F357149

General Info

Members Datasets Scaffolds Average Seq Length
245 139 490 253

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100003082|Ga0070708_10000308213
Length 279
Sequence VLPAQPSGKRPLQRGARCVTLRPMRILVSNDDGIEAPGLRALAEGLLELGEVAVCAPDREQSATSRSISLHRPLRIEQLPPWGPDGQIQRWSVDGTPTDAVYIGLNQVLKGRAPDLVASGINRGPNLANDVHYSGTVAAAMEGCVGGVPSFAISQIKSRDYSHAARFAAALARQIGLHGLPPGTLLNVNVPPGAPQGAQIARIGKRTYVAAVVEKLDPRGRAYYWIGGDEQAHEHVPGSDCDAVFDRQLISVTPLHLDLTAHELVEELKRWELPGLVRD

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
105 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
137 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 1.22
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100003082 3300005445 Bacteria 12958
2 JGI25406J46586_10003843 3300003203 Bacteria 7020
3 Ga0065707_10015369 3300005295 Bacteria 1481
4 Ga0070658_10181883 3300005327 Bacteria 1769
5 Ga0070683_100000229 3300005329 Bacteria 38178
6 Ga0070670_100000294 3300005331 Bacteria 43861
7 Ga0070670_100065141 3300005331 Bacteria 3126
8 Ga0070670_100065476 3300005331 Bacteria 3118
9 Ga0068869_100019402 3300005334 Bacteria 4646
10 Ga0068869_100038859 3300005334 Bacteria 3395
11 Ga0070682_100024828 3300005337 Bacteria 3571
12 Ga0070682_100108192 3300005337 Bacteria 1848
13 Ga0068868_100005248 3300005338 Bacteria 9094
14 Ga0068868_100060106 3300005338 Bacteria 3008
15 Ga0070661_100071069 3300005344 Bacteria 2560
16 Ga0070692_10000319 3300005345 Bacteria 13814
17 Ga0070692_10175623 3300005345 Bacteria 1238
18 Ga0070668_100044651 3300005347 Bacteria 3399
19 Ga0070668_100144127 3300005347 Bacteria 1922
20 Ga0070669_100223884 3300005353 Unclassified 1488
21 Ga0070673_100406038 3300005364 Bacteria 1219
22 Ga0070659_100058388 3300005366 Bacteria 3044
23 Ga0070705_100002817 3300005440 Bacteria 8672
24 Ga0070700_100119252 3300005441 Unclassified 1765
25 Ga0070662_100026857 3300005457 Unclassified 3990
26 Ga0070681_10111743 3300005458 Bacteria 2671
27 Ga0070706_100302994 3300005467 Unclassified 1491
28 Ga0070707_100408579 3300005468 Bacteria 1318
29 Ga0070698_100025609 3300005471 Bacteria 6148
30 Ga0070698_100028601 3300005471 Bacteria 5789
31 Ga0070698_100136295 3300005471 Bacteria 2408
32 Ga0070699_100016203 3300005518 Bacteria 6398
33 Ga0070699_100070540 3300005518 Bacteria 3038
34 Ga0070699_100578657 3300005518 Unclassified 1023
35 Ga0070684_100007934 3300005535 Bacteria 8284
36 Ga0070684_100544827 3300005535 Bacteria 1076
37 Ga0070697_100014049 3300005536 Bacteria 6290
38 Ga0070697_100126855 3300005536 Bacteria 2138
39 Ga0070697_100447278 3300005536 Bacteria 1125
40 Ga0070686_100010860 3300005544 Bacteria 5152
41 Ga0070696_100000573 3300005546 Bacteria 23505
42 Ga0070693_100172443 3300005547 Bacteria 1387
43 Ga0070704_100003218 3300005549 Bacteria 9339
44 Ga0068855_100141373 3300005563 Bacteria 2743
45 Ga0070664_100049430 3300005564 Bacteria 3556
46 Ga0068857_100024418 3300005577 Bacteria 5321
47 Ga0068854_100021182 3300005578 Bacteria 4410
48 Ga0068864_100872881 3300005618 Unclassified 887
49 Ga0068861_100055926 3300005719 Bacteria 3010
50 Ga0068861_100232002 3300005719 Bacteria 1566
51 Ga0068870_10234147 3300005840 Bacteria 1131
52 Ga0068860_100710437 3300005843 Unclassified 1015
53 Ga0068862_100243282 3300005844 Bacteria 1637
54 Ga0081455_10012874 3300005937 Bacteria 8302
55 Ga0081455_10311808 3300005937 Unclassified 1124
56 Ga0081539_10000022 3300005985 Bacteria 356710
57 Ga0070716_100069521 3300006173 Bacteria 2064
58 Ga0070716_100081320 3300006173 Bacteria 1934
59 Ga0097621_100332114 3300006237 Bacteria 1349
60 Ga0075428_100011764 3300006844 Bacteria 9742
61 Ga0075428_100646010 3300006844 Bacteria 1128
62 Ga0075431_100040804 3300006847 Bacteria 4784
63 Ga0075431_100113685 3300006847 Bacteria 2794
64 Ga0075433_10044983 3300006852 Bacteria 3836
65 Ga0075433_10092790 3300006852 Viruses 2671
66 Ga0075433_10157017 3300006852 Bacteria 2024
67 Ga0075434_100092574 3300006871 Unclassified 3026
68 Ga0075434_100147798 3300006871 Bacteria 2370
69 Ga0068865_100186650 3300006881 Unclassified 1600
70 Ga0075436_100026556 3300006914 Bacteria 3987
71 Ga0075435_100493015 3300007076 Bacteria 1059
72 Ga0099794_10000555 3300007265 Bacteria 12514
73 Ga0111539_10015915 3300009094 Bacteria 9341
74 Ga0111539_10047877 3300009094 Bacteria 5108
75 Ga0111539_10135810 3300009094 Bacteria 2880
76 Ga0105245_10000033 3300009098 Bacteria 148617
77 Ga0105245_10048819 3300009098 Bacteria 3787
78 Ga0114129_10005148 3300009147 Bacteria 18405
79 Ga0114129_10262992 3300009147 Bacteria 2311
80 Ga0114129_10751097 3300009147 Bacteria 1249
81 Ga0105237_10296089 3300009545 Bacteria 1621
82 Ga0105238_10000005 3300009551 Bacteria 372840
83 Ga0105249_10001430 3300009553 Bacteria 20929
84 Ga0105249_10099537 3300009553 Bacteria 2733
85 Ga0105249_10129747 3300009553 Bacteria 2405
86 Ga0105239_10035696 3300010375 Bacteria 5458
87 Ga0157373_10062498 3300013100 Bacteria 2637
88 Ga0157369_10000036 3300013105 Bacteria 190875
89 Ga0157369_10144228 3300013105 Bacteria 2518
90 Ga0157374_10000006 3300013296 Bacteria 640284
91 Ga0157374_10629111 3300013296 Bacteria 1084
92 Ga0157378_10000374 3300013297 Bacteria 44264
93 Ga0157378_10004276 3300013297 Bacteria 12580
94 Ga0157378_10285494 3300013297 Bacteria 1592
95 Ga0163162_10000027 3300013306 Bacteria 178451
96 Ga0163162_10016787 3300013306 Bacteria 7158
97 Ga0163162_10119799 3300013306 Unclassified 2735
98 Ga0157372_10120928 3300013307 Bacteria 3007
99 Ga0157375_10000064 3300013308 Bacteria 112951
100 Ga0157375_10000427 3300013308 Bacteria 38132
101 Ga0157375_10858593 3300013308 Bacteria 1054
102 Ga0157375_11067411 3300013308 Bacteria 944
103 Ga0157380_10102942 3300014326 Unclassified 2382
104 Ga0157380_10309531 3300014326 Bacteria 1459
105 Ga0157380_10388067 3300014326 Bacteria 1320
106 Ga0157377_10000003 3300014745 Bacteria 435133
107 Ga0157376_10000009 3300014969 Bacteria 340244
108 Ga0213873_10002579 3300021358 Bacteria 3154
109 Ga0213876_10000028 3300021384 Bacteria 222108
110 Ga0213876_10000527 3300021384 Bacteria 29161
111 Ga0213876_10022807 3300021384 Bacteria 3307
112 Ga0213876_10102984 3300021384 Bacteria 1513
113 Ga0207699_10105666 3300025906 Bacteria 1796
114 Ga0207684_10181562 3300025910 Bacteria 1815
115 Ga0207707_10055647 3300025912 Bacteria 3441
116 Ga0207657_10122028 3300025919 Bacteria 2143
117 Ga0207652_10325604 3300025921 Bacteria 1387
118 Ga0207694_10000001 3300025924 Bacteria 4078485
119 Ga0207650_10000091 3300025925 Bacteria 117116
120 Ga0207650_10021267 3300025925 Bacteria 4586
121 Ga0207687_10000006 3300025927 Bacteria 641680
122 Ga0207687_10068139 3300025927 Bacteria 2534
123 Ga0207690_10178031 3300025932 Bacteria 1599
124 Ga0207706_10199602 3300025933 Bacteria 1754
125 Ga0207706_10789881 3300025933 Unclassified 807
126 Ga0207665_10149906 3300025939 Bacteria 1670
127 Ga0207689_10011161 3300025942 Bacteria 7709
128 Ga0207661_10000006 3300025944 Bacteria 537727
129 Ga0207651_10293331 3300025960 Bacteria 1349
130 Ga0207712_10000956 3300025961 Bacteria 20827
131 Ga0207712_10066414 3300025961 Bacteria 2578
132 Ga0207712_10331522 3300025961 Bacteria 1259
133 Ga0207668_10032036 3300025972 Bacteria 3469
134 Ga0207640_10002698 3300025981 Bacteria 9504
135 Ga0207640_10018825 3300025981 Bacteria 4065
136 Ga0207640_10136205 3300025981 Bacteria 1783
137 Ga0207677_10000211 3300026023 Bacteria 46566
138 Ga0207677_10080747 3300026023 Bacteria 2331
139 Ga0207677_10135898 3300026023 Bacteria 1874
140 Ga0207708_10084531 3300026075 Unclassified 2440
141 Ga0207641_10516815 3300026088 Bacteria 1161
142 Ga0207674_10045184 3300026116 Bacteria 4532
143 Ga0207675_100001995 3300026118 Bacteria 20351
144 Ga0207675_100084465 3300026118 Bacteria 2979
145 Ga0207428_10071376 3300027907 Bacteria 2727
146 Ga0268265_10407066 3300028380 Bacteria 1259
147 Ga0268264_10222993 3300028381 Bacteria 1736
148 Ga0268264_10584965 3300028381 Unclassified 1099
149 Ga0265324_10072549 3300029957 Bacteria 1173
150 Ga0307511_10019082 3300030521 Bacteria 6534
151 Ga0265316_10029629 3300031344 Bacteria 4497
152 Ga0316579_10003249 3300031691 Bacteria 6301
153 Ga0307411_10285545 3300032005 Bacteria 1316
154 Ga0373928_0031946 3300035084 Unclassified 1171
155 Ga0373931_0011430 3300035691 Bacteria 4290
156 Ga0436365_0510114 3300039437 Bacteria 55431
157 Ga0436365_1688827 3300039437 Bacteria 1465
158 Ga0436363_1199412 3300039450 Bacteria 1360
159 Ga0436362_0430309 3300039453 Bacteria 4292
160 Ga0451839_0693054 3300041496 Bacteria 2639
161 Ga0451577_0000035 3300042876 Bacteria 373467
162 Ga0451577_0002063 3300042876 Bacteria 24808
163 Ga0451577_0021120 3300042876 Bacteria 5963
164 Ga0451577_0066502 3300042876 Bacteria 3215
165 Ga0451577_0084519 3300042876 Bacteria 2832
166 Ga0451577_0125961 3300042876 Bacteria 2295
167 Ga0451577_0240100 3300042876 Bacteria 1639
168 Ga0451577_0241141 3300042876 Bacteria 1636
169 Ga0451577_0628048 3300042876 Bacteria 974
170 Ga0451577_0870268 3300042876 Unclassified 812
171 Ga0453683_0000028 3300044673 Bacteria 247877
172 Ga0453683_0000030 3300044673 Bacteria 242193
173 Ga0453683_0013046 3300044673 Bacteria 5433
174 Ga0453683_0038491 3300044673 Bacteria 3007
175 Ga0453683_0093113 3300044673 Bacteria 1889
176 Ga0453683_0128176 3300044673 Bacteria 1598
177 Ga0453684_0000097 3300044712 Bacteria 377772
178 Ga0453684_0004714 3300044712 Bacteria 28208
179 Ga0453684_0006109 3300044712 Bacteria 23215
180 Ga0453684_0012581 3300044712 Bacteria 13925
181 Ga0453684_0018881 3300044712 Bacteria 10547
182 Ga0453684_0020888 3300044712 Bacteria 9827
183 Ga0453684_0024637 3300044712 Bacteria 8780
184 Ga0453684_0060862 3300044712 Bacteria 4851
185 Ga0453684_0106125 3300044712 Bacteria 3424
186 Ga0453684_0123167 3300044712 Bacteria 3126
187 Ga0453684_0210925 3300044712 Bacteria 2257
188 Ga0453684_0241477 3300044712 Bacteria 2079
189 Ga0453684_0407570 3300044712 Bacteria 1521
190 Ga0453684_0585077 3300044712 Bacteria 1225
191 Ga0466957_0229690 3300044842 Unclassified 1228
192 Ga0466957_0347472 3300044842 Unclassified 1006
193 Ga0451576_0000223 3300045051 Bacteria 139383
194 Ga0451576_0000316 3300045051 Bacteria 116978
195 Ga0451576_0003669 3300045051 Bacteria 20837
196 Ga0451576_0019304 3300045051 Bacteria 7441
197 Ga0451576_0020188 3300045051 Bacteria 7259
198 Ga0451576_0089862 3300045051 Bacteria 3194
199 Ga0451576_0170648 3300045051 Bacteria 2270
200 Ga0451576_0218907 3300045051 Bacteria 1988
201 Ga0495629_0236939 3300046459 Bacteria 1257
202 Ga0495582_0027295 3300046473 Bacteria 3128
203 Ga0495644_0026197 3300046523 Bacteria 2213
204 Ga0495657_0230417 3300046675 Bacteria 1121
205 Ga0495658_0029640 3300046683 Bacteria 2965
206 Ga0495658_0121743 3300046683 Bacteria 1579
207 Ga0496103_0387107 3300048906 Unclassified 898
208 Ga0496104_0155603 3300048907 Bacteria 2194
209 Ga0496109_0000277 3300048912 Bacteria 49066
210 Ga0501036_0132020 3300049572 Bacteria 2108
211 Ga0501038_0224330 3300049574 Bacteria 1498
212 Ga0501040_0019243 3300049576 Bacteria 4542
213 Ga0501040_0197298 3300049576 Bacteria 1429
214 Ga0501040_0254541 3300049576 Bacteria 1253
215 Ga0501041_0313235 3300049577 Bacteria 989
216 Ga0501042_0007902 3300049578 Bacteria 6996
217 Ga0501076_0002009 3300049592 Bacteria 13914
218 Ga0501076_0238963 3300049592 Unclassified 1486
219 Ga0501079_0119471 3300049741 Bacteria 2049
220 Ga0501081_0031986 3300049743 Bacteria 3567
221 Ga0501045_0173913 3300049824 Unclassified 1604
222 nmdc:mga05p37_162073_c1 3300050507 Bacteria 2731
223 nmdc:mga05p37_18327_c1 3300050507 Bacteria 8455
224 nmdc:mga05p37_556922_c1 3300050507 Bacteria 1304
225 nmdc:mga06r32_109640_c1 3300050510 Bacteria 2715
226 nmdc:mga06r32_389189_c1 3300050510 Bacteria 1377
227 nmdc:mga06r32_447011_c1 3300050510 Bacteria 1272
228 nmdc:mga06r32_47146_c1 3300050510 Bacteria 4115
229 nmdc:mga08y16_34880_c1 3300050511 Bacteria 5286
230 nmdc:mga08y16_39911_c1 3300050511 Bacteria 4924
231 nmdc:mga08y16_45566_c1 3300050511 Bacteria 4595
232 nmdc:mga0n895_148772_c1 3300050512 Unclassified 2371
233 nmdc:mga0n895_22673_c1 3300050512 Bacteria 5888
234 nmdc:mga0n895_432251_c1 3300050512 Bacteria 1330
235 nmdc:mga0rr50_503467_c1 3300050513 Bacteria 1030
236 nmdc:mga08x19_130769_c1 3300050514 Bacteria 1688
237 nmdc:mga08x19_20724_c1 3300050514 Bacteria 4051
238 nmdc:mga0a205_10130_c1 3300050515 Bacteria 5193
239 nmdc:mga0a205_38042_c1 3300050515 Bacteria 4628
240 Ga0500641_0066416 3300053096 Unclassified 1511
241 Ga0500555_027448 3300053103 Bacteria 1624
242 Ga0500617_147337 3300053124 Bacteria 936
243 Ga0501084_0005362 3300054114 Bacteria 10508
244 Ga0501082_0009679 3300060353 Bacteria 8299
245 Ga0501082_0187389 3300060353 Bacteria 1800
246 Ga0070708_100003082
247 JGI25406J46586_10003843
248 Ga0065707_10015369
249 Ga0070658_10181883
250 Ga0070683_100000229
251 Ga0070670_100000294
252 Ga0070670_100065141
253 Ga0070670_100065476
254 Ga0068869_100019402
255 Ga0068869_100038859
256 Ga0070682_100024828
257 Ga0070682_100108192
258 Ga0068868_100005248
259 Ga0068868_100060106
260 Ga0070661_100071069
261 Ga0070692_10000319
262 Ga0070692_10175623
263 Ga0070668_100044651
264 Ga0070668_100144127
265 Ga0070669_100223884
266 Ga0070673_100406038
267 Ga0070659_100058388
268 Ga0070705_100002817
269 Ga0070700_100119252
270 Ga0070662_100026857
271 Ga0070681_10111743
272 Ga0070706_100302994
273 Ga0070707_100408579
274 Ga0070698_100025609
275 Ga0070698_100028601
276 Ga0070698_100136295
277 Ga0070699_100016203
278 Ga0070699_100070540
279 Ga0070699_100578657
280 Ga0070684_100007934
281 Ga0070684_100544827
282 Ga0070697_100014049
283 Ga0070697_100126855
284 Ga0070697_100447278
285 Ga0070686_100010860
286 Ga0070696_100000573
287 Ga0070693_100172443
288 Ga0070704_100003218
289 Ga0068855_100141373
290 Ga0070664_100049430
291 Ga0068857_100024418
292 Ga0068854_100021182
293 Ga0068864_100872881
294 Ga0068861_100055926
295 Ga0068861_100232002
296 Ga0068870_10234147
297 Ga0068860_100710437
298 Ga0068862_100243282
299 Ga0081455_10012874
300 Ga0081455_10311808
301 Ga0081539_10000022
302 Ga0070716_100069521
303 Ga0070716_100081320
304 Ga0097621_100332114
305 Ga0075428_100011764
306 Ga0075428_100646010
307 Ga0075431_100040804
308 Ga0075431_100113685
309 Ga0075433_10044983
310 Ga0075433_10092790
311 Ga0075433_10157017
312 Ga0075434_100092574
313 Ga0075434_100147798
314 Ga0068865_100186650
315 Ga0075436_100026556
316 Ga0075435_100493015
317 Ga0099794_10000555
318 Ga0111539_10015915
319 Ga0111539_10047877
320 Ga0111539_10135810
321 Ga0105245_10000033
322 Ga0105245_10048819
323 Ga0114129_10005148
324 Ga0114129_10262992
325 Ga0114129_10751097
326 Ga0105237_10296089
327 Ga0105238_10000005
328 Ga0105249_10001430
329 Ga0105249_10099537
330 Ga0105249_10129747
331 Ga0105239_10035696
332 Ga0157373_10062498
333 Ga0157369_10000036
334 Ga0157369_10144228
335 Ga0157374_10000006
336 Ga0157374_10629111
337 Ga0157378_10000374
338 Ga0157378_10004276
339 Ga0157378_10285494
340 Ga0163162_10000027
341 Ga0163162_10016787
342 Ga0163162_10119799
343 Ga0157372_10120928
344 Ga0157375_10000064
345 Ga0157375_10000427
346 Ga0157375_10858593
347 Ga0157375_11067411
348 Ga0157380_10102942
349 Ga0157380_10309531
350 Ga0157380_10388067
351 Ga0157377_10000003
352 Ga0157376_10000009
353 Ga0213873_10002579
354 Ga0213876_10000028
355 Ga0213876_10000527
356 Ga0213876_10022807
357 Ga0213876_10102984
358 Ga0207699_10105666
359 Ga0207684_10181562
360 Ga0207707_10055647
361 Ga0207657_10122028
362 Ga0207652_10325604
363 Ga0207694_10000001
364 Ga0207650_10000091
365 Ga0207650_10021267
366 Ga0207687_10000006
367 Ga0207687_10068139
368 Ga0207690_10178031
369 Ga0207706_10199602
370 Ga0207706_10789881
371 Ga0207665_10149906
372 Ga0207689_10011161
373 Ga0207661_10000006
374 Ga0207651_10293331
375 Ga0207712_10000956
376 Ga0207712_10066414
377 Ga0207712_10331522
378 Ga0207668_10032036
379 Ga0207640_10002698
380 Ga0207640_10018825
381 Ga0207640_10136205
382 Ga0207677_10000211
383 Ga0207677_10080747
384 Ga0207677_10135898
385 Ga0207708_10084531
386 Ga0207641_10516815
387 Ga0207674_10045184
388 Ga0207675_100001995
389 Ga0207675_100084465
390 Ga0207428_10071376
391 Ga0268265_10407066
392 Ga0268264_10222993
393 Ga0268264_10584965
394 Ga0265324_10072549
395 Ga0307511_10019082
396 Ga0265316_10029629
397 Ga0316579_10003249
398 Ga0307411_10285545
399 Ga0373928_0031946
400 Ga0373931_0011430
401 Ga0436365_0510114
402 Ga0436365_1688827
403 Ga0436363_1199412
404 Ga0436362_0430309
405 Ga0451839_0693054
406 Ga0451577_0000035
407 Ga0451577_0002063
408 Ga0451577_0021120
409 Ga0451577_0066502
410 Ga0451577_0084519
411 Ga0451577_0125961
412 Ga0451577_0240100
413 Ga0451577_0241141
414 Ga0451577_0628048
415 Ga0451577_0870268
416 Ga0453683_0000028
417 Ga0453683_0000030
418 Ga0453683_0013046
419 Ga0453683_0038491
420 Ga0453683_0093113
421 Ga0453683_0128176
422 Ga0453684_0000097
423 Ga0453684_0004714
424 Ga0453684_0006109
425 Ga0453684_0012581
426 Ga0453684_0018881
427 Ga0453684_0020888
428 Ga0453684_0024637
429 Ga0453684_0060862
430 Ga0453684_0106125
431 Ga0453684_0123167
432 Ga0453684_0210925
433 Ga0453684_0241477
434 Ga0453684_0407570
435 Ga0453684_0585077
436 Ga0466957_0229690
437 Ga0466957_0347472
438 Ga0451576_0000223
439 Ga0451576_0000316
440 Ga0451576_0003669
441 Ga0451576_0019304
442 Ga0451576_0020188
443 Ga0451576_0089862
444 Ga0451576_0170648
445 Ga0451576_0218907
446 Ga0495629_0236939
447 Ga0495582_0027295
448 Ga0495644_0026197
449 Ga0495657_0230417
450 Ga0495658_0029640
451 Ga0495658_0121743
452 Ga0496103_0387107
453 Ga0496104_0155603
454 Ga0496109_0000277
455 Ga0501036_0132020
456 Ga0501038_0224330
457 Ga0501040_0019243
458 Ga0501040_0197298
459 Ga0501040_0254541
460 Ga0501041_0313235
461 Ga0501042_0007902
462 Ga0501076_0002009
463 Ga0501076_0238963
464 Ga0501079_0119471
465 Ga0501081_0031986
466 Ga0501045_0173913
467 nmdc:mga05p37_162073_c1
468 nmdc:mga05p37_18327_c1
469 nmdc:mga05p37_556922_c1
470 nmdc:mga06r32_109640_c1
471 nmdc:mga06r32_389189_c1
472 nmdc:mga06r32_447011_c1
473 nmdc:mga06r32_47146_c1
474 nmdc:mga08y16_34880_c1
475 nmdc:mga08y16_39911_c1
476 nmdc:mga08y16_45566_c1
477 nmdc:mga0n895_148772_c1
478 nmdc:mga0n895_22673_c1
479 nmdc:mga0n895_432251_c1
480 nmdc:mga0rr50_503467_c1
481 nmdc:mga08x19_130769_c1
482 nmdc:mga08x19_20724_c1
483 nmdc:mga0a205_10130_c1
484 nmdc:mga0a205_38042_c1
485 Ga0500641_0066416
486 Ga0500555_027448
487 Ga0500617_147337
488 Ga0501084_0005362
489 Ga0501082_0009679
490 Ga0501082_0187389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01975

SurE

Survival protein SurE

26

210

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zg5-assembly1.cif.gz_G structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus 0.9396 2 243
4zg5-assembly1.cif.gz_C structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus 0.9358 2 241
4zg5-assembly1.cif.gz_A structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus 0.9229 2 242
4zg5-assembly1.cif.gz_G structural and functional insights into survival endonuclease, an important virulence factor of brucella abortus 0.9177 2 243
1ilv-assembly2.cif.gz_B crystal structure analysis of the tm107 0.9036 2 244
ID Description Score Start End Superfamily
4qeaA00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.9226 2 242 3.40.1210.10
4qeaA00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.8976 2 242 3.40.1210.10
4xgbA00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.8889 2 244 3.40.1210.10
2wqkB00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.8678 3 244 3.40.1210.10
1ilvB00 Alpha Beta;3-Layer(aba) Sandwich;Stationary-phase Survival Protein Sure Homolog; Chain: A,;Survival protein SurE-like phosphatase/nucleotidase 0.8672 3 244 3.40.1210.10
ID Description Score Start End GO Terms
AF-A0A843RWE5-F1-model_v4 5'-nucleotidase (EC 3.1.3.5) 0.9715 2 121 GO:0000166
GO:0004309
GO:0005737
GO:0008253
GO:0008254
GO:0046872
AF-A0A7X8CUI0-F1-model_v4 5'-nucleotidase (EC 3.1.3.5) 0.971 2 129 GO:0004309
GO:0008253
GO:0008254
GO:0046872
AF-A0A5C7N312-F1-model_v4 5'-nucleotidase (EC 3.1.3.5) 0.9707 2 167 GO:0000166
GO:0004309
GO:0005737
GO:0008254
GO:0046872
GO:0106411
AF-A0A7V9DAP9-F1-model_v4 5'-nucleotidase (EC 3.1.3.5) 0.9692 2 96 GO:0000166
GO:0004309
GO:0005737
GO:0008253
GO:0008254
GO:0046872
AF-A0A356U3L7-F1-model_v4 deleted 0.9663 2 121

Map