | Bacteria | 2056 |
| 187 | Ga0207641_10003848 | 3300026088 | Bacteria | 13142 |
| 188 | Ga0207641_10211272 | 3300026088 | Bacteria | 1795 |
| 189 | Ga0207648_10042766 | 3300026089 | Unclassified | 3978 |
| 190 | Ga0207648_10118625 | 3300026089 | Bacteria | 2325 |
| 191 | Ga0207676_10046932 | 3300026095 | Bacteria | 3345 |
| 192 | Ga0207676_10263071 | 3300026095 | Bacteria | 1558 |
| 193 | Ga0207674_10006472 | 3300026116 | Bacteria | 13769 |
| 194 | Ga0207674_10031848 | 3300026116 | Bacteria | 5535 |
| 195 | Ga0207674_10033425 | 3300026116 | Bacteria | 5385 |
| 196 | Ga0207675_100052692 | 3300026118 | Bacteria | 3797 |
| 197 | Ga0268264_10113546 | 3300028381 | Bacteria | 2377 |
| 198 | Ga0265339_10020961 | 3300031249 | Unclassified | 3812 |
| 199 | Ga0265316_10025618 | 3300031344 | Unclassified | 4919 |
| 200 | Ga0307408_100016850 | 3300031548 | Bacteria | 4884 |
| 201 | Ga0265314_10002485 | 3300031711 | Bacteria | 18841 |
| 202 | Ga0265314_10073247 | 3300031711 | Unclassified | 2284 |
| 203 | Ga0265314_10086717 | 3300031711 | Unclassified | 2048 |
| 204 | Ga0316576_10043593 | 3300031727 | Bacteria | 3237 |
| 205 | Ga0316576_10207320 | 3300031727 | Bacteria | 1476 |
| 206 | Ga0307405_10001139 | 3300031731 | Bacteria | 10911 |
| 207 | Ga0307413_10081317 | 3300031824 | Bacteria | 2077 |
| 208 | Ga0307413_10111195 | 3300031824 | Bacteria | 1834 |
| 209 | Ga0307410_10000633 | 3300031852 | Bacteria | 14512 |
| 210 | Ga0307410_10126825 | 3300031852 | Bacteria | 1869 |
| 211 | Ga0307406_10012851 | 3300031901 | Bacteria | 4782 |
| 212 | Ga0307407_10001813 | 3300031903 | Bacteria | 8008 |
| 213 | Ga0307407_10035274 | 3300031903 | Bacteria | 2747 |
| 214 | Ga0307407_10044425 | 3300031903 | Bacteria | 2504 |
| 215 | Ga0307412_10012646 | 3300031911 | Bacteria | 4926 |
| 216 | Ga0307409_100000059 | 3300031995 | Bacteria | 39752 |
| 217 | Ga0307409_100095491 | 3300031995 | Bacteria | 2450 |
| 218 | Ga0307409_100167648 | 3300031995 | Bacteria | 1929 |
| 219 | Ga0307416_100016335 | 3300032002 | Bacteria | 5155 |
| 220 | Ga0307416_100096461 | 3300032002 | Bacteria | 2557 |
| 221 | Ga0307414_10230778 | 3300032004 | Bacteria | 1526 |
| 222 | Ga0307411_10000079 | 3300032005 | Bacteria | 30144 |
| 223 | Ga0307415_100000396 | 3300032126 | Bacteria | 18556 |
| 224 | Ga0373931_0020640 | 3300035691 | Unclassified | 3298 |
| 225 | Ga0451577_0011067 | 3300042876 | Bacteria | 8568 |
| 226 | Ga0451577_0035870 | 3300042876 | Bacteria | 4466 |
| 227 | Ga0451577_0290132 | 3300042876 | Bacteria | 1482 |
| 228 | Ga0453684_0001810 | 3300044712 | Bacteria | 56611 |
| 229 | Ga0453684_0034318 | 3300044712 | Bacteria | 7044 |
| 230 | Ga0453684_0084408 | 3300044712 | Bacteria | 3949 |
| 231 | Ga0495628_0046144 | 3300046516 | Bacteria | 3462 |
| 232 | Ga0495586_0035516 | 3300046535 | Bacteria | 2678 |
| 233 | Ga0495581_0205753 | 3300047315 | Bacteria | 1151 |
| 234 | Ga0495674_0012367 | 3300047319 | Bacteria | 8039 |
| 235 | Ga0495684_0030184 | 3300047471 | Bacteria | 4162 |
| 236 | Ga0495602_0242710 | 3300048088 | Bacteria | 1347 |
| 237 | Ga0496112_0009753 | 3300048915 | Bacteria | 8669 |
| 238 | Ga0501037_0108623 | 3300049573 | Bacteria | 1999 |
| 239 | nmdc:mga06r32_123207_c1 | 3300050510 | Bacteria | 2558 |
| 240 | nmdc:mga06r32_298618_c1 | 3300050510 | Bacteria | 1597 |
| 241 | nmdc:mga0n895_41556_c1 | 3300050512 | Bacteria | 4471 |
| 242 | nmdc:mga08x19_14997_c1 | 3300050514 | Bacteria | 4706 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047315 | Ga0495581_0205753 | Ga0495581_0205753_15_1052 | 309 |
| 2 | 3300031344 | Ga0265316_10025618 | Ga0265316_100256182 | 347 |
| 3 | 3300005546 | Ga0070696_100003363 | Ga0070696_1000033639 | 348 |
| 4 | iso_pu_bacteria | 2913036834 | 2913040317 | 348 |
| 5 | 3300031903 | Ga0307407_10035274 | Ga0307407_100352741 | 351 |
| 6 | 3300042876 | Ga0451577_0290132 | Ga0451577_0290132_304_1374 | 352 |
| 7 | 3300044712 | Ga0453684_0034318 | Ga0453684_0034318_3743_4813 | 352 |
| 8 | 3300005985 | Ga0081539_10048191 | Ga0081539_100481912 | 353 |
| 9 | 3300005985 | Ga0081539_10000104 | Ga0081539_1000010483 | 356 |
| 10 | 3300031727 | Ga0316576_10043593 | Ga0316576_100435932 | 358 |
| 11 | 3300042876 | Ga0451577_0011067 | Ga0451577_0011067_6254_7366 | 359 |
| 12 | 3300044712 | Ga0453684_0001810 | Ga0453684_0001810_8176_9288 | 359 |
| 13 | iso_pu_bacteria | 2775506925 | 2776371711 | 359 |
| 14 | iso_pu_bacteria | 2863067949 | 2863072806 | 359 |
| 15 | 3300005329 | Ga0070683_100308349 | Ga0070683_1003083492 | 360 |
| 16 | 3300046516 | Ga0495628_0046144 | Ga0495628_0046144_1209_2414 | 360 |
| 17 | 3300047319 | Ga0495674_0012367 | Ga0495674_0012367_5178_6383 | 360 |
| 18 | 3300047471 | Ga0495684_0030184 | Ga0495684_0030184_2281_3486 | 360 |
| 19 | 3300048088 | Ga0495602_0242710 | Ga0495602_0242710_122_1327 | 360 |
| 20 | 3300005355 | Ga0070671_100009821 | Ga0070671_1000098215 | 361 |
| 21 | 3300005364 | Ga0070673_100159144 | Ga0070673_1001591442 | 361 |
| 22 | 3300005842 | Ga0068858_100032776 | Ga0068858_1000327763 | 361 |
| 23 | 3300006237 | Ga0097621_100003352 | Ga0097621_1000033523 | 361 |
| 24 | 3300006358 | Ga0068871_100033381 | Ga0068871_1000333812 | 361 |
| 25 | 3300025927 | Ga0207687_10025733 | Ga0207687_100257333 | 361 |
| 26 | 3300025931 | Ga0207644_10004083 | Ga0207644_100040835 | 361 |
| 27 | 3300026035 | Ga0207703_10067778 | Ga0207703_100677783 | 361 |
| 28 | 3300005335 | Ga0070666_10008882 | Ga0070666_100088823 | 362 |
| 29 | 3300005458 | Ga0070681_10013374 | Ga0070681_100133745 | 362 |
| 30 | 3300005530 | Ga0070679_100142374 | Ga0070679_1001423742 | 362 |
| 31 | 3300005546 | Ga0070696_100000297 | Ga0070696_1000002978 | 362 |
| 32 | 3300005577 | Ga0068857_100007994 | Ga0068857_1000079945 | 362 |
| 33 | 3300005577 | Ga0068857_100039937 | Ga0068857_1000399372 | 362 |
| 34 | 3300005843 | Ga0068860_100030892 | Ga0068860_1000308924 | 362 |
| 35 | 3300006237 | Ga0097621_100002831 | Ga0097621_10000283111 | 362 |
| 36 | 3300006237 | Ga0097621_100040582 | Ga0097621_1000405823 | 362 |
| 37 | 3300009093 | Ga0105240_10428544 | Ga0105240_104285441 | 362 |
| 38 | 3300009098 | Ga0105245_10004649 | Ga0105245_100046496 | 362 |
| 39 | 3300009176 | Ga0105242_10070578 | Ga0105242_100705782 | 362 |
| 40 | 3300009545 | Ga0105237_10094053 | Ga0105237_100940532 | 362 |
| 41 | 3300011119 | Ga0105246_10079091 | Ga0105246_100790912 | 362 |
| 42 | 3300013296 | Ga0157374_10131350 | Ga0157374_101313502 | 362 |
| 43 | 3300013306 | Ga0163162_10005937 | Ga0163162_100059377 | 362 |
| 44 | 3300014325 | Ga0163163_10042250 | Ga0163163_100422502 | 362 |
| 45 | 3300014325 | Ga0163163_10188464 | Ga0163163_101884642 | 362 |
| 46 | 3300014968 | Ga0157379_10095588 | Ga0157379_100955881 | 362 |
| 47 | 3300014969 | Ga0157376_10128884 | Ga0157376_101288842 | 362 |
| 48 | 3300025903 | Ga0207680_10048932 | Ga0207680_100489322 | 362 |
| 49 | 3300025917 | Ga0207660_10288019 | Ga0207660_102880191 | 362 |
| 50 | 3300025921 | Ga0207652_10108116 | Ga0207652_101081162 | 362 |
| 51 | 3300025927 | Ga0207687_10005939 | Ga0207687_100059392 | 362 |
| 52 | 3300025934 | Ga0207686_10013004 | Ga0207686_100130044 | 362 |
| 53 | 3300025941 | Ga0207711_10023422 | Ga0207711_100234223 | 362 |
| 54 | 3300026023 | Ga0207677_10027135 | Ga0207677_100271352 | 362 |
| 55 | 3300026035 | Ga0207703_10084729 | Ga0207703_100847293 | 362 |
| 56 | 3300026116 | Ga0207674_10006472 | Ga0207674_100064727 | 362 |
| 57 | 3300028381 | Ga0268264_10113546 | Ga0268264_101135462 | 362 |
| 58 | 3300005468 | Ga0070707_100058015 | Ga0070707_1000580152 | 363 |
| 59 | 3300005535 | Ga0070684_100175963 | Ga0070684_1001759632 | 364 |
| 60 | 3300009176 | Ga0105242_10229252 | Ga0105242_102292522 | 364 |
| 61 | 3300013307 | Ga0157372_10264155 | Ga0157372_102641552 | 364 |
| 62 | 3300031711 | Ga0265314_10002485 | Ga0265314_100024852 | 364 |
| 63 | 3300005329 | Ga0070683_100119417 | Ga0070683_1001194172 | 365 |
| 64 | 3300005329 | Ga0070683_100217657 | Ga0070683_1002176571 | 365 |
| 65 | 3300005331 | Ga0070670_100021827 | Ga0070670_1000218272 | 365 |
| 66 | 3300005334 | Ga0068869_100004345 | Ga0068869_1000043454 | 365 |
| 67 | 3300005335 | Ga0070666_10034334 | Ga0070666_100343343 | 365 |
| 68 | 3300005336 | Ga0070680_100096521 | Ga0070680_1000965212 | 365 |
| 69 | 3300005338 | Ga0068868_100005747 | Ga0068868_1000057475 | 365 |
| 70 | 3300005338 | Ga0068868_100010746 | Ga0068868_1000107464 | 365 |
| 71 | 3300005338 | Ga0068868_100027920 | Ga0068868_1000279203 | 365 |
| 72 | 3300005458 | Ga0070681_10000293 | Ga0070681_100002935 | 365 |
| 73 | 3300005458 | Ga0070681_10031897 | Ga0070681_100318974 | 365 |
| 74 | 3300005459 | Ga0068867_100029593 | Ga0068867_1000295932 | 365 |
| 75 | 3300005459 | Ga0068867_100102944 | Ga0068867_1001029442 | 365 |
| 76 | 3300005530 | Ga0070679_100012622 | Ga0070679_1000126222 | 365 |
| 77 | 3300005535 | Ga0070684_100030225 | Ga0070684_1000302252 | 365 |
| 78 | 3300005547 | Ga0070693_100057451 | Ga0070693_1000574513 | 365 |
| 79 | 3300005563 | Ga0068855_100000500 | Ga0068855_10000050017 | 365 |
| 80 | 3300005563 | Ga0068855_100005759 | Ga0068855_1000057591 | 365 |
| 81 | 3300005563 | Ga0068855_100007031 | Ga0068855_1000070311 | 365 |
| 82 | 3300005563 | Ga0068855_100047244 | Ga0068855_1000472442 | 365 |
| 83 | 3300005577 | Ga0068857_100006186 | Ga0068857_1000061861 | 365 |
| 84 | 3300005578 | Ga0068854_100018021 | Ga0068854_1000180212 | 365 |
| 85 | 3300005614 | Ga0068856_100001116 | Ga0068856_1000011162 | 365 |
| 86 | 3300005614 | Ga0068856_100003796 | Ga0068856_1000037968 | 365 |
| 87 | 3300005614 | Ga0068856_100005044 | Ga0068856_1000050446 | 365 |
| 88 | 3300005614 | Ga0068856_100080676 | Ga0068856_1000806762 | 365 |
| 89 | 3300005614 | Ga0068856_100204842 | Ga0068856_1002048422 | 365 |
| 90 | 3300005617 | Ga0068859_100045324 | Ga0068859_1000453244 | 365 |
| 91 | 3300005618 | Ga0068864_100005947 | Ga0068864_1000059474 | 365 |
| 92 | 3300005841 | Ga0068863_100007622 | Ga0068863_1000076222 | 365 |
| 93 | 3300005842 | Ga0068858_100012496 | Ga0068858_1000124965 | 365 |
| 94 | 3300005843 | Ga0068860_100071497 | Ga0068860_1000714971 | 365 |
| 95 | 3300006237 | Ga0097621_100000217 | Ga0097621_10000021718 | 365 |
| 96 | 3300006237 | Ga0097621_100001907 | Ga0097621_1000019078 | 365 |
| 97 | 3300006358 | Ga0068871_100000637 | Ga0068871_1000006377 | 365 |
| 98 | 3300006358 | Ga0068871_100001524 | Ga0068871_1000015245 | 365 |
| 99 | 3300006881 | Ga0068865_100023260 | Ga0068865_1000232602 | 365 |
| 100 | 3300006931 | Ga0097620_100045323 | Ga0097620_1000453234 | 365 |
| 101 | 3300009093 | Ga0105240_10031410 | Ga0105240_100314103 | 365 |
| 102 | 3300009098 | Ga0105245_10007504 | Ga0105245_100075044 | 365 |
| 103 | 3300009176 | Ga0105242_10032260 | Ga0105242_100322603 | 365 |
| 104 | 3300009177 | Ga0105248_10009716 | Ga0105248_100097165 | 365 |
| 105 | 3300009177 | Ga0105248_10160802 | Ga0105248_101608022 | 365 |
| 106 | 3300009551 | Ga0105238_10000198 | Ga0105238_1000019814 | 365 |
| 107 | 3300010375 | Ga0105239_10068208 | Ga0105239_100682082 | 365 |
| 108 | 3300010375 | Ga0105239_10220255 | Ga0105239_102202552 | 365 |
| 109 | 3300011119 | Ga0105246_10116272 | Ga0105246_101162722 | 365 |
| 110 | 3300013100 | Ga0157373_10107697 | Ga0157373_101076971 | 365 |
| 111 | 3300013102 | Ga0157371_10081895 | Ga0157371_100818952 | 365 |
| 112 | 3300013104 | Ga0157370_10087975 | Ga0157370_100879752 | 365 |
| 113 | 3300013105 | Ga0157369_10001064 | Ga0157369_1000106425 | 365 |
| 114 | 3300013105 | Ga0157369_10024173 | Ga0157369_100241737 | 365 |
| 115 | 3300013105 | Ga0157369_10255058 | Ga0157369_102550582 | 365 |
| 116 | 3300013296 | Ga0157374_10001451 | Ga0157374_1000145110 | 365 |
| 117 | 3300013296 | Ga0157374_10001766 | Ga0157374_100017664 | 365 |
| 118 | 3300013296 | Ga0157374_10012849 | Ga0157374_100128495 | 365 |
| 119 | 3300013297 | Ga0157378_10000279 | Ga0157378_1000027913 | 365 |
| 120 | 3300013297 | Ga0157378_10000549 | Ga0157378_100005493 | 365 |
| 121 | 3300013297 | Ga0157378_10006140 | Ga0157378_100061407 | 365 |
| 122 | 3300013297 | Ga0157378_10033197 | Ga0157378_100331972 | 365 |
| 123 | 3300013307 | Ga0157372_10002495 | Ga0157372_100024958 | 365 |
| 124 | 3300013307 | Ga0157372_10006511 | Ga0157372_100065115 | 365 |
| 125 | 3300013307 | Ga0157372_10009691 | Ga0157372_100096912 | 365 |
| 126 | 3300013308 | Ga0157375_10297728 | Ga0157375_102977282 | 365 |
| 127 | 3300014969 | Ga0157376_10027596 | Ga0157376_100275963 | 365 |
| 128 | 3300024227 | Ga0228598_1002517 | Ga0228598_10025173 | 365 |
| 129 | 3300025912 | Ga0207707_10005183 | Ga0207707_100051834 | 365 |
| 130 | 3300025912 | Ga0207707_10040274 | Ga0207707_100402742 | 365 |
| 131 | 3300025921 | Ga0207652_10076193 | Ga0207652_100761933 | 365 |
| 132 | 3300025921 | Ga0207652_10083465 | Ga0207652_100834652 | 365 |
| 133 | 3300025924 | Ga0207694_10003795 | Ga0207694_100037954 | 365 |
| 134 | 3300025924 | Ga0207694_10106799 | Ga0207694_101067992 | 365 |
| 135 | 3300025925 | Ga0207650_10022001 | Ga0207650_100220012 | 365 |
| 136 | 3300025928 | Ga0207700_10311180 | Ga0207700_103111801 | 365 |
| 137 | 3300025938 | Ga0207704_10114825 | Ga0207704_101148251 | 365 |
| 138 | 3300025941 | Ga0207711_10015045 | Ga0207711_100150455 | 365 |
| 139 | 3300025942 | Ga0207689_10030239 | Ga0207689_100302394 | 365 |
| 140 | 3300025944 | Ga0207661_10017927 | Ga0207661_100179272 | 365 |
| 141 | 3300025944 | Ga0207661_10076149 | Ga0207661_100761492 | 365 |
| 142 | 3300025949 | Ga0207667_10002346 | Ga0207667_100023465 | 365 |
| 143 | 3300025949 | Ga0207667_10014488 | Ga0207667_100144882 | 365 |
| 144 | 3300025949 | Ga0207667_10031914 | Ga0207667_100319143 | 365 |
| 145 | 3300025960 | Ga0207651_10075212 | Ga0207651_100752121 | 365 |
| 146 | 3300026023 | Ga0207677_10005368 | Ga0207677_100053685 | 365 |
| 147 | 3300026023 | Ga0207677_10018090 | Ga0207677_100180903 | 365 |
| 148 | 3300026078 | Ga0207702_10001121 | Ga0207702_100011216 | 365 |
| 149 | 3300026078 | Ga0207702_10001291 | Ga0207702_100012913 | 365 |
| 150 | 3300026088 | Ga0207641_10003848 | Ga0207641_100038485 | 365 |
| 151 | 3300026088 | Ga0207641_10211272 | Ga0207641_102112722 | 365 |
| 152 | 3300026089 | Ga0207648_10042766 | Ga0207648_100427662 | 365 |
| 153 | 3300026089 | Ga0207648_10118625 | Ga0207648_101186253 | 365 |
| 154 | 3300026095 | Ga0207676_10046932 | Ga0207676_100469322 | 365 |
| 155 | 3300026095 | Ga0207676_10263071 | Ga0207676_102630712 | 365 |
| 156 | 3300026116 | Ga0207674_10033425 | Ga0207674_100334253 | 365 |
| 157 | 3300031249 | Ga0265339_10020961 | Ga0265339_100209612 | 365 |
| 158 | 3300031711 | Ga0265314_10073247 | Ga0265314_100732472 | 365 |
| 159 | 3300031711 | Ga0265314_10086717 | Ga0265314_100867172 | 365 |
| 160 | 3300031824 | Ga0307413_10081317 | Ga0307413_100813172 | 365 |
| 161 | 3300035691 | Ga0373931_0020640 | Ga0373931_0020640_580_1749 | 365 |
| 162 | 3300048915 | Ga0496112_0009753 | Ga0496112_0009753_2493_3662 | 365 |
| 163 | 3300009093 | Ga0105240_10032464 | Ga0105240_100324642 | 366 |
| 164 | 3300009093 | Ga0105240_10168549 | Ga0105240_101685492 | 366 |
| 165 | 3300013104 | Ga0157370_10041000 | Ga0157370_100410002 | 366 |
| 166 | 3300031727 | Ga0316576_10207320 | Ga0316576_102073201 | 366 |
| 167 | 3300050514 | nmdc:mga08x19_14997_c1 | nmdc:mga08x19_14997_c1_421_1521 | 366 |
| 168 | 3300026118 | Ga0207675_100052692 | Ga0207675_1000526923 | 367 |
| 169 | 3300031852 | Ga0307410_10126825 | Ga0307410_101268252 | 369 |
| 170 | 3300031903 | Ga0307407_10044425 | Ga0307407_100444252 | 369 |
| 171 | 3300031995 | Ga0307409_100095491 | Ga0307409_1000954912 | 369 |
| 172 | 3300031995 | Ga0307409_100167648 | Ga0307409_1001676482 | 369 |
| 173 | 3300032002 | Ga0307416_100096461 | Ga0307416_1000964612 | 369 |
| 174 | 3300004803 | Ga0058862_11807904 | Ga0058862_118079041 | 370 |
| 175 | 3300005327 | Ga0070658_10006394 | Ga0070658_100063946 | 370 |
| 176 | 3300005329 | Ga0070683_100002790 | Ga0070683_10000279014 | 370 |
| 177 | 3300005329 | Ga0070683_100030282 | Ga0070683_1000302822 | 370 |
| 178 | 3300005329 | Ga0070683_100066714 | Ga0070683_1000667143 | 370 |
| 179 | 3300005330 | Ga0070690_100010141 | Ga0070690_1000101415 | 370 |
| 180 | 3300005335 | Ga0070666_10179262 | Ga0070666_101792622 | 370 |
| 181 | 3300005338 | Ga0068868_100249960 | Ga0068868_1002499602 | 370 |
| 182 | 3300005341 | Ga0070691_10032960 | Ga0070691_100329602 | 370 |
| 183 | 3300005347 | Ga0070668_100053992 | Ga0070668_1000539923 | 370 |
| 184 | 3300005353 | Ga0070669_100156019 | Ga0070669_1001560192 | 370 |
| 185 | 3300005355 | Ga0070671_100028715 | Ga0070671_1000287153 | 370 |
| 186 | 3300005439 | Ga0070711_100079675 | Ga0070711_1000796752 | 370 |
| 187 | 3300005458 | Ga0070681_10001656 | Ga0070681_100016562 | 370 |
| 188 | 3300005535 | Ga0070684_100193697 | Ga0070684_1001936972 | 370 |
| 189 | 3300005564 | Ga0070664_100116184 | Ga0070664_1001161842 | 370 |
| 190 | 3300005564 | Ga0070664_100277561 | Ga0070664_1002775611 | 370 |
| 191 | 3300005577 | Ga0068857_100019991 | Ga0068857_1000199915 | 370 |
| 192 | 3300005617 | Ga0068859_100206268 | Ga0068859_1002062682 | 370 |
| 193 | 3300006846 | Ga0075430_100026226 | Ga0075430_1000262265 | 370 |
| 194 | 3300006871 | Ga0075434_100102765 | Ga0075434_1001027652 | 370 |
| 195 | 3300006914 | Ga0075436_100007193 | Ga0075436_1000071932 | 370 |
| 196 | 3300006931 | Ga0097620_100206274 | Ga0097620_1002062741 | 370 |
| 197 | 3300009093 | Ga0105240_10037778 | Ga0105240_100377784 | 370 |
| 198 | 3300009098 | Ga0105245_10100607 | Ga0105245_101006072 | 370 |
| 199 | 3300009147 | Ga0114129_10051318 | Ga0114129_100513184 | 370 |
| 200 | 3300009177 | Ga0105248_10395733 | Ga0105248_103957331 | 370 |
| 201 | 3300013100 | Ga0157373_10093157 | Ga0157373_100931572 | 370 |
| 202 | 3300013104 | Ga0157370_10011442 | Ga0157370_100114425 | 370 |
| 203 | 3300013105 | Ga0157369_10006874 | Ga0157369_100068742 | 370 |
| 204 | 3300013296 | Ga0157374_10363845 | Ga0157374_103638452 | 370 |
| 205 | 3300013297 | Ga0157378_10297504 | Ga0157378_102975042 | 370 |
| 206 | 3300013307 | Ga0157372_10040273 | Ga0157372_100402733 | 370 |
| 207 | 3300013308 | Ga0157375_10120279 | Ga0157375_101202792 | 370 |
| 208 | 3300014969 | Ga0157376_10060468 | Ga0157376_100604683 | 370 |
| 209 | 3300020082 | Ga0206353_11856375 | Ga0206353_118563752 | 370 |
| 210 | 3300025907 | Ga0207645_10141834 | Ga0207645_101418342 | 370 |
| 211 | 3300025910 | Ga0207684_10011828 | Ga0207684_100118282 | 370 |
| 212 | 3300025912 | Ga0207707_10008080 | Ga0207707_100080802 | 370 |
| 213 | 3300025913 | Ga0207695_10001042 | Ga0207695_100010423 | 370 |
| 214 | 3300025913 | Ga0207695_10212418 | Ga0207695_102124182 | 370 |
| 215 | 3300025920 | Ga0207649_10021811 | Ga0207649_100218112 | 370 |
| 216 | 3300025921 | Ga0207652_10224264 | Ga0207652_102242642 | 370 |
| 217 | 3300025931 | Ga0207644_10186212 | Ga0207644_101862122 | 370 |
| 218 | 3300025934 | Ga0207686_10051581 | Ga0207686_100515812 | 370 |
| 219 | 3300025940 | Ga0207691_10052773 | Ga0207691_100527732 | 370 |
| 220 | 3300025944 | Ga0207661_10023366 | Ga0207661_100233664 | 370 |
| 221 | 3300025945 | Ga0207679_10009347 | Ga0207679_100093476 | 370 |
| 222 | 3300025981 | Ga0207640_10146853 | Ga0207640_101468531 | 370 |
| 223 | 3300026023 | Ga0207677_10069487 | Ga0207677_100694872 | 370 |
| 224 | 3300026041 | Ga0207639_10036627 | Ga0207639_100366272 | 370 |
| 225 | 3300026078 | Ga0207702_10159922 | Ga0207702_101599222 | 370 |
| 226 | 3300026116 | Ga0207674_10031848 | Ga0207674_100318482 | 370 |
| 227 | 3300031548 | Ga0307408_100016850 | Ga0307408_1000168504 | 370 |
| 228 | 3300031731 | Ga0307405_10001139 | Ga0307405_100011394 | 370 |
| 229 | 3300031824 | Ga0307413_10111195 | Ga0307413_101111952 | 370 |
| 230 | 3300031852 | Ga0307410_10000633 | Ga0307410_1000063311 | 370 |
| 231 | 3300031901 | Ga0307406_10012851 | Ga0307406_100128512 | 370 |
| 232 | 3300031903 | Ga0307407_10001813 | Ga0307407_100018134 | 370 |
| 233 | 3300031911 | Ga0307412_10012646 | Ga0307412_100126462 | 370 |
| 234 | 3300031995 | Ga0307409_100000059 | Ga0307409_1000000594 | 370 |
| 235 | 3300032002 | Ga0307416_100016335 | Ga0307416_1000163352 | 370 |
| 236 | 3300032004 | Ga0307414_10230778 | Ga0307414_102307782 | 370 |
| 237 | 3300032005 | Ga0307411_10000079 | Ga0307411_1000007917 | 370 |
| 238 | 3300032126 | Ga0307415_100000396 | Ga0307415_1000003964 | 370 |
| 239 | 3300042876 | Ga0451577_0035870 | Ga0451577_0035870_1077_2189 | 370 |
| 240 | 3300044712 | Ga0453684_0084408 | Ga0453684_0084408_529_1641 | 370 |
| 241 | 3300046535 | Ga0495586_0035516 | Ga0495586_0035516_1302_2414 | 370 |
| 242 | 3300049573 | Ga0501037_0108623 | Ga0501037_0108623_540_1652 | 370 |
| 243 | 3300050510 | nmdc:mga06r32_123207_c1 | nmdc:mga06r32_123207_c1_69_1217 | 370 |
| 244 | 3300050510 | nmdc:mga06r32_298618_c1 | nmdc:mga06r32_298618_c1_252_1400 | 370 |
| 245 | 3300050512 | nmdc:mga0n895_41556_c1 | nmdc:mga0n895_41556_c1_530_1642 | 370 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3frk-assembly1.cif.gz_B | x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine | 0.9795 | 1 | 366 |
| 3frk-assembly1.cif.gz_B | x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine | 0.9742 | 1 | 366 |
| 2oga-assembly1.cif.gz_A | x-ray crystal structure of s. venezuelae desv in complex with ketimine intermediate | 0.9736 | 2 | 370 |
| 7b0d-assembly1.cif.gz_B | sugar transaminase from archaeoglobus veneficus | 0.9729 | 1 | 368 |
| 3nu7-assembly1.cif.gz_A | wbpe, an aminotransferase from pseudomonas aeruginosa involved in o-antigen assembly in complex with the cofactor pmp | 0.9684 | 3 | 364 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3frkB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9696 | 250 | 366 | 3.90.1150.10 |
| 3uwcA02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9647 | 250 | 368 | 3.90.1150.10 |
| 2ogaB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9643 | 250 | 367 | 3.90.1150.10 |
| af_Q58466_257_386_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9578 | 251 | 366 | 3.90.1150.10 |
| 2ogeD01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9542 | 1 | 247 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M4IN30-F1-model_v4 | DegT/DnrJ/EryC1/StrS family aminotransferase | 0.9972 | 1 | 370 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A847XTC3-F1-model_v4 | Transcriptional regulator | 0.992 | 180 | 368 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A0F4W2L2-F1-model_v4 | deleted | 0.9896 | 244 | 365 |
|
| AF-A0A2M8Q735-F1-model_v4 | Aminotransferase DegT | 0.9895 | 18 | 145 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A7W1L4E0-F1-model_v4 | DegT/DnrJ/EryC1/StrS family aminotransferase | 0.9886 | 190 | 367 |
GO:0000271
GO:0008483 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar