F357173
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 245 | 138 | 245 | 95 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_101013101|Ga0070699_1010131012 |
| Length | 105 |
| Sequence | MAHRARIETGMNIELSPAAAQHLQHDLDGRVLRIAFTTGCGGSGYRLSYAPEPVESDEVVAIDGVRVALDSMAASRLDGARIEYDPDEDGYLLDHPDAVSAVWCG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 71 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 110 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 114 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 117 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 118 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 120 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 123 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 126 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 131 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 136 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.22 |
| Rhizosphere | 91.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10112003 | 3300005327 | Bacteria | 2262 |
| 2 | Ga0070676_11155299 | 3300005328 | Bacteria | 587 |
| 3 | Ga0070683_100000113 | 3300005329 | Bacteria | 53083 |
| 4 | Ga0070683_101905179 | 3300005329 | Unclassified | 571 |
| 5 | Ga0070690_100178634 | 3300005330 | Unclassified | 1466 |
| 6 | Ga0070670_100000041 | 3300005331 | Bacteria | 147849 |
| 7 | Ga0070670_100008464 | 3300005331 | Bacteria | 8776 |
| 8 | Ga0070670_101506976 | 3300005331 | Unclassified | 617 |
| 9 | Ga0070677_10901025 | 3300005333 | Bacteria | 511 |
| 10 | Ga0068869_100001899 | 3300005334 | Bacteria | 12569 |
| 11 | Ga0068869_100097146 | 3300005334 | Bacteria | 2224 |
| 12 | Ga0068869_101497246 | 3300005334 | Unclassified | 599 |
| 13 | Ga0068869_101612269 | 3300005334 | Unclassified | 578 |
| 14 | Ga0070680_100004153 | 3300005336 | Bacteria | 10847 |
| 15 | Ga0070682_100436148 | 3300005337 | Unclassified | 1000 |
| 16 | Ga0070682_100802894 | 3300005337 | Unclassified | 765 |
| 17 | Ga0068868_100002260 | 3300005338 | Bacteria | 13319 |
| 18 | Ga0070689_100390681 | 3300005340 | Unclassified | 1174 |
| 19 | Ga0070689_100496719 | 3300005340 | Unclassified | 1045 |
| 20 | Ga0070689_100534697 | 3300005340 | Bacteria | 1008 |
| 21 | Ga0070687_100000252 | 3300005343 | Bacteria | 18252 |
| 22 | Ga0070687_100336837 | 3300005343 | Bacteria | 969 |
| 23 | Ga0070687_100693048 | 3300005343 | Unclassified | 711 |
| 24 | Ga0070692_11083137 | 3300005345 | Unclassified | 565 |
| 25 | Ga0070675_100000009 | 3300005354 | Bacteria | 245759 |
| 26 | Ga0070671_100137970 | 3300005355 | Bacteria | 2057 |
| 27 | Ga0070671_101288906 | 3300005355 | Unclassified | 644 |
| 28 | Ga0070674_100887124 | 3300005356 | Unclassified | 776 |
| 29 | Ga0070703_10087802 | 3300005406 | Bacteria | 1072 |
| 30 | Ga0070709_10489021 | 3300005434 | Bacteria | 933 |
| 31 | Ga0070713_100573912 | 3300005436 | Bacteria | 1070 |
| 32 | Ga0070713_101049323 | 3300005436 | Unclassified | 787 |
| 33 | Ga0070701_10024665 | 3300005438 | Bacteria | 2911 |
| 34 | Ga0070700_100000084 | 3300005441 | Bacteria | 62644 |
| 35 | Ga0070708_100067949 | 3300005445 | Bacteria | 3202 |
| 36 | Ga0070708_100797125 | 3300005445 | Bacteria | 888 |
| 37 | Ga0070708_101151005 | 3300005445 | Bacteria | 726 |
| 38 | Ga0068867_100710585 | 3300005459 | Bacteria | 888 |
| 39 | Ga0070685_10025452 | 3300005466 | Bacteria | 3259 |
| 40 | Ga0070706_100002247 | 3300005467 | Bacteria | 19604 |
| 41 | Ga0070706_100046116 | 3300005467 | Bacteria | 4023 |
| 42 | Ga0070706_100140825 | 3300005467 | Unclassified | 2252 |
| 43 | Ga0070707_100079190 | 3300005468 | Bacteria | 3171 |
| 44 | Ga0070707_101326261 | 3300005468 | Unclassified | 686 |
| 45 | Ga0070707_101990237 | 3300005468 | Bacteria | 548 |
| 46 | Ga0070707_102057343 | 3300005468 | Bacteria | 538 |
| 47 | Ga0070698_100103029 | 3300005471 | Bacteria | 2824 |
| 48 | Ga0070698_100217764 | 3300005471 | Bacteria | 1843 |
| 49 | Ga0070698_100233747 | 3300005471 | Bacteria | 1771 |
| 50 | Ga0070698_100505981 | 3300005471 | Unclassified | 1146 |
| 51 | Ga0070699_100019275 | 3300005518 | Bacteria | 5871 |
| 52 | Ga0070699_100020283 | 3300005518 | Bacteria | 5731 |
| 53 | Ga0070699_100285570 | 3300005518 | Bacteria | 1478 |
| 54 | Ga0070699_101013101 | 3300005518 | Bacteria | 762 |
| 55 | Ga0070684_100001793 | 3300005535 | Bacteria | 15696 |
| 56 | Ga0070684_100776726 | 3300005535 | Unclassified | 895 |
| 57 | Ga0070684_101541618 | 3300005535 | Unclassified | 626 |
| 58 | Ga0070684_101993680 | 3300005535 | Bacteria | 548 |
| 59 | Ga0070697_100060031 | 3300005536 | Bacteria | 3098 |
| 60 | Ga0070697_100072876 | 3300005536 | Unclassified | 2818 |
| 61 | Ga0070697_100121862 | 3300005536 | Bacteria | 2182 |
| 62 | Ga0068853_100196868 | 3300005539 | Bacteria | 1833 |
| 63 | Ga0070672_100234560 | 3300005543 | Bacteria | 1542 |
| 64 | Ga0070696_100435394 | 3300005546 | Unclassified | 1032 |
| 65 | Ga0070693_100375156 | 3300005547 | Unclassified | 980 |
| 66 | Ga0070704_101297533 | 3300005549 | Bacteria | 666 |
| 67 | Ga0068857_100025018 | 3300005577 | Bacteria | 5259 |
| 68 | Ga0068854_100019615 | 3300005578 | Bacteria | 4559 |
| 69 | Ga0068854_100036345 | 3300005578 | Bacteria | 3453 |
| 70 | Ga0070702_100098061 | 3300005615 | Bacteria | 1792 |
| 71 | Ga0070702_100206695 | 3300005615 | Bacteria | 1304 |
| 72 | Ga0070702_100772565 | 3300005615 | Unclassified | 740 |
| 73 | Ga0068852_101577132 | 3300005616 | Bacteria | 679 |
| 74 | Ga0068866_11358045 | 3300005718 | Bacteria | 518 |
| 75 | Ga0068861_100179105 | 3300005719 | Bacteria | 1763 |
| 76 | Ga0068851_10147140 | 3300005834 | Bacteria | 1285 |
| 77 | Ga0068870_10084259 | 3300005840 | Unclassified | 1764 |
| 78 | Ga0070717_10000073 | 3300006028 | Bacteria | 84057 |
| 79 | Ga0070717_11342392 | 3300006028 | Unclassified | 650 |
| 80 | Ga0070716_100115959 | 3300006173 | Bacteria | 1668 |
| 81 | Ga0070716_100634340 | 3300006173 | Unclassified | 808 |
| 82 | Ga0075431_100022923 | 3300006847 | Bacteria | 6382 |
| 83 | Ga0075431_100934577 | 3300006847 | Unclassified | 836 |
| 84 | Ga0075433_10771209 | 3300006852 | Bacteria | 841 |
| 85 | Ga0075434_100597205 | 3300006871 | Bacteria | 1123 |
| 86 | Ga0075434_100825583 | 3300006871 | Bacteria | 943 |
| 87 | Ga0075434_101032224 | 3300006871 | Bacteria | 836 |
| 88 | Ga0075434_101113428 | 3300006871 | Bacteria | 803 |
| 89 | Ga0075429_100704961 | 3300006880 | Unclassified | 884 |
| 90 | Ga0075429_100977745 | 3300006880 | Unclassified | 740 |
| 91 | Ga0075436_100017349 | 3300006914 | Bacteria | 4928 |
| 92 | Ga0075436_100675955 | 3300006914 | Bacteria | 764 |
| 93 | Ga0075435_100000060 | 3300007076 | Bacteria | 55995 |
| 94 | Ga0075435_100007875 | 3300007076 | Bacteria | 7624 |
| 95 | Ga0075435_100022079 | 3300007076 | Bacteria | 4907 |
| 96 | Ga0075435_100163179 | 3300007076 | Bacteria | 1878 |
| 97 | Ga0105244_10068316 | 3300009036 | Bacteria | 1776 |
| 98 | Ga0105240_10103556 | 3300009093 | Bacteria | 3458 |
| 99 | Ga0111539_10000054 | 3300009094 | Bacteria | 115242 |
| 100 | Ga0105245_10000066 | 3300009098 | Bacteria | 109321 |
| 101 | Ga0105245_10000927 | 3300009098 | Bacteria | 26636 |
| 102 | Ga0105245_10325386 | 3300009098 | Unclassified | 1516 |
| 103 | Ga0105245_10547048 | 3300009098 | Bacteria | 1179 |
| 104 | Ga0105245_11011912 | 3300009098 | Bacteria | 876 |
| 105 | Ga0114129_10057312 | 3300009147 | Bacteria | 5453 |
| 106 | Ga0114129_13333272 | 3300009147 | Bacteria | 518 |
| 107 | Ga0105243_13093161 | 3300009148 | Bacteria | 504 |
| 108 | Ga0105242_10812501 | 3300009176 | Unclassified | 927 |
| 109 | Ga0105248_12782326 | 3300009177 | Unclassified | 558 |
| 110 | Ga0105238_10000001 | 3300009551 | Bacteria | 2036163 |
| 111 | Ga0105239_10091582 | 3300010375 | Bacteria | 3355 |
| 112 | Ga0105246_11493983 | 3300011119 | Unclassified | 634 |
| 113 | Ga0157369_10002844 | 3300013105 | Bacteria | 20665 |
| 114 | Ga0157369_10717035 | 3300013105 | Unclassified | 1030 |
| 115 | Ga0157374_10000021 | 3300013296 | Bacteria | 272840 |
| 116 | Ga0157378_10000572 | 3300013297 | Bacteria | 34793 |
| 117 | Ga0157378_10002268 | 3300013297 | Bacteria | 17079 |
| 118 | Ga0157378_10097853 | 3300013297 | Bacteria | 2675 |
| 119 | Ga0157378_11351852 | 3300013297 | Bacteria | 754 |
| 120 | Ga0163162_10011697 | 3300013306 | Bacteria | 8557 |
| 121 | Ga0163162_10317132 | 3300013306 | Bacteria | 1691 |
| 122 | Ga0157375_10000004 | 3300013308 | Bacteria | 474935 |
| 123 | Ga0157375_10001181 | 3300013308 | Bacteria | 22565 |
| 124 | Ga0157377_10000009 | 3300014745 | Bacteria | 385287 |
| 125 | Ga0157377_10000227 | 3300014745 | Bacteria | 29511 |
| 126 | Ga0157376_10000020 | 3300014969 | Bacteria | 246318 |
| 127 | Ga0157376_11886349 | 3300014969 | Unclassified | 634 |
| 128 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 129 | Ga0213873_10010945 | 3300021358 | Bacteria | 1927 |
| 130 | Ga0213874_10129073 | 3300021377 | Bacteria | 866 |
| 131 | Ga0213876_10000010 | 3300021384 | Bacteria | 492549 |
| 132 | Ga0213876_10000012 | 3300021384 | Bacteria | 396530 |
| 133 | Ga0213876_10011520 | 3300021384 | Bacteria | 4719 |
| 134 | Ga0213876_10014326 | 3300021384 | Bacteria | 4203 |
| 135 | Ga0213876_10021085 | 3300021384 | Bacteria | 3445 |
| 136 | Ga0207656_10134488 | 3300025321 | Bacteria | 1161 |
| 137 | Ga0207655_1121379 | 3300025728 | Unclassified | 865 |
| 138 | Ga0207699_10064150 | 3300025906 | Bacteria | 2222 |
| 139 | Ga0207645_10095234 | 3300025907 | Unclassified | 1917 |
| 140 | Ga0207643_10020905 | 3300025908 | Bacteria | 3592 |
| 141 | Ga0207705_10075892 | 3300025909 | Bacteria | 2442 |
| 142 | Ga0207684_10042915 | 3300025910 | Bacteria | 3834 |
| 143 | Ga0207684_10154391 | 3300025910 | Bacteria | 1975 |
| 144 | Ga0207684_10318112 | 3300025910 | Bacteria | 1341 |
| 145 | Ga0207660_10066627 | 3300025917 | Bacteria | 2606 |
| 146 | Ga0207662_10001051 | 3300025918 | Bacteria | 12945 |
| 147 | Ga0207646_10065175 | 3300025922 | Bacteria | 3252 |
| 148 | Ga0207646_10078318 | 3300025922 | Bacteria | 2955 |
| 149 | Ga0207646_11160760 | 3300025922 | Unclassified | 678 |
| 150 | Ga0207646_11637010 | 3300025922 | Bacteria | 554 |
| 151 | Ga0207681_10864028 | 3300025923 | Bacteria | 757 |
| 152 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 153 | Ga0207650_10000088 | 3300025925 | Bacteria | 123236 |
| 154 | Ga0207650_11799498 | 3300025925 | Unclassified | 518 |
| 155 | Ga0207659_10000007 | 3300025926 | Bacteria | 322984 |
| 156 | Ga0207687_10000003 | 3300025927 | Bacteria | 875159 |
| 157 | Ga0207687_10000157 | 3300025927 | Bacteria | 45617 |
| 158 | Ga0207687_10134220 | 3300025927 | Bacteria | 1870 |
| 159 | Ga0207700_10668656 | 3300025928 | Bacteria | 926 |
| 160 | Ga0207700_10960483 | 3300025928 | Unclassified | 765 |
| 161 | Ga0207686_10046476 | 3300025934 | Bacteria | 2678 |
| 162 | Ga0207670_10278038 | 3300025936 | Bacteria | 1304 |
| 163 | Ga0207670_10302036 | 3300025936 | Unclassified | 1253 |
| 164 | Ga0207670_10552952 | 3300025936 | Bacteria | 941 |
| 165 | Ga0207669_11041211 | 3300025937 | Unclassified | 689 |
| 166 | Ga0207665_10531966 | 3300025939 | Bacteria | 911 |
| 167 | Ga0207691_11333026 | 3300025940 | Bacteria | 592 |
| 168 | Ga0207689_10003419 | 3300025942 | Bacteria | 14492 |
| 169 | Ga0207689_10450026 | 3300025942 | Bacteria | 1076 |
| 170 | Ga0207689_11074150 | 3300025942 | Unclassified | 679 |
| 171 | Ga0207661_10000001 | 3300025944 | Bacteria | 937688 |
| 172 | Ga0207640_10006779 | 3300025981 | Bacteria | 6303 |
| 173 | Ga0207640_10013881 | 3300025981 | Bacteria | 4625 |
| 174 | Ga0207640_10098382 | 3300025981 | Bacteria | 2045 |
| 175 | Ga0207640_10585221 | 3300025981 | Unclassified | 943 |
| 176 | Ga0207677_10000009 | 3300026023 | Bacteria | 252751 |
| 177 | Ga0207639_10000003 | 3300026041 | Bacteria | 806887 |
| 178 | Ga0207639_10283447 | 3300026041 | Unclassified | 1458 |
| 179 | Ga0207708_10000001 | 3300026075 | Bacteria | 467100 |
| 180 | Ga0207674_10013030 | 3300026116 | Bacteria | 9262 |
| 181 | Ga0207675_100069643 | 3300026118 | Bacteria | 3288 |
| 182 | Ga0207698_11598749 | 3300026142 | Bacteria | 667 |
| 183 | Ga0207428_10000581 | 3300027907 | Bacteria | 43128 |
| 184 | Ga0307511_10008320 | 3300030521 | Bacteria | 10384 |
| 185 | Ga0307408_102435970 | 3300031548 | Unclassified | 508 |
| 186 | Ga0307410_11156690 | 3300031852 | Bacteria | 673 |
| 187 | Ga0307409_102000689 | 3300031995 | Bacteria | 609 |
| 188 | Ga0307409_102242560 | 3300031995 | Unclassified | 575 |
| 189 | Ga0307416_101730079 | 3300032002 | Bacteria | 730 |
| 190 | Ga0307416_102135471 | 3300032002 | Unclassified | 662 |
| 191 | Ga0307416_103818069 | 3300032002 | Bacteria | 504 |
| 192 | Ga0307415_100449124 | 3300032126 | Unclassified | 1114 |
| 193 | Ga0307415_101989288 | 3300032126 | Bacteria | 566 |
| 194 | Ga0373932_0001131 | 3300035112 | Bacteria | 7686 |
| 195 | Ga0373941_0203088 | 3300035115 | Unclassified | 754 |
| 196 | Ga0373941_0238448 | 3300035115 | Bacteria | 705 |
| 197 | Ga0373943_0109216 | 3300035170 | Unclassified | 1457 |
| 198 | Ga0373931_0152827 | 3300035691 | Bacteria | 1347 |
| 199 | Ga0373947_0453494 | 3300035725 | Unclassified | 869 |
| 200 | Ga0373947_0979093 | 3300035725 | Unclassified | 577 |
| 201 | Ga0436365_0080501 | 3300039437 | Bacteria | 6381 |
| 202 | Ga0436365_0120716 | 3300039437 | Bacteria | 90169 |
| 203 | Ga0436365_0362725 | 3300039437 | Bacteria | 2840 |
| 204 | Ga0436365_0404975 | 3300039437 | Bacteria | 180420 |
| 205 | Ga0436365_0716789 | 3300039437 | Unclassified | 698 |
| 206 | Ga0436365_1172437 | 3300039437 | Bacteria | 5782 |
| 207 | Ga0436365_1576280 | 3300039437 | Bacteria | 1544 |
| 208 | Ga0436363_0546122 | 3300039450 | Bacteria | 511 |
| 209 | Ga0436363_0726707 | 3300039450 | Bacteria | 878 |
| 210 | Ga0436363_0772335 | 3300039450 | Bacteria | 595 |
| 211 | Ga0436362_0178131 | 3300039453 | Bacteria | 97887 |
| 212 | Ga0436362_0931096 | 3300039453 | Bacteria | 4074 |
| 213 | Ga0451804_0178835 | 3300041463 | Bacteria | 516 |
| 214 | Ga0451839_0677481 | 3300041496 | Bacteria | 4417 |
| 215 | Ga0451845_0527068 | 3300041501 | Bacteria | 502 |
| 216 | Ga0451577_0080083 | 3300042876 | Bacteria | 2912 |
| 217 | Ga0451577_0349117 | 3300042876 | Bacteria | 1342 |
| 218 | Ga0451577_0429242 | 3300042876 | Bacteria | 1200 |
| 219 | Ga0451577_1350826 | 3300042876 | Bacteria | 633 |
| 220 | Ga0466964_0137965 | 3300044706 | Unclassified | 1118 |
| 221 | Ga0453684_0851777 | 3300044712 | Bacteria | 979 |
| 222 | Ga0451576_0698931 | 3300045051 | Bacteria | 1065 |
| 223 | Ga0466958_0841013 | 3300045836 | Unclassified | 599 |
| 224 | Ga0495620_0002789 | 3300046515 | Bacteria | 10055 |
| 225 | Ga0495621_0262904 | 3300046539 | Bacteria | 707 |
| 226 | Ga0495679_083589 | 3300047446 | Unclassified | 903 |
| 227 | Ga0496101_0600684 | 3300048904 | Bacteria | 870 |
| 228 | Ga0496112_1113206 | 3300048915 | Unclassified | 708 |
| 229 | Ga0501073_0003332 | 3300049589 | Bacteria | 12073 |
| 230 | nmdc:mga09592_1134815_c1 | 3300050508 | Unclassified | 648 |
| 231 | nmdc:mga09592_609164_c1 | 3300050508 | Unclassified | 935 |
| 232 | nmdc:mga06r32_439084_c1 | 3300050510 | Bacteria | 1285 |
| 233 | nmdc:mga06r32_9428_c1 | 3300050510 | Bacteria | 8807 |
| 234 | nmdc:mga08y16_28_c1 | 3300050511 | Bacteria | 201429 |
| 235 | nmdc:mga0n895_133918_c1 | 3300050512 | Bacteria | 2504 |
| 236 | nmdc:mga0n895_239137_c1 | 3300050512 | Bacteria | 1842 |
| 237 | nmdc:mga0n895_769957_c1 | 3300050512 | Bacteria | 954 |
| 238 | nmdc:mga0rr50_125_c1 | 3300050513 | Bacteria | 42801 |
| 239 | nmdc:mga0rr50_153197_c1 | 3300050513 | Bacteria | 1865 |
| 240 | nmdc:mga0rr50_15806_c1 | 3300050513 | Bacteria | 4992 |
| 241 | nmdc:mga0rr50_20352_c1 | 3300050513 | Bacteria | 4504 |
| 242 | nmdc:mga0rr50_751092_c1 | 3300050513 | Bacteria | 832 |
| 243 | nmdc:mga08x19_658600_c1 | 3300050514 | Bacteria | 743 |
| 244 | nmdc:mga08x19_776_c1 | 3300050514 | Bacteria | 20338 |
| 245 | Ga0495655_0000194 | 3300053083 | Bacteria | 11396 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007076 | Ga0075435_100007875 | Ga0075435_1000078758 | 90 |
| 2 | 3300035115 | Ga0373941_0238448 | Ga0373941_0238448_334_609 | 90 |
| 3 | 3300050513 | nmdc:mga0rr50_15806_c1 | nmdc:mga0rr50_15806_c1_683_958 | 90 |
| 4 | 3300005336 | Ga0070680_100004153 | Ga0070680_10000415313 | 91 |
| 5 | 3300005719 | Ga0068861_100179105 | Ga0068861_1001791053 | 91 |
| 6 | 3300013306 | Ga0163162_10317132 | Ga0163162_103171323 | 91 |
| 7 | 3300025917 | Ga0207660_10066627 | Ga0207660_100666274 | 91 |
| 8 | 3300026118 | Ga0207675_100069643 | Ga0207675_1000696436 | 91 |
| 9 | 3300044706 | Ga0466964_0137965 | Ga0466964_0137965_240_515 | 91 |
| 10 | 3300039437 | Ga0436365_0716789 | Ga0436365_0716789_329_607 | 92 |
| 11 | 3300005343 | Ga0070687_100336837 | Ga0070687_1003368372 | 94 |
| 12 | 3300005354 | Ga0070675_100000009 | Ga0070675_100000009160 | 94 |
| 13 | 3300005434 | Ga0070709_10489021 | Ga0070709_104890212 | 94 |
| 14 | 3300005436 | Ga0070713_100573912 | Ga0070713_1005739122 | 94 |
| 15 | 3300005471 | Ga0070698_100505981 | Ga0070698_1005059812 | 94 |
| 16 | 3300005546 | Ga0070696_100435394 | Ga0070696_1004353942 | 94 |
| 17 | 3300005547 | Ga0070693_100375156 | Ga0070693_1003751562 | 94 |
| 18 | 3300006028 | Ga0070717_10000073 | Ga0070717_1000007370 | 94 |
| 19 | 3300006852 | Ga0075433_10771209 | Ga0075433_107712091 | 94 |
| 20 | 3300006871 | Ga0075434_100825583 | Ga0075434_1008255832 | 94 |
| 21 | 3300006914 | Ga0075436_100017349 | Ga0075436_1000173492 | 94 |
| 22 | 3300007076 | Ga0075435_100000060 | Ga0075435_10000006024 | 94 |
| 23 | 3300009036 | Ga0105244_10068316 | Ga0105244_100683162 | 94 |
| 24 | 3300009147 | Ga0114129_13333272 | Ga0114129_133332721 | 94 |
| 25 | 3300009177 | Ga0105248_12782326 | Ga0105248_127823262 | 94 |
| 26 | 3300025728 | Ga0207655_1121379 | Ga0207655_11213792 | 94 |
| 27 | 3300025906 | Ga0207699_10064150 | Ga0207699_100641503 | 94 |
| 28 | 3300025926 | Ga0207659_10000007 | Ga0207659_10000007162 | 94 |
| 29 | 3300025928 | Ga0207700_10668656 | Ga0207700_106686562 | 94 |
| 30 | 3300050513 | nmdc:mga0rr50_125_c1 | nmdc:mga0rr50_125_c1_11939_12223 | 94 |
| 31 | 3300050514 | nmdc:mga08x19_776_c1 | nmdc:mga08x19_776_c1_16740_17024 | 94 |
| 32 | 3300053083 | Ga0495655_0000194 | Ga0495655_0000194_8348_8632 | 94 |
| 33 | 3300005327 | Ga0070658_10112003 | Ga0070658_101120034 | 95 |
| 34 | 3300005328 | Ga0070676_11155299 | Ga0070676_111552992 | 95 |
| 35 | 3300005329 | Ga0070683_100000113 | Ga0070683_10000011310 | 95 |
| 36 | 3300005329 | Ga0070683_101905179 | Ga0070683_1019051792 | 95 |
| 37 | 3300005330 | Ga0070690_100178634 | Ga0070690_1001786342 | 95 |
| 38 | 3300005331 | Ga0070670_100000041 | Ga0070670_10000004130 | 95 |
| 39 | 3300005331 | Ga0070670_100008464 | Ga0070670_10000846410 | 95 |
| 40 | 3300005331 | Ga0070670_101506976 | Ga0070670_1015069761 | 95 |
| 41 | 3300005333 | Ga0070677_10901025 | Ga0070677_109010252 | 95 |
| 42 | 3300005334 | Ga0068869_100001899 | Ga0068869_10000189910 | 95 |
| 43 | 3300005334 | Ga0068869_100097146 | Ga0068869_1000971461 | 95 |
| 44 | 3300005334 | Ga0068869_101497246 | Ga0068869_1014972461 | 95 |
| 45 | 3300005334 | Ga0068869_101612269 | Ga0068869_1016122691 | 95 |
| 46 | 3300005337 | Ga0070682_100436148 | Ga0070682_1004361482 | 95 |
| 47 | 3300005337 | Ga0070682_100802894 | Ga0070682_1008028942 | 95 |
| 48 | 3300005338 | Ga0068868_100002260 | Ga0068868_1000022606 | 95 |
| 49 | 3300005340 | Ga0070689_100390681 | Ga0070689_1003906813 | 95 |
| 50 | 3300005340 | Ga0070689_100496719 | Ga0070689_1004967192 | 95 |
| 51 | 3300005340 | Ga0070689_100534697 | Ga0070689_1005346972 | 95 |
| 52 | 3300005343 | Ga0070687_100000252 | Ga0070687_1000002528 | 95 |
| 53 | 3300005343 | Ga0070687_100693048 | Ga0070687_1006930481 | 95 |
| 54 | 3300005345 | Ga0070692_11083137 | Ga0070692_110831372 | 95 |
| 55 | 3300005355 | Ga0070671_100137970 | Ga0070671_1001379703 | 95 |
| 56 | 3300005355 | Ga0070671_101288906 | Ga0070671_1012889062 | 95 |
| 57 | 3300005356 | Ga0070674_100887124 | Ga0070674_1008871242 | 95 |
| 58 | 3300005406 | Ga0070703_10087802 | Ga0070703_100878022 | 95 |
| 59 | 3300005436 | Ga0070713_101049323 | Ga0070713_1010493232 | 95 |
| 60 | 3300005438 | Ga0070701_10024665 | Ga0070701_100246652 | 95 |
| 61 | 3300005441 | Ga0070700_100000084 | Ga0070700_10000008441 | 95 |
| 62 | 3300005445 | Ga0070708_100067949 | Ga0070708_1000679492 | 95 |
| 63 | 3300005445 | Ga0070708_100797125 | Ga0070708_1007971252 | 95 |
| 64 | 3300005445 | Ga0070708_101151005 | Ga0070708_1011510052 | 95 |
| 65 | 3300005459 | Ga0068867_100710585 | Ga0068867_1007105852 | 95 |
| 66 | 3300005466 | Ga0070685_10025452 | Ga0070685_100254522 | 95 |
| 67 | 3300005467 | Ga0070706_100002247 | Ga0070706_1000022476 | 95 |
| 68 | 3300005467 | Ga0070706_100046116 | Ga0070706_1000461162 | 95 |
| 69 | 3300005467 | Ga0070706_100140825 | Ga0070706_1001408252 | 95 |
| 70 | 3300005468 | Ga0070707_100079190 | Ga0070707_1000791905 | 95 |
| 71 | 3300005468 | Ga0070707_101326261 | Ga0070707_1013262611 | 95 |
| 72 | 3300005468 | Ga0070707_101990237 | Ga0070707_1019902371 | 95 |
| 73 | 3300005468 | Ga0070707_102057343 | Ga0070707_1020573431 | 95 |
| 74 | 3300005471 | Ga0070698_100103029 | Ga0070698_1001030294 | 95 |
| 75 | 3300005471 | Ga0070698_100217764 | Ga0070698_1002177642 | 95 |
| 76 | 3300005471 | Ga0070698_100233747 | Ga0070698_1002337472 | 95 |
| 77 | 3300005518 | Ga0070699_100019275 | Ga0070699_1000192754 | 95 |
| 78 | 3300005518 | Ga0070699_100020283 | Ga0070699_1000202837 | 95 |
| 79 | 3300005518 | Ga0070699_100285570 | Ga0070699_1002855704 | 95 |
| 80 | 3300005518 | Ga0070699_101013101 | Ga0070699_1010131012 | 95 |
| 81 | 3300005535 | Ga0070684_100001793 | Ga0070684_10000179310 | 95 |
| 82 | 3300005535 | Ga0070684_100776726 | Ga0070684_1007767262 | 95 |
| 83 | 3300005535 | Ga0070684_101541618 | Ga0070684_1015416181 | 95 |
| 84 | 3300005535 | Ga0070684_101993680 | Ga0070684_1019936802 | 95 |
| 85 | 3300005536 | Ga0070697_100060031 | Ga0070697_1000600312 | 95 |
| 86 | 3300005536 | Ga0070697_100072876 | Ga0070697_1000728762 | 95 |
| 87 | 3300005536 | Ga0070697_100121862 | Ga0070697_1001218625 | 95 |
| 88 | 3300005539 | Ga0068853_100196868 | Ga0068853_1001968681 | 95 |
| 89 | 3300005543 | Ga0070672_100234560 | Ga0070672_1002345602 | 95 |
| 90 | 3300005549 | Ga0070704_101297533 | Ga0070704_1012975331 | 95 |
| 91 | 3300005577 | Ga0068857_100025018 | Ga0068857_1000250184 | 95 |
| 92 | 3300005578 | Ga0068854_100019615 | Ga0068854_1000196152 | 95 |
| 93 | 3300005578 | Ga0068854_100036345 | Ga0068854_1000363452 | 95 |
| 94 | 3300005615 | Ga0070702_100098061 | Ga0070702_1000980613 | 95 |
| 95 | 3300005615 | Ga0070702_100206695 | Ga0070702_1002066952 | 95 |
| 96 | 3300005615 | Ga0070702_100772565 | Ga0070702_1007725651 | 95 |
| 97 | 3300005616 | Ga0068852_101577132 | Ga0068852_1015771322 | 95 |
| 98 | 3300005718 | Ga0068866_11358045 | Ga0068866_113580452 | 95 |
| 99 | 3300005834 | Ga0068851_10147140 | Ga0068851_101471402 | 95 |
| 100 | 3300005840 | Ga0068870_10084259 | Ga0068870_100842594 | 95 |
| 101 | 3300006028 | Ga0070717_11342392 | Ga0070717_113423922 | 95 |
| 102 | 3300006173 | Ga0070716_100115959 | Ga0070716_1001159594 | 95 |
| 103 | 3300006173 | Ga0070716_100634340 | Ga0070716_1006343402 | 95 |
| 104 | 3300006847 | Ga0075431_100022923 | Ga0075431_1000229231 | 95 |
| 105 | 3300006847 | Ga0075431_100934577 | Ga0075431_1009345772 | 95 |
| 106 | 3300006871 | Ga0075434_100597205 | Ga0075434_1005972052 | 95 |
| 107 | 3300006871 | Ga0075434_101032224 | Ga0075434_1010322242 | 95 |
| 108 | 3300006871 | Ga0075434_101113428 | Ga0075434_1011134282 | 95 |
| 109 | 3300006880 | Ga0075429_100704961 | Ga0075429_1007049612 | 95 |
| 110 | 3300006880 | Ga0075429_100977745 | Ga0075429_1009777451 | 95 |
| 111 | 3300006914 | Ga0075436_100675955 | Ga0075436_1006759551 | 95 |
| 112 | 3300007076 | Ga0075435_100022079 | Ga0075435_1000220795 | 95 |
| 113 | 3300007076 | Ga0075435_100163179 | Ga0075435_1001631793 | 95 |
| 114 | 3300009093 | Ga0105240_10103556 | Ga0105240_101035566 | 95 |
| 115 | 3300009094 | Ga0111539_10000054 | Ga0111539_1000005455 | 95 |
| 116 | 3300009098 | Ga0105245_10000066 | Ga0105245_1000006621 | 95 |
| 117 | 3300009098 | Ga0105245_10000927 | Ga0105245_1000092714 | 95 |
| 118 | 3300009098 | Ga0105245_10325386 | Ga0105245_103253862 | 95 |
| 119 | 3300009098 | Ga0105245_10547048 | Ga0105245_105470482 | 95 |
| 120 | 3300009098 | Ga0105245_11011912 | Ga0105245_110119122 | 95 |
| 121 | 3300009147 | Ga0114129_10057312 | Ga0114129_100573126 | 95 |
| 122 | 3300009148 | Ga0105243_13093161 | Ga0105243_130931612 | 95 |
| 123 | 3300009176 | Ga0105242_10812501 | Ga0105242_108125013 | 95 |
| 124 | 3300009551 | Ga0105238_10000001 | Ga0105238_100000011164 | 95 |
| 125 | 3300010375 | Ga0105239_10091582 | Ga0105239_100915822 | 95 |
| 126 | 3300011119 | Ga0105246_11493983 | Ga0105246_114939832 | 95 |
| 127 | 3300013105 | Ga0157369_10002844 | Ga0157369_1000284420 | 95 |
| 128 | 3300013105 | Ga0157369_10717035 | Ga0157369_107170352 | 95 |
| 129 | 3300013296 | Ga0157374_10000021 | Ga0157374_10000021229 | 95 |
| 130 | 3300013297 | Ga0157378_10000572 | Ga0157378_1000057219 | 95 |
| 131 | 3300013297 | Ga0157378_10002268 | Ga0157378_1000226810 | 95 |
| 132 | 3300013297 | Ga0157378_10097853 | Ga0157378_100978534 | 95 |
| 133 | 3300013297 | Ga0157378_11351852 | Ga0157378_113518522 | 95 |
| 134 | 3300013306 | Ga0163162_10011697 | Ga0163162_100116975 | 95 |
| 135 | 3300013308 | Ga0157375_10000004 | Ga0157375_1000000460 | 95 |
| 136 | 3300013308 | Ga0157375_10001181 | Ga0157375_1000118112 | 95 |
| 137 | 3300014745 | Ga0157377_10000009 | Ga0157377_10000009282 | 95 |
| 138 | 3300014745 | Ga0157377_10000227 | Ga0157377_1000022710 | 95 |
| 139 | 3300014969 | Ga0157376_10000020 | Ga0157376_10000020194 | 95 |
| 140 | 3300014969 | Ga0157376_11886349 | Ga0157376_118863491 | 95 |
| 141 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002989 | 95 |
| 142 | 3300021358 | Ga0213873_10010945 | Ga0213873_100109452 | 95 |
| 143 | 3300021377 | Ga0213874_10129073 | Ga0213874_101290732 | 95 |
| 144 | 3300021384 | Ga0213876_10000010 | Ga0213876_100000107 | 95 |
| 145 | 3300021384 | Ga0213876_10000012 | Ga0213876_1000001289 | 95 |
| 146 | 3300021384 | Ga0213876_10011520 | Ga0213876_100115206 | 95 |
| 147 | 3300021384 | Ga0213876_10014326 | Ga0213876_100143265 | 95 |
| 148 | 3300021384 | Ga0213876_10021085 | Ga0213876_100210855 | 95 |
| 149 | 3300025321 | Ga0207656_10134488 | Ga0207656_101344882 | 95 |
| 150 | 3300025907 | Ga0207645_10095234 | Ga0207645_100952342 | 95 |
| 151 | 3300025908 | Ga0207643_10020905 | Ga0207643_100209051 | 95 |
| 152 | 3300025909 | Ga0207705_10075892 | Ga0207705_100758922 | 95 |
| 153 | 3300025910 | Ga0207684_10042915 | Ga0207684_100429152 | 95 |
| 154 | 3300025910 | Ga0207684_10154391 | Ga0207684_101543912 | 95 |
| 155 | 3300025910 | Ga0207684_10318112 | Ga0207684_103181122 | 95 |
| 156 | 3300025918 | Ga0207662_10001051 | Ga0207662_100010517 | 95 |
| 157 | 3300025922 | Ga0207646_10065175 | Ga0207646_100651752 | 95 |
| 158 | 3300025922 | Ga0207646_10078318 | Ga0207646_100783185 | 95 |
| 159 | 3300025922 | Ga0207646_11160760 | Ga0207646_111607602 | 95 |
| 160 | 3300025922 | Ga0207646_11637010 | Ga0207646_116370102 | 95 |
| 161 | 3300025923 | Ga0207681_10864028 | Ga0207681_108640282 | 95 |
| 162 | 3300025924 | Ga0207694_10000001 | Ga0207694_100000012202 | 95 |
| 163 | 3300025925 | Ga0207650_10000088 | Ga0207650_10000088107 | 95 |
| 164 | 3300025925 | Ga0207650_11799498 | Ga0207650_117994982 | 95 |
| 165 | 3300025927 | Ga0207687_10000003 | Ga0207687_10000003756 | 95 |
| 166 | 3300025927 | Ga0207687_10000157 | Ga0207687_1000015740 | 95 |
| 167 | 3300025927 | Ga0207687_10134220 | Ga0207687_101342201 | 95 |
| 168 | 3300025928 | Ga0207700_10960483 | Ga0207700_109604832 | 95 |
| 169 | 3300025934 | Ga0207686_10046476 | Ga0207686_100464763 | 95 |
| 170 | 3300025936 | Ga0207670_10278038 | Ga0207670_102780381 | 95 |
| 171 | 3300025936 | Ga0207670_10302036 | Ga0207670_103020362 | 95 |
| 172 | 3300025936 | Ga0207670_10552952 | Ga0207670_105529522 | 95 |
| 173 | 3300025937 | Ga0207669_11041211 | Ga0207669_110412112 | 95 |
| 174 | 3300025939 | Ga0207665_10531966 | Ga0207665_105319662 | 95 |
| 175 | 3300025940 | Ga0207691_11333026 | Ga0207691_113330262 | 95 |
| 176 | 3300025942 | Ga0207689_10003419 | Ga0207689_1000341912 | 95 |
| 177 | 3300025942 | Ga0207689_10450026 | Ga0207689_104500262 | 95 |
| 178 | 3300025942 | Ga0207689_11074150 | Ga0207689_110741502 | 95 |
| 179 | 3300025944 | Ga0207661_10000001 | Ga0207661_1000000125 | 95 |
| 180 | 3300025981 | Ga0207640_10006779 | Ga0207640_100067798 | 95 |
| 181 | 3300025981 | Ga0207640_10013881 | Ga0207640_100138814 | 95 |
| 182 | 3300025981 | Ga0207640_10098382 | Ga0207640_100983822 | 95 |
| 183 | 3300025981 | Ga0207640_10585221 | Ga0207640_105852212 | 95 |
| 184 | 3300026023 | Ga0207677_10000009 | Ga0207677_1000000923 | 95 |
| 185 | 3300026041 | Ga0207639_10000003 | Ga0207639_1000000379 | 95 |
| 186 | 3300026041 | Ga0207639_10283447 | Ga0207639_102834474 | 95 |
| 187 | 3300026075 | Ga0207708_10000001 | Ga0207708_10000001434 | 95 |
| 188 | 3300026116 | Ga0207674_10013030 | Ga0207674_100130305 | 95 |
| 189 | 3300026142 | Ga0207698_11598749 | Ga0207698_115987492 | 95 |
| 190 | 3300027907 | Ga0207428_10000581 | Ga0207428_1000058139 | 95 |
| 191 | 3300030521 | Ga0307511_10008320 | Ga0307511_100083205 | 95 |
| 192 | 3300031548 | Ga0307408_102435970 | Ga0307408_1024359701 | 95 |
| 193 | 3300031852 | Ga0307410_11156690 | Ga0307410_111566902 | 95 |
| 194 | 3300031995 | Ga0307409_102000689 | Ga0307409_1020006891 | 95 |
| 195 | 3300031995 | Ga0307409_102242560 | Ga0307409_1022425602 | 95 |
| 196 | 3300032002 | Ga0307416_101730079 | Ga0307416_1017300792 | 95 |
| 197 | 3300032002 | Ga0307416_102135471 | Ga0307416_1021354712 | 95 |
| 198 | 3300032002 | Ga0307416_103818069 | Ga0307416_1038180691 | 95 |
| 199 | 3300032126 | Ga0307415_100449124 | Ga0307415_1004491242 | 95 |
| 200 | 3300032126 | Ga0307415_101989288 | Ga0307415_1019892881 | 95 |
| 201 | 3300035112 | Ga0373932_0001131 | Ga0373932_0001131_4484_4771 | 95 |
| 202 | 3300035115 | Ga0373941_0203088 | Ga0373941_0203088_247_534 | 95 |
| 203 | 3300035170 | Ga0373943_0109216 | Ga0373943_0109216_686_973 | 95 |
| 204 | 3300035691 | Ga0373931_0152827 | Ga0373931_0152827_791_1078 | 95 |
| 205 | 3300035725 | Ga0373947_0453494 | Ga0373947_0453494_229_516 | 95 |
| 206 | 3300035725 | Ga0373947_0979093 | Ga0373947_0979093_20_319 | 95 |
| 207 | 3300039437 | Ga0436365_0080501 | Ga0436365_0080501_3994_4281 | 95 |
| 208 | 3300039437 | Ga0436365_0120716 | Ga0436365_0120716_88581_88868 | 95 |
| 209 | 3300039437 | Ga0436365_0362725 | Ga0436365_0362725_2154_2441 | 95 |
| 210 | 3300039437 | Ga0436365_0404975 | Ga0436365_0404975_2073_2360 | 95 |
| 211 | 3300039437 | Ga0436365_1172437 | Ga0436365_1172437_4482_4769 | 95 |
| 212 | 3300039437 | Ga0436365_1576280 | Ga0436365_1576280_1223_1510 | 95 |
| 213 | 3300039450 | Ga0436363_0546122 | Ga0436363_0546122_159_446 | 95 |
| 214 | 3300039450 | Ga0436363_0726707 | Ga0436363_0726707_431_718 | 95 |
| 215 | 3300039450 | Ga0436363_0772335 | Ga0436363_0772335_27_314 | 95 |
| 216 | 3300039453 | Ga0436362_0178131 | Ga0436362_0178131_12081_12368 | 95 |
| 217 | 3300039453 | Ga0436362_0931096 | Ga0436362_0931096_1472_1759 | 95 |
| 218 | 3300041463 | Ga0451804_0178835 | Ga0451804_0178835_215_502 | 95 |
| 219 | 3300041496 | Ga0451839_0677481 | Ga0451839_0677481_1202_1489 | 95 |
| 220 | 3300041501 | Ga0451845_0527068 | Ga0451845_0527068_115_402 | 95 |
| 221 | 3300042876 | Ga0451577_0080083 | Ga0451577_0080083_1183_1476 | 95 |
| 222 | 3300042876 | Ga0451577_0349117 | Ga0451577_0349117_332_619 | 95 |
| 223 | 3300042876 | Ga0451577_0429242 | Ga0451577_0429242_759_1052 | 95 |
| 224 | 3300042876 | Ga0451577_1350826 | Ga0451577_1350826_322_615 | 95 |
| 225 | 3300044712 | Ga0453684_0851777 | Ga0453684_0851777_623_916 | 95 |
| 226 | 3300045051 | Ga0451576_0698931 | Ga0451576_0698931_64_357 | 95 |
| 227 | 3300045836 | Ga0466958_0841013 | Ga0466958_0841013_221_508 | 95 |
| 228 | 3300046515 | Ga0495620_0002789 | Ga0495620_0002789_6737_7024 | 95 |
| 229 | 3300046539 | Ga0495621_0262904 | Ga0495621_0262904_311_598 | 95 |
| 230 | 3300047446 | Ga0495679_083589 | Ga0495679_083589_109_396 | 95 |
| 231 | 3300048904 | Ga0496101_0600684 | Ga0496101_0600684_302_589 | 95 |
| 232 | 3300048915 | Ga0496112_1113206 | Ga0496112_1113206_145_432 | 95 |
| 233 | 3300049589 | Ga0501073_0003332 | Ga0501073_0003332_6363_6650 | 95 |
| 234 | 3300050508 | nmdc:mga09592_1134815_c1 | nmdc:mga09592_1134815_c1_103_390 | 95 |
| 235 | 3300050508 | nmdc:mga09592_609164_c1 | nmdc:mga09592_609164_c1_87_374 | 95 |
| 236 | 3300050510 | nmdc:mga06r32_439084_c1 | nmdc:mga06r32_439084_c1_359_646 | 95 |
| 237 | 3300050510 | nmdc:mga06r32_9428_c1 | nmdc:mga06r32_9428_c1_8451_8738 | 95 |
| 238 | 3300050511 | nmdc:mga08y16_28_c1 | nmdc:mga08y16_28_c1_122417_122704 | 95 |
| 239 | 3300050512 | nmdc:mga0n895_133918_c1 | nmdc:mga0n895_133918_c1_690_977 | 95 |
| 240 | 3300050512 | nmdc:mga0n895_239137_c1 | nmdc:mga0n895_239137_c1_915_1202 | 95 |
| 241 | 3300050512 | nmdc:mga0n895_769957_c1 | nmdc:mga0n895_769957_c1_174_461 | 95 |
| 242 | 3300050513 | nmdc:mga0rr50_153197_c1 | nmdc:mga0rr50_153197_c1_894_1181 | 95 |
| 243 | 3300050513 | nmdc:mga0rr50_20352_c1 | nmdc:mga0rr50_20352_c1_2127_2414 | 95 |
| 244 | 3300050513 | nmdc:mga0rr50_751092_c1 | nmdc:mga0rr50_751092_c1_57_344 | 95 |
| 245 | 3300050514 | nmdc:mga08x19_658600_c1 | nmdc:mga08x19_658600_c1_18_305 | 95 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.847 | 2 | 86 |
| 1r94-assembly1.cif.gz_A | crystal structure of isca (mercury derivative) | 0.8 | 1 | 90 |
| 2d2a-assembly2.cif.gz_B-2 | crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters | 0.7793 | 1 | 88 |
| 1x0g-assembly1.cif.gz_C | crystal structure of isca with the [2fe-2s] cluster | 0.7754 | 2 | 90 |
| 1s98-assembly1.cif.gz_A | e.coli isca crystal structure to 2.3 a | 0.7591 | 2 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O96161_49_160_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8873 | 2 | 85 | 2.60.300.12 |
| 1s98A00 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.847 | 2 | 86 | 2.60.300.12 |
| af_D4A4L5_49_154_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8344 | 2 | 90 | 2.60.300.12 |
| af_I3ITR1_24_129_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8316 | 2 | 86 | 2.60.300.12 |
| af_P78859_82_189_2.60.300.12 | Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain | 0.8219 | 2 | 90 | 2.60.300.12 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7WPT9-F1-model_v4 | FeS cluster biogenesis domain-containing protein | 0.9815 | 1 | 95 |
|
| AF-A0A7W0UK23-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.8909 | 1 | 84 |
|
| AF-A0A847BY98-F1-model_v4 | Iron-sulfur cluster biosynthesis family protein | 0.8897 | 2 | 84 |
|
| AF-A0A850PH24-F1-model_v4 | Iron-sulfur cluster assembly accessory protein | 0.8808 | 3 | 86 |
GO:0005737
GO:0016226 GO:0051537 GO:0097428 |
| AF-A0A1F4QCB2-F1-model_v4 | FeS cluster biogenesis domain-containing protein | 0.8803 | 2 | 94 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar