F357173

General Info

Members Datasets Scaffolds Average Seq Length
245 138 245 95

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_101013101|Ga0070699_1010131012
Length 105
Sequence MAHRARIETGMNIELSPAAAQHLQHDLDGRVLRIAFTTGCGGSGYRLSYAPEPVESDEVVAIDGVRVALDSMAASRLDGARIEYDPDEDGYLLDHPDAVSAVWCG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
119 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
120 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 91.02
Stem 0
Stem Tuber 0
Unclassified 7.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10112003 3300005327 Bacteria 2262
2 Ga0070676_11155299 3300005328 Bacteria 587
3 Ga0070683_100000113 3300005329 Bacteria 53083
4 Ga0070683_101905179 3300005329 Unclassified 571
5 Ga0070690_100178634 3300005330 Unclassified 1466
6 Ga0070670_100000041 3300005331 Bacteria 147849
7 Ga0070670_100008464 3300005331 Bacteria 8776
8 Ga0070670_101506976 3300005331 Unclassified 617
9 Ga0070677_10901025 3300005333 Bacteria 511
10 Ga0068869_100001899 3300005334 Bacteria 12569
11 Ga0068869_100097146 3300005334 Bacteria 2224
12 Ga0068869_101497246 3300005334 Unclassified 599
13 Ga0068869_101612269 3300005334 Unclassified 578
14 Ga0070680_100004153 3300005336 Bacteria 10847
15 Ga0070682_100436148 3300005337 Unclassified 1000
16 Ga0070682_100802894 3300005337 Unclassified 765
17 Ga0068868_100002260 3300005338 Bacteria 13319
18 Ga0070689_100390681 3300005340 Unclassified 1174
19 Ga0070689_100496719 3300005340 Unclassified 1045
20 Ga0070689_100534697 3300005340 Bacteria 1008
21 Ga0070687_100000252 3300005343 Bacteria 18252
22 Ga0070687_100336837 3300005343 Bacteria 969
23 Ga0070687_100693048 3300005343 Unclassified 711
24 Ga0070692_11083137 3300005345 Unclassified 565
25 Ga0070675_100000009 3300005354 Bacteria 245759
26 Ga0070671_100137970 3300005355 Bacteria 2057
27 Ga0070671_101288906 3300005355 Unclassified 644
28 Ga0070674_100887124 3300005356 Unclassified 776
29 Ga0070703_10087802 3300005406 Bacteria 1072
30 Ga0070709_10489021 3300005434 Bacteria 933
31 Ga0070713_100573912 3300005436 Bacteria 1070
32 Ga0070713_101049323 3300005436 Unclassified 787
33 Ga0070701_10024665 3300005438 Bacteria 2911
34 Ga0070700_100000084 3300005441 Bacteria 62644
35 Ga0070708_100067949 3300005445 Bacteria 3202
36 Ga0070708_100797125 3300005445 Bacteria 888
37 Ga0070708_101151005 3300005445 Bacteria 726
38 Ga0068867_100710585 3300005459 Bacteria 888
39 Ga0070685_10025452 3300005466 Bacteria 3259
40 Ga0070706_100002247 3300005467 Bacteria 19604
41 Ga0070706_100046116 3300005467 Bacteria 4023
42 Ga0070706_100140825 3300005467 Unclassified 2252
43 Ga0070707_100079190 3300005468 Bacteria 3171
44 Ga0070707_101326261 3300005468 Unclassified 686
45 Ga0070707_101990237 3300005468 Bacteria 548
46 Ga0070707_102057343 3300005468 Bacteria 538
47 Ga0070698_100103029 3300005471 Bacteria 2824
48 Ga0070698_100217764 3300005471 Bacteria 1843
49 Ga0070698_100233747 3300005471 Bacteria 1771
50 Ga0070698_100505981 3300005471 Unclassified 1146
51 Ga0070699_100019275 3300005518 Bacteria 5871
52 Ga0070699_100020283 3300005518 Bacteria 5731
53 Ga0070699_100285570 3300005518 Bacteria 1478
54 Ga0070699_101013101 3300005518 Bacteria 762
55 Ga0070684_100001793 3300005535 Bacteria 15696
56 Ga0070684_100776726 3300005535 Unclassified 895
57 Ga0070684_101541618 3300005535 Unclassified 626
58 Ga0070684_101993680 3300005535 Bacteria 548
59 Ga0070697_100060031 3300005536 Bacteria 3098
60 Ga0070697_100072876 3300005536 Unclassified 2818
61 Ga0070697_100121862 3300005536 Bacteria 2182
62 Ga0068853_100196868 3300005539 Bacteria 1833
63 Ga0070672_100234560 3300005543 Bacteria 1542
64 Ga0070696_100435394 3300005546 Unclassified 1032
65 Ga0070693_100375156 3300005547 Unclassified 980
66 Ga0070704_101297533 3300005549 Bacteria 666
67 Ga0068857_100025018 3300005577 Bacteria 5259
68 Ga0068854_100019615 3300005578 Bacteria 4559
69 Ga0068854_100036345 3300005578 Bacteria 3453
70 Ga0070702_100098061 3300005615 Bacteria 1792
71 Ga0070702_100206695 3300005615 Bacteria 1304
72 Ga0070702_100772565 3300005615 Unclassified 740
73 Ga0068852_101577132 3300005616 Bacteria 679
74 Ga0068866_11358045 3300005718 Bacteria 518
75 Ga0068861_100179105 3300005719 Bacteria 1763
76 Ga0068851_10147140 3300005834 Bacteria 1285
77 Ga0068870_10084259 3300005840 Unclassified 1764
78 Ga0070717_10000073 3300006028 Bacteria 84057
79 Ga0070717_11342392 3300006028 Unclassified 650
80 Ga0070716_100115959 3300006173 Bacteria 1668
81 Ga0070716_100634340 3300006173 Unclassified 808
82 Ga0075431_100022923 3300006847 Bacteria 6382
83 Ga0075431_100934577 3300006847 Unclassified 836
84 Ga0075433_10771209 3300006852 Bacteria 841
85 Ga0075434_100597205 3300006871 Bacteria 1123
86 Ga0075434_100825583 3300006871 Bacteria 943
87 Ga0075434_101032224 3300006871 Bacteria 836
88 Ga0075434_101113428 3300006871 Bacteria 803
89 Ga0075429_100704961 3300006880 Unclassified 884
90 Ga0075429_100977745 3300006880 Unclassified 740
91 Ga0075436_100017349 3300006914 Bacteria 4928
92 Ga0075436_100675955 3300006914 Bacteria 764
93 Ga0075435_100000060 3300007076 Bacteria 55995
94 Ga0075435_100007875 3300007076 Bacteria 7624
95 Ga0075435_100022079 3300007076 Bacteria 4907
96 Ga0075435_100163179 3300007076 Bacteria 1878
97 Ga0105244_10068316 3300009036 Bacteria 1776
98 Ga0105240_10103556 3300009093 Bacteria 3458
99 Ga0111539_10000054 3300009094 Bacteria 115242
100 Ga0105245_10000066 3300009098 Bacteria 109321
101 Ga0105245_10000927 3300009098 Bacteria 26636
102 Ga0105245_10325386 3300009098 Unclassified 1516
103 Ga0105245_10547048 3300009098 Bacteria 1179
104 Ga0105245_11011912 3300009098 Bacteria 876
105 Ga0114129_10057312 3300009147 Bacteria 5453
106 Ga0114129_13333272 3300009147 Bacteria 518
107 Ga0105243_13093161 3300009148 Bacteria 504
108 Ga0105242_10812501 3300009176 Unclassified 927
109 Ga0105248_12782326 3300009177 Unclassified 558
110 Ga0105238_10000001 3300009551 Bacteria 2036163
111 Ga0105239_10091582 3300010375 Bacteria 3355
112 Ga0105246_11493983 3300011119 Unclassified 634
113 Ga0157369_10002844 3300013105 Bacteria 20665
114 Ga0157369_10717035 3300013105 Unclassified 1030
115 Ga0157374_10000021 3300013296 Bacteria 272840
116 Ga0157378_10000572 3300013297 Bacteria 34793
117 Ga0157378_10002268 3300013297 Bacteria 17079
118 Ga0157378_10097853 3300013297 Bacteria 2675
119 Ga0157378_11351852 3300013297 Bacteria 754
120 Ga0163162_10011697 3300013306 Bacteria 8557
121 Ga0163162_10317132 3300013306 Bacteria 1691
122 Ga0157375_10000004 3300013308 Bacteria 474935
123 Ga0157375_10001181 3300013308 Bacteria 22565
124 Ga0157377_10000009 3300014745 Bacteria 385287
125 Ga0157377_10000227 3300014745 Bacteria 29511
126 Ga0157376_10000020 3300014969 Bacteria 246318
127 Ga0157376_11886349 3300014969 Unclassified 634
128 Ga0213873_10000002 3300021358 Bacteria 1164195
129 Ga0213873_10010945 3300021358 Bacteria 1927
130 Ga0213874_10129073 3300021377 Bacteria 866
131 Ga0213876_10000010 3300021384 Bacteria 492549
132 Ga0213876_10000012 3300021384 Bacteria 396530
133 Ga0213876_10011520 3300021384 Bacteria 4719
134 Ga0213876_10014326 3300021384 Bacteria 4203
135 Ga0213876_10021085 3300021384 Bacteria 3445
136 Ga0207656_10134488 3300025321 Bacteria 1161
137 Ga0207655_1121379 3300025728 Unclassified 865
138 Ga0207699_10064150 3300025906 Bacteria 2222
139 Ga0207645_10095234 3300025907 Unclassified 1917
140 Ga0207643_10020905 3300025908 Bacteria 3592
141 Ga0207705_10075892 3300025909 Bacteria 2442
142 Ga0207684_10042915 3300025910 Bacteria 3834
143 Ga0207684_10154391 3300025910 Bacteria 1975
144 Ga0207684_10318112 3300025910 Bacteria 1341
145 Ga0207660_10066627 3300025917 Bacteria 2606
146 Ga0207662_10001051 3300025918 Bacteria 12945
147 Ga0207646_10065175 3300025922 Bacteria 3252
148 Ga0207646_10078318 3300025922 Bacteria 2955
149 Ga0207646_11160760 3300025922 Unclassified 678
150 Ga0207646_11637010 3300025922 Bacteria 554
151 Ga0207681_10864028 3300025923 Bacteria 757
152 Ga0207694_10000001 3300025924 Bacteria 4078485
153 Ga0207650_10000088 3300025925 Bacteria 123236
154 Ga0207650_11799498 3300025925 Unclassified 518
155 Ga0207659_10000007 3300025926 Bacteria 322984
156 Ga0207687_10000003 3300025927 Bacteria 875159
157 Ga0207687_10000157 3300025927 Bacteria 45617
158 Ga0207687_10134220 3300025927 Bacteria 1870
159 Ga0207700_10668656 3300025928 Bacteria 926
160 Ga0207700_10960483 3300025928 Unclassified 765
161 Ga0207686_10046476 3300025934 Bacteria 2678
162 Ga0207670_10278038 3300025936 Bacteria 1304
163 Ga0207670_10302036 3300025936 Unclassified 1253
164 Ga0207670_10552952 3300025936 Bacteria 941
165 Ga0207669_11041211 3300025937 Unclassified 689
166 Ga0207665_10531966 3300025939 Bacteria 911
167 Ga0207691_11333026 3300025940 Bacteria 592
168 Ga0207689_10003419 3300025942 Bacteria 14492
169 Ga0207689_10450026 3300025942 Bacteria 1076
170 Ga0207689_11074150 3300025942 Unclassified 679
171 Ga0207661_10000001 3300025944 Bacteria 937688
172 Ga0207640_10006779 3300025981 Bacteria 6303
173 Ga0207640_10013881 3300025981 Bacteria 4625
174 Ga0207640_10098382 3300025981 Bacteria 2045
175 Ga0207640_10585221 3300025981 Unclassified 943
176 Ga0207677_10000009 3300026023 Bacteria 252751
177 Ga0207639_10000003 3300026041 Bacteria 806887
178 Ga0207639_10283447 3300026041 Unclassified 1458
179 Ga0207708_10000001 3300026075 Bacteria 467100
180 Ga0207674_10013030 3300026116 Bacteria 9262
181 Ga0207675_100069643 3300026118 Bacteria 3288
182 Ga0207698_11598749 3300026142 Bacteria 667
183 Ga0207428_10000581 3300027907 Bacteria 43128
184 Ga0307511_10008320 3300030521 Bacteria 10384
185 Ga0307408_102435970 3300031548 Unclassified 508
186 Ga0307410_11156690 3300031852 Bacteria 673
187 Ga0307409_102000689 3300031995 Bacteria 609
188 Ga0307409_102242560 3300031995 Unclassified 575
189 Ga0307416_101730079 3300032002 Bacteria 730
190 Ga0307416_102135471 3300032002 Unclassified 662
191 Ga0307416_103818069 3300032002 Bacteria 504
192 Ga0307415_100449124 3300032126 Unclassified 1114
193 Ga0307415_101989288 3300032126 Bacteria 566
194 Ga0373932_0001131 3300035112 Bacteria 7686
195 Ga0373941_0203088 3300035115 Unclassified 754
196 Ga0373941_0238448 3300035115 Bacteria 705
197 Ga0373943_0109216 3300035170 Unclassified 1457
198 Ga0373931_0152827 3300035691 Bacteria 1347
199 Ga0373947_0453494 3300035725 Unclassified 869
200 Ga0373947_0979093 3300035725 Unclassified 577
201 Ga0436365_0080501 3300039437 Bacteria 6381
202 Ga0436365_0120716 3300039437 Bacteria 90169
203 Ga0436365_0362725 3300039437 Bacteria 2840
204 Ga0436365_0404975 3300039437 Bacteria 180420
205 Ga0436365_0716789 3300039437 Unclassified 698
206 Ga0436365_1172437 3300039437 Bacteria 5782
207 Ga0436365_1576280 3300039437 Bacteria 1544
208 Ga0436363_0546122 3300039450 Bacteria 511
209 Ga0436363_0726707 3300039450 Bacteria 878
210 Ga0436363_0772335 3300039450 Bacteria 595
211 Ga0436362_0178131 3300039453 Bacteria 97887
212 Ga0436362_0931096 3300039453 Bacteria 4074
213 Ga0451804_0178835 3300041463 Bacteria 516
214 Ga0451839_0677481 3300041496 Bacteria 4417
215 Ga0451845_0527068 3300041501 Bacteria 502
216 Ga0451577_0080083 3300042876 Bacteria 2912
217 Ga0451577_0349117 3300042876 Bacteria 1342
218 Ga0451577_0429242 3300042876 Bacteria 1200
219 Ga0451577_1350826 3300042876 Bacteria 633
220 Ga0466964_0137965 3300044706 Unclassified 1118
221 Ga0453684_0851777 3300044712 Bacteria 979
222 Ga0451576_0698931 3300045051 Bacteria 1065
223 Ga0466958_0841013 3300045836 Unclassified 599
224 Ga0495620_0002789 3300046515 Bacteria 10055
225 Ga0495621_0262904 3300046539 Bacteria 707
226 Ga0495679_083589 3300047446 Unclassified 903
227 Ga0496101_0600684 3300048904 Bacteria 870
228 Ga0496112_1113206 3300048915 Unclassified 708
229 Ga0501073_0003332 3300049589 Bacteria 12073
230 nmdc:mga09592_1134815_c1 3300050508 Unclassified 648
231 nmdc:mga09592_609164_c1 3300050508 Unclassified 935
232 nmdc:mga06r32_439084_c1 3300050510 Bacteria 1285
233 nmdc:mga06r32_9428_c1 3300050510 Bacteria 8807
234 nmdc:mga08y16_28_c1 3300050511 Bacteria 201429
235 nmdc:mga0n895_133918_c1 3300050512 Bacteria 2504
236 nmdc:mga0n895_239137_c1 3300050512 Bacteria 1842
237 nmdc:mga0n895_769957_c1 3300050512 Bacteria 954
238 nmdc:mga0rr50_125_c1 3300050513 Bacteria 42801
239 nmdc:mga0rr50_153197_c1 3300050513 Bacteria 1865
240 nmdc:mga0rr50_15806_c1 3300050513 Bacteria 4992
241 nmdc:mga0rr50_20352_c1 3300050513 Bacteria 4504
242 nmdc:mga0rr50_751092_c1 3300050513 Bacteria 832
243 nmdc:mga08x19_658600_c1 3300050514 Bacteria 743
244 nmdc:mga08x19_776_c1 3300050514 Bacteria 20338
245 Ga0495655_0000194 3300053083 Bacteria 11396

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100007875 Ga0075435_1000078758 90
2 3300035115 Ga0373941_0238448 Ga0373941_0238448_334_609 90
3 3300050513 nmdc:mga0rr50_15806_c1 nmdc:mga0rr50_15806_c1_683_958 90
4 3300005336 Ga0070680_100004153 Ga0070680_10000415313 91
5 3300005719 Ga0068861_100179105 Ga0068861_1001791053 91
6 3300013306 Ga0163162_10317132 Ga0163162_103171323 91
7 3300025917 Ga0207660_10066627 Ga0207660_100666274 91
8 3300026118 Ga0207675_100069643 Ga0207675_1000696436 91
9 3300044706 Ga0466964_0137965 Ga0466964_0137965_240_515 91
10 3300039437 Ga0436365_0716789 Ga0436365_0716789_329_607 92
11 3300005343 Ga0070687_100336837 Ga0070687_1003368372 94
12 3300005354 Ga0070675_100000009 Ga0070675_100000009160 94
13 3300005434 Ga0070709_10489021 Ga0070709_104890212 94
14 3300005436 Ga0070713_100573912 Ga0070713_1005739122 94
15 3300005471 Ga0070698_100505981 Ga0070698_1005059812 94
16 3300005546 Ga0070696_100435394 Ga0070696_1004353942 94
17 3300005547 Ga0070693_100375156 Ga0070693_1003751562 94
18 3300006028 Ga0070717_10000073 Ga0070717_1000007370 94
19 3300006852 Ga0075433_10771209 Ga0075433_107712091 94
20 3300006871 Ga0075434_100825583 Ga0075434_1008255832 94
21 3300006914 Ga0075436_100017349 Ga0075436_1000173492 94
22 3300007076 Ga0075435_100000060 Ga0075435_10000006024 94
23 3300009036 Ga0105244_10068316 Ga0105244_100683162 94
24 3300009147 Ga0114129_13333272 Ga0114129_133332721 94
25 3300009177 Ga0105248_12782326 Ga0105248_127823262 94
26 3300025728 Ga0207655_1121379 Ga0207655_11213792 94
27 3300025906 Ga0207699_10064150 Ga0207699_100641503 94
28 3300025926 Ga0207659_10000007 Ga0207659_10000007162 94
29 3300025928 Ga0207700_10668656 Ga0207700_106686562 94
30 3300050513 nmdc:mga0rr50_125_c1 nmdc:mga0rr50_125_c1_11939_12223 94
31 3300050514 nmdc:mga08x19_776_c1 nmdc:mga08x19_776_c1_16740_17024 94
32 3300053083 Ga0495655_0000194 Ga0495655_0000194_8348_8632 94
33 3300005327 Ga0070658_10112003 Ga0070658_101120034 95
34 3300005328 Ga0070676_11155299 Ga0070676_111552992 95
35 3300005329 Ga0070683_100000113 Ga0070683_10000011310 95
36 3300005329 Ga0070683_101905179 Ga0070683_1019051792 95
37 3300005330 Ga0070690_100178634 Ga0070690_1001786342 95
38 3300005331 Ga0070670_100000041 Ga0070670_10000004130 95
39 3300005331 Ga0070670_100008464 Ga0070670_10000846410 95
40 3300005331 Ga0070670_101506976 Ga0070670_1015069761 95
41 3300005333 Ga0070677_10901025 Ga0070677_109010252 95
42 3300005334 Ga0068869_100001899 Ga0068869_10000189910 95
43 3300005334 Ga0068869_100097146 Ga0068869_1000971461 95
44 3300005334 Ga0068869_101497246 Ga0068869_1014972461 95
45 3300005334 Ga0068869_101612269 Ga0068869_1016122691 95
46 3300005337 Ga0070682_100436148 Ga0070682_1004361482 95
47 3300005337 Ga0070682_100802894 Ga0070682_1008028942 95
48 3300005338 Ga0068868_100002260 Ga0068868_1000022606 95
49 3300005340 Ga0070689_100390681 Ga0070689_1003906813 95
50 3300005340 Ga0070689_100496719 Ga0070689_1004967192 95
51 3300005340 Ga0070689_100534697 Ga0070689_1005346972 95
52 3300005343 Ga0070687_100000252 Ga0070687_1000002528 95
53 3300005343 Ga0070687_100693048 Ga0070687_1006930481 95
54 3300005345 Ga0070692_11083137 Ga0070692_110831372 95
55 3300005355 Ga0070671_100137970 Ga0070671_1001379703 95
56 3300005355 Ga0070671_101288906 Ga0070671_1012889062 95
57 3300005356 Ga0070674_100887124 Ga0070674_1008871242 95
58 3300005406 Ga0070703_10087802 Ga0070703_100878022 95
59 3300005436 Ga0070713_101049323 Ga0070713_1010493232 95
60 3300005438 Ga0070701_10024665 Ga0070701_100246652 95
61 3300005441 Ga0070700_100000084 Ga0070700_10000008441 95
62 3300005445 Ga0070708_100067949 Ga0070708_1000679492 95
63 3300005445 Ga0070708_100797125 Ga0070708_1007971252 95
64 3300005445 Ga0070708_101151005 Ga0070708_1011510052 95
65 3300005459 Ga0068867_100710585 Ga0068867_1007105852 95
66 3300005466 Ga0070685_10025452 Ga0070685_100254522 95
67 3300005467 Ga0070706_100002247 Ga0070706_1000022476 95
68 3300005467 Ga0070706_100046116 Ga0070706_1000461162 95
69 3300005467 Ga0070706_100140825 Ga0070706_1001408252 95
70 3300005468 Ga0070707_100079190 Ga0070707_1000791905 95
71 3300005468 Ga0070707_101326261 Ga0070707_1013262611 95
72 3300005468 Ga0070707_101990237 Ga0070707_1019902371 95
73 3300005468 Ga0070707_102057343 Ga0070707_1020573431 95
74 3300005471 Ga0070698_100103029 Ga0070698_1001030294 95
75 3300005471 Ga0070698_100217764 Ga0070698_1002177642 95
76 3300005471 Ga0070698_100233747 Ga0070698_1002337472 95
77 3300005518 Ga0070699_100019275 Ga0070699_1000192754 95
78 3300005518 Ga0070699_100020283 Ga0070699_1000202837 95
79 3300005518 Ga0070699_100285570 Ga0070699_1002855704 95
80 3300005518 Ga0070699_101013101 Ga0070699_1010131012 95
81 3300005535 Ga0070684_100001793 Ga0070684_10000179310 95
82 3300005535 Ga0070684_100776726 Ga0070684_1007767262 95
83 3300005535 Ga0070684_101541618 Ga0070684_1015416181 95
84 3300005535 Ga0070684_101993680 Ga0070684_1019936802 95
85 3300005536 Ga0070697_100060031 Ga0070697_1000600312 95
86 3300005536 Ga0070697_100072876 Ga0070697_1000728762 95
87 3300005536 Ga0070697_100121862 Ga0070697_1001218625 95
88 3300005539 Ga0068853_100196868 Ga0068853_1001968681 95
89 3300005543 Ga0070672_100234560 Ga0070672_1002345602 95
90 3300005549 Ga0070704_101297533 Ga0070704_1012975331 95
91 3300005577 Ga0068857_100025018 Ga0068857_1000250184 95
92 3300005578 Ga0068854_100019615 Ga0068854_1000196152 95
93 3300005578 Ga0068854_100036345 Ga0068854_1000363452 95
94 3300005615 Ga0070702_100098061 Ga0070702_1000980613 95
95 3300005615 Ga0070702_100206695 Ga0070702_1002066952 95
96 3300005615 Ga0070702_100772565 Ga0070702_1007725651 95
97 3300005616 Ga0068852_101577132 Ga0068852_1015771322 95
98 3300005718 Ga0068866_11358045 Ga0068866_113580452 95
99 3300005834 Ga0068851_10147140 Ga0068851_101471402 95
100 3300005840 Ga0068870_10084259 Ga0068870_100842594 95
101 3300006028 Ga0070717_11342392 Ga0070717_113423922 95
102 3300006173 Ga0070716_100115959 Ga0070716_1001159594 95
103 3300006173 Ga0070716_100634340 Ga0070716_1006343402 95
104 3300006847 Ga0075431_100022923 Ga0075431_1000229231 95
105 3300006847 Ga0075431_100934577 Ga0075431_1009345772 95
106 3300006871 Ga0075434_100597205 Ga0075434_1005972052 95
107 3300006871 Ga0075434_101032224 Ga0075434_1010322242 95
108 3300006871 Ga0075434_101113428 Ga0075434_1011134282 95
109 3300006880 Ga0075429_100704961 Ga0075429_1007049612 95
110 3300006880 Ga0075429_100977745 Ga0075429_1009777451 95
111 3300006914 Ga0075436_100675955 Ga0075436_1006759551 95
112 3300007076 Ga0075435_100022079 Ga0075435_1000220795 95
113 3300007076 Ga0075435_100163179 Ga0075435_1001631793 95
114 3300009093 Ga0105240_10103556 Ga0105240_101035566 95
115 3300009094 Ga0111539_10000054 Ga0111539_1000005455 95
116 3300009098 Ga0105245_10000066 Ga0105245_1000006621 95
117 3300009098 Ga0105245_10000927 Ga0105245_1000092714 95
118 3300009098 Ga0105245_10325386 Ga0105245_103253862 95
119 3300009098 Ga0105245_10547048 Ga0105245_105470482 95
120 3300009098 Ga0105245_11011912 Ga0105245_110119122 95
121 3300009147 Ga0114129_10057312 Ga0114129_100573126 95
122 3300009148 Ga0105243_13093161 Ga0105243_130931612 95
123 3300009176 Ga0105242_10812501 Ga0105242_108125013 95
124 3300009551 Ga0105238_10000001 Ga0105238_100000011164 95
125 3300010375 Ga0105239_10091582 Ga0105239_100915822 95
126 3300011119 Ga0105246_11493983 Ga0105246_114939832 95
127 3300013105 Ga0157369_10002844 Ga0157369_1000284420 95
128 3300013105 Ga0157369_10717035 Ga0157369_107170352 95
129 3300013296 Ga0157374_10000021 Ga0157374_10000021229 95
130 3300013297 Ga0157378_10000572 Ga0157378_1000057219 95
131 3300013297 Ga0157378_10002268 Ga0157378_1000226810 95
132 3300013297 Ga0157378_10097853 Ga0157378_100978534 95
133 3300013297 Ga0157378_11351852 Ga0157378_113518522 95
134 3300013306 Ga0163162_10011697 Ga0163162_100116975 95
135 3300013308 Ga0157375_10000004 Ga0157375_1000000460 95
136 3300013308 Ga0157375_10001181 Ga0157375_1000118112 95
137 3300014745 Ga0157377_10000009 Ga0157377_10000009282 95
138 3300014745 Ga0157377_10000227 Ga0157377_1000022710 95
139 3300014969 Ga0157376_10000020 Ga0157376_10000020194 95
140 3300014969 Ga0157376_11886349 Ga0157376_118863491 95
141 3300021358 Ga0213873_10000002 Ga0213873_10000002989 95
142 3300021358 Ga0213873_10010945 Ga0213873_100109452 95
143 3300021377 Ga0213874_10129073 Ga0213874_101290732 95
144 3300021384 Ga0213876_10000010 Ga0213876_100000107 95
145 3300021384 Ga0213876_10000012 Ga0213876_1000001289 95
146 3300021384 Ga0213876_10011520 Ga0213876_100115206 95
147 3300021384 Ga0213876_10014326 Ga0213876_100143265 95
148 3300021384 Ga0213876_10021085 Ga0213876_100210855 95
149 3300025321 Ga0207656_10134488 Ga0207656_101344882 95
150 3300025907 Ga0207645_10095234 Ga0207645_100952342 95
151 3300025908 Ga0207643_10020905 Ga0207643_100209051 95
152 3300025909 Ga0207705_10075892 Ga0207705_100758922 95
153 3300025910 Ga0207684_10042915 Ga0207684_100429152 95
154 3300025910 Ga0207684_10154391 Ga0207684_101543912 95
155 3300025910 Ga0207684_10318112 Ga0207684_103181122 95
156 3300025918 Ga0207662_10001051 Ga0207662_100010517 95
157 3300025922 Ga0207646_10065175 Ga0207646_100651752 95
158 3300025922 Ga0207646_10078318 Ga0207646_100783185 95
159 3300025922 Ga0207646_11160760 Ga0207646_111607602 95
160 3300025922 Ga0207646_11637010 Ga0207646_116370102 95
161 3300025923 Ga0207681_10864028 Ga0207681_108640282 95
162 3300025924 Ga0207694_10000001 Ga0207694_100000012202 95
163 3300025925 Ga0207650_10000088 Ga0207650_10000088107 95
164 3300025925 Ga0207650_11799498 Ga0207650_117994982 95
165 3300025927 Ga0207687_10000003 Ga0207687_10000003756 95
166 3300025927 Ga0207687_10000157 Ga0207687_1000015740 95
167 3300025927 Ga0207687_10134220 Ga0207687_101342201 95
168 3300025928 Ga0207700_10960483 Ga0207700_109604832 95
169 3300025934 Ga0207686_10046476 Ga0207686_100464763 95
170 3300025936 Ga0207670_10278038 Ga0207670_102780381 95
171 3300025936 Ga0207670_10302036 Ga0207670_103020362 95
172 3300025936 Ga0207670_10552952 Ga0207670_105529522 95
173 3300025937 Ga0207669_11041211 Ga0207669_110412112 95
174 3300025939 Ga0207665_10531966 Ga0207665_105319662 95
175 3300025940 Ga0207691_11333026 Ga0207691_113330262 95
176 3300025942 Ga0207689_10003419 Ga0207689_1000341912 95
177 3300025942 Ga0207689_10450026 Ga0207689_104500262 95
178 3300025942 Ga0207689_11074150 Ga0207689_110741502 95
179 3300025944 Ga0207661_10000001 Ga0207661_1000000125 95
180 3300025981 Ga0207640_10006779 Ga0207640_100067798 95
181 3300025981 Ga0207640_10013881 Ga0207640_100138814 95
182 3300025981 Ga0207640_10098382 Ga0207640_100983822 95
183 3300025981 Ga0207640_10585221 Ga0207640_105852212 95
184 3300026023 Ga0207677_10000009 Ga0207677_1000000923 95
185 3300026041 Ga0207639_10000003 Ga0207639_1000000379 95
186 3300026041 Ga0207639_10283447 Ga0207639_102834474 95
187 3300026075 Ga0207708_10000001 Ga0207708_10000001434 95
188 3300026116 Ga0207674_10013030 Ga0207674_100130305 95
189 3300026142 Ga0207698_11598749 Ga0207698_115987492 95
190 3300027907 Ga0207428_10000581 Ga0207428_1000058139 95
191 3300030521 Ga0307511_10008320 Ga0307511_100083205 95
192 3300031548 Ga0307408_102435970 Ga0307408_1024359701 95
193 3300031852 Ga0307410_11156690 Ga0307410_111566902 95
194 3300031995 Ga0307409_102000689 Ga0307409_1020006891 95
195 3300031995 Ga0307409_102242560 Ga0307409_1022425602 95
196 3300032002 Ga0307416_101730079 Ga0307416_1017300792 95
197 3300032002 Ga0307416_102135471 Ga0307416_1021354712 95
198 3300032002 Ga0307416_103818069 Ga0307416_1038180691 95
199 3300032126 Ga0307415_100449124 Ga0307415_1004491242 95
200 3300032126 Ga0307415_101989288 Ga0307415_1019892881 95
201 3300035112 Ga0373932_0001131 Ga0373932_0001131_4484_4771 95
202 3300035115 Ga0373941_0203088 Ga0373941_0203088_247_534 95
203 3300035170 Ga0373943_0109216 Ga0373943_0109216_686_973 95
204 3300035691 Ga0373931_0152827 Ga0373931_0152827_791_1078 95
205 3300035725 Ga0373947_0453494 Ga0373947_0453494_229_516 95
206 3300035725 Ga0373947_0979093 Ga0373947_0979093_20_319 95
207 3300039437 Ga0436365_0080501 Ga0436365_0080501_3994_4281 95
208 3300039437 Ga0436365_0120716 Ga0436365_0120716_88581_88868 95
209 3300039437 Ga0436365_0362725 Ga0436365_0362725_2154_2441 95
210 3300039437 Ga0436365_0404975 Ga0436365_0404975_2073_2360 95
211 3300039437 Ga0436365_1172437 Ga0436365_1172437_4482_4769 95
212 3300039437 Ga0436365_1576280 Ga0436365_1576280_1223_1510 95
213 3300039450 Ga0436363_0546122 Ga0436363_0546122_159_446 95
214 3300039450 Ga0436363_0726707 Ga0436363_0726707_431_718 95
215 3300039450 Ga0436363_0772335 Ga0436363_0772335_27_314 95
216 3300039453 Ga0436362_0178131 Ga0436362_0178131_12081_12368 95
217 3300039453 Ga0436362_0931096 Ga0436362_0931096_1472_1759 95
218 3300041463 Ga0451804_0178835 Ga0451804_0178835_215_502 95
219 3300041496 Ga0451839_0677481 Ga0451839_0677481_1202_1489 95
220 3300041501 Ga0451845_0527068 Ga0451845_0527068_115_402 95
221 3300042876 Ga0451577_0080083 Ga0451577_0080083_1183_1476 95
222 3300042876 Ga0451577_0349117 Ga0451577_0349117_332_619 95
223 3300042876 Ga0451577_0429242 Ga0451577_0429242_759_1052 95
224 3300042876 Ga0451577_1350826 Ga0451577_1350826_322_615 95
225 3300044712 Ga0453684_0851777 Ga0453684_0851777_623_916 95
226 3300045051 Ga0451576_0698931 Ga0451576_0698931_64_357 95
227 3300045836 Ga0466958_0841013 Ga0466958_0841013_221_508 95
228 3300046515 Ga0495620_0002789 Ga0495620_0002789_6737_7024 95
229 3300046539 Ga0495621_0262904 Ga0495621_0262904_311_598 95
230 3300047446 Ga0495679_083589 Ga0495679_083589_109_396 95
231 3300048904 Ga0496101_0600684 Ga0496101_0600684_302_589 95
232 3300048915 Ga0496112_1113206 Ga0496112_1113206_145_432 95
233 3300049589 Ga0501073_0003332 Ga0501073_0003332_6363_6650 95
234 3300050508 nmdc:mga09592_1134815_c1 nmdc:mga09592_1134815_c1_103_390 95
235 3300050508 nmdc:mga09592_609164_c1 nmdc:mga09592_609164_c1_87_374 95
236 3300050510 nmdc:mga06r32_439084_c1 nmdc:mga06r32_439084_c1_359_646 95
237 3300050510 nmdc:mga06r32_9428_c1 nmdc:mga06r32_9428_c1_8451_8738 95
238 3300050511 nmdc:mga08y16_28_c1 nmdc:mga08y16_28_c1_122417_122704 95
239 3300050512 nmdc:mga0n895_133918_c1 nmdc:mga0n895_133918_c1_690_977 95
240 3300050512 nmdc:mga0n895_239137_c1 nmdc:mga0n895_239137_c1_915_1202 95
241 3300050512 nmdc:mga0n895_769957_c1 nmdc:mga0n895_769957_c1_174_461 95
242 3300050513 nmdc:mga0rr50_153197_c1 nmdc:mga0rr50_153197_c1_894_1181 95
243 3300050513 nmdc:mga0rr50_20352_c1 nmdc:mga0rr50_20352_c1_2127_2414 95
244 3300050513 nmdc:mga0rr50_751092_c1 nmdc:mga0rr50_751092_c1_57_344 95
245 3300050514 nmdc:mga08x19_658600_c1 nmdc:mga08x19_658600_c1_18_305 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

11

104

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.847 2 86
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8 1 90
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.7793 1 88
1x0g-assembly1.cif.gz_C crystal structure of isca with the [2fe-2s] cluster 0.7754 2 90
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.7591 2 86
ID Description Score Start End Superfamily
af_O96161_49_160_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8873 2 85 2.60.300.12
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.847 2 86 2.60.300.12
af_D4A4L5_49_154_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8344 2 90 2.60.300.12
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8316 2 86 2.60.300.12
af_P78859_82_189_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8219 2 90 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A2V7WPT9-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.9815 1 95
AF-A0A7W0UK23-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.8909 1 84
AF-A0A847BY98-F1-model_v4 Iron-sulfur cluster biosynthesis family protein 0.8897 2 84
AF-A0A850PH24-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.8808 3 86 GO:0005737
GO:0016226
GO:0051537
GO:0097428
AF-A0A1F4QCB2-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.8803 2 94

Feature Viewer

pLDDT pTM Quality
87.06 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map