F356885

General Info

Members Datasets Scaffolds Average Seq Length
244 178 488 100

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_816099_c1|nmdc:mga06z11_816099_c1_102_455
Length 117
Sequence MMIVRRQQPTGGKVARVFDRIRKYAGRFRGTGGAGXAEVPKRPERRAHNLFEAAAAYVAAHAEDDQDRIEEAAGWVSPEALSFGVSELACRAVLALARERDESPRTVARDLLGLPVA

Samples

Sample ID Description Type Environment
1 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
16 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
20 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
25 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
28 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
29 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
30 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
31 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
32 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
33 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
34 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
35 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
36 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
41 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
42 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
43 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
44 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
45 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
46 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
49 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
50 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
51 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
52 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
53 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
54 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
65 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
66 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
67 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
103 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
104 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
110 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
111 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
140 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
141 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
142 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
143 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
144 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
145 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
146 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
147 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
150 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
151 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
152 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
153 2643221647 Streptomyces sp. Root369 Isolate Unclassified
154 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
155 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
156 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
157 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
158 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
159 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
160 2808606448 Streptomyces sp. 193411 Isolate Unclassified
161 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
162 2867428634 Streptomyces sp. RP5T Isolate Unclassified
163 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
164 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
165 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
166 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
167 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
168 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
169 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
170 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
171 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
172 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
173 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
174 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
175 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
176 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
177 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
178 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.3
Metatranscriptomes 0.82
Isolates 11.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.3
Nodule 0.41
Rhizoplane 0.82
Rhizosphere 70.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06z11_816099_c1 3300050494 Bacteria 568
2 JGI24737J22298_10049377 3300001990 Bacteria 1280
3 JGI24738J21930_10006560 3300002075 Bacteria 2724
4 rootH1_10009792 3300003316 Bacteria 5248
5 rootH1_10070384 3300003316 Bacteria 1064
6 rootH1_10084770 3300003316 Bacteria 1246
7 rootH2_10034945 3300003320 Bacteria 3631
8 rootH1_10005364 3300003323 Bacteria 16242
9 Ga0006562J51391_1144267 3300003578 Bacteria 2120
10 Ga0006562J51391_1144268 3300003578 Bacteria 800
11 Ga0068855_102089217 3300005563 Bacteria 571
12 Ga0068854_100167485 3300005578 Bacteria 1707
13 Ga0081455_10363866 3300005937 Bacteria 1016
14 Ga0075368_10002663 3300006042 Bacteria 5873
15 Ga0075368_10209981 3300006042 Bacteria 825
16 Ga0075363_100027472 3300006048 Bacteria 2918
17 Ga0075363_100359216 3300006048 Bacteria 852
18 Ga0075367_10001623 3300006178 Bacteria 9771
19 Ga0075367_11044409 3300006178 Bacteria 522
20 Ga0075370_10271250 3300006353 Bacteria 1007
21 Ga0075370_10297804 3300006353 Bacteria 959
22 Ga0099826_10136528 3300006948 Bacteria 1423
23 Ga0105244_10219613 3300009036 Bacteria 892
24 Ga0105246_10069544 3300011119 Bacteria 2473
25 Ga0182008_10016966 3300014497 Bacteria 3777
26 Ga0182007_10001664 3300015262 Bacteria 11770
27 Ga0207647_10030522 3300025904 Bacteria 3475
28 Ga0207667_10907010 3300025949 Bacteria 873
29 Ga0207640_11172514 3300025981 Bacteria 682
30 Ga0207674_10554884 3300026116 Bacteria 1110
31 Ga0209813_10014615 3300027866 Bacteria 2116
32 Ga0209813_10129038 3300027866 Bacteria 887
33 Ga0307517_10001103 3300028786 Bacteria 45619
34 Ga0307515_10000524 3300028794 Bacteria 91311
35 Ga0307515_10499525 3300028794 Bacteria 827
36 Ga0307511_10035228 3300030521 Bacteria 4374
37 Ga0307509_10178006 3300031507 Bacteria 1996
38 Ga0307508_10015003 3300031616 Bacteria 7063
39 Ga0307514_10001124 3300031649 Bacteria 37073
40 Ga0307514_10206586 3300031649 Bacteria 1225
41 Ga0307516_10002535 3300031730 Bacteria 24316
42 Ga0307518_10043173 3300031838 Bacteria 3282
43 Ga0307518_10125625 3300031838 Bacteria 1810
44 Ga0307507_10008621 3300033179 Bacteria 14001
45 Ga0307507_10019776 3300033179 Bacteria 7569
46 Ga0307507_10558702 3300033179 Bacteria 601
47 Ga0307510_10007905 3300033180 Bacteria 12665
48 Ga0373945_0526986 3300035116 Bacteria 528
49 Ga0395899_0874246 3300037312 Bacteria 550
50 Ga0395898_0001831 3300037466 Bacteria 27409
51 Ga0395898_0499539 3300037466 Bacteria 1157
52 Ga0395905_0132140 3300037471 Bacteria 2348
53 Ga0395905_1665126 3300037471 Bacteria 543
54 Ga0395901_0263544 3300038443 Bacteria 1793
55 Ga0395901_1440666 3300038443 Bacteria 646
56 Ga0395901_2106058 3300038443 Bacteria 509
57 Ga0439436_0002819 3300041404 Bacteria 5266
58 Ga0439436_0004646 3300041404 Bacteria 4211
59 Ga0439438_092359 3300041405 Bacteria 737
60 Ga0439439_0017573 3300041406 Bacteria 1760
61 Ga0451839_0284865 3300041496 Bacteria 582
62 Ga0439433_0194389 3300041999 Bacteria 534
63 Ga0439442_072612 3300042002 Bacteria 733
64 Ga0439448_0009950 3300042005 Bacteria 2810
65 Ga0439448_0105782 3300042005 Bacteria 959
66 Ga0439449_0021507 3300042007 Bacteria 2414
67 Ga0439449_0053263 3300042007 Bacteria 1495
68 Ga0439449_0071267 3300042007 Bacteria 1280
69 Ga0439449_0207595 3300042007 Bacteria 733
70 Ga0439449_0390607 3300042007 Bacteria 528
71 Ga0439450_208701 3300042008 Bacteria 524
72 Ga0439454_055695 3300042011 Bacteria 677
73 Ga0439455_0117735 3300042012 Bacteria 743
74 Ga0439455_0125176 3300042012 Bacteria 722
75 Ga0439457_000715 3300042014 Bacteria 9841
76 Ga0439457_003363 3300042014 Bacteria 4365
77 Ga0439462_0035160 3300042015 Bacteria 1331
78 Ga0450903_000015 3300042138 Bacteria 34074
79 Ga0466972_0021678 3300044658 Bacteria 3202
80 Ga0466972_0068610 3300044658 Bacteria 1694
81 Ga0466972_0100926 3300044658 Bacteria 1365
82 Ga0466965_0309186 3300044683 Bacteria 859
83 Ga0466966_0017856 3300044684 Bacteria 4685
84 Ga0466966_0581273 3300044684 Bacteria 674
85 Ga0466961_0085302 3300044693 Bacteria 1997
86 Ga0466963_0049769 3300044694 Bacteria 2772
87 Ga0466964_0122980 3300044706 Bacteria 1172
88 Ga0466971_0219193 3300044719 Bacteria 901
89 Ga0466970_0020617 3300044765 Bacteria 3427
90 Ga0466970_0148955 3300044765 Bacteria 1292
91 Ga0466957_0188324 3300044842 Bacteria 1351
92 Ga0466960_0035306 3300044901 Bacteria 2335
93 Ga0466960_0093594 3300044901 Bacteria 1536
94 Ga0466959_0235291 3300045049 Bacteria 1267
95 Ga0466959_0526486 3300045049 Bacteria 798
96 Ga0466958_0231450 3300045836 Bacteria 1180
97 Ga0466967_0023080 3300045976 Bacteria 5092
98 Ga0495603_0000223 3300046455 Bacteria 29515
99 Ga0495603_0046161 3300046455 Bacteria 2596
100 Ga0495629_0000584 3300046459 Bacteria 29621
101 Ga0495629_0013800 3300046459 Bacteria 5828
102 Ga0495629_0014360 3300046459 Bacteria 5697
103 Ga0495638_0307035 3300046460 Bacteria 853
104 Ga0495638_0316620 3300046460 Bacteria 835
105 Ga0495651_0004370 3300046462 Bacteria 10819
106 Ga0495653_0498705 3300046463 Bacteria 759
107 Ga0495662_0000774 3300046476 Bacteria 15449
108 Ga0495662_0033799 3300046476 Bacteria 2470
109 Ga0495664_0002008 3300046477 Bacteria 10861
110 Ga0495585_0203768 3300046492 Bacteria 1006
111 Ga0495594_0005758 3300046499 Bacteria 6364
112 Ga0495594_0009648 3300046499 Bacteria 4991
113 Ga0495583_0145579 3300046506 Bacteria 984
114 Ga0495618_0048108 3300046514 Bacteria 2692
115 Ga0495630_0501719 3300046517 Bacteria 930
116 Ga0495630_0624776 3300046517 Bacteria 825
117 Ga0495632_0141722 3300046519 Bacteria 1115
118 Ga0495643_0194366 3300046522 Bacteria 978
119 Ga0495666_0173299 3300046526 Bacteria 997
120 Ga0495652_0007564 3300046529 Bacteria 10013
121 Ga0495640_0004913 3300046533 Bacteria 10623
122 Ga0495586_0153295 3300046535 Bacteria 1297
123 Ga0495587_0025475 3300046536 Bacteria 3614
124 Ga0495645_0009175 3300046543 Bacteria 6910
125 Ga0495622_0169519 3300046557 Bacteria 982
126 Ga0495622_0226207 3300046557 Bacteria 828
127 Ga0495633_0435165 3300046558 Bacteria 593
128 Ga0495633_0522788 3300046558 Bacteria 535
129 Ga0495668_0246175 3300046616 Bacteria 979
130 Ga0495634_0008506 3300046642 Bacteria 7629
131 Ga0495611_0255577 3300046648 Bacteria 812
132 Ga0495625_0019192 3300046660 Bacteria 5311
133 Ga0495625_0065027 3300046660 Bacteria 2572
134 Ga0495588_0003054 3300046674 Bacteria 7241
135 Ga0495588_0016597 3300046674 Bacteria 3560
136 Ga0495588_0046050 3300046674 Bacteria 2237
137 Ga0495657_0000837 3300046675 Bacteria 27220
138 Ga0495657_0023039 3300046675 Bacteria 4454
139 Ga0495646_0004911 3300046680 Bacteria 8447
140 Ga0495658_0021034 3300046683 Bacteria 3434
141 Ga0495613_0000820 3300046689 Bacteria 24062
142 Ga0495613_0001328 3300046689 Bacteria 18892
143 Ga0495613_0004081 3300046689 Bacteria 10913
144 Ga0495671_0077327 3300046692 Bacteria 1631
145 Ga0495649_0668167 3300046694 Bacteria 510
146 Ga0495589_0095646 3300046794 Bacteria 1441
147 Ga0495600_0000809 3300046809 Bacteria 16609
148 Ga0495581_0021016 3300047315 Bacteria 3786
149 Ga0495604_0004123 3300047317 Bacteria 11542
150 Ga0495604_0142314 3300047317 Bacteria 1712
151 Ga0495636_0006692 3300047318 Bacteria 4532
152 Ga0495636_0011702 3300047318 Bacteria 3476
153 Ga0495636_0071357 3300047318 Bacteria 1483
154 Ga0495674_0052554 3300047319 Bacteria 3585
155 Ga0495676_0002159 3300047321 Bacteria 17412
156 Ga0495676_0011179 3300047321 Bacteria 8113
157 Ga0495687_004777 3300047443 Bacteria 8949
158 Ga0495687_087061 3300047443 Bacteria 1206
159 Ga0495675_0027835 3300047444 Bacteria 3603
160 Ga0495685_001404 3300047447 Bacteria 7352
161 Ga0495685_002306 3300047447 Bacteria 5956
162 Ga0495685_013932 3300047447 Bacteria 2728
163 Ga0495685_053785 3300047447 Bacteria 1363
164 Ga0495681_0001081 3300047470 Bacteria 20717
165 Ga0495681_0380265 3300047470 Bacteria 531
166 Ga0495684_0120974 3300047471 Bacteria 1972
167 Ga0495686_0048597 3300047472 Bacteria 2674
168 Ga0495686_0211717 3300047472 Bacteria 1107
169 Ga0495593_0033475 3300047673 Bacteria 2798
170 Ga0495602_0119941 3300048088 Bacteria 2118
171 Ga0495614_0001149 3300048089 Bacteria 11343
172 Ga0495614_0001597 3300048089 Bacteria 9836
173 Ga0495614_0003031 3300048089 Bacteria 7483
174 Ga0496106_0013245 3300048909 Bacteria 6088
175 Ga0496113_0490230 3300048916 Bacteria 987
176 Ga0501032_0035705 3300049569 Bacteria 3397
177 Ga0501033_0003066 3300049570 Bacteria 13888
178 Ga0501034_0688474 3300049571 Bacteria 921
179 Ga0501034_0719928 3300049571 Bacteria 895
180 Ga0501036_0185936 3300049572 Bacteria 1748
181 Ga0501038_0005122 3300049574 Bacteria 12174
182 Ga0501039_0327659 3300049575 Bacteria 1204
183 Ga0501043_0023419 3300049579 Bacteria 4844
184 Ga0501043_0266812 3300049579 Bacteria 1315
185 Ga0501047_0107559 3300049581 Bacteria 2670
186 Ga0501047_0269989 3300049581 Bacteria 1547
187 Ga0501070_0363257 3300049586 Bacteria 1174
188 Ga0501072_1269622 3300049588 Bacteria 571
189 Ga0501199_050391 3300049650 Bacteria 561
190 Ga0501035_0094665 3300049822 Bacteria 2626
191 Ga0501035_0112785 3300049822 Bacteria 2382
192 Ga0501035_0851340 3300049822 Bacteria 725
193 Ga0501044_0586801 3300049823 Bacteria 1008
194 nmdc:mga03n38_19709_c1 3300050490 Bacteria 2684
195 nmdc:mga06z11_418877_c1 3300050494 Bacteria 807
196 nmdc:mga06z11_825_c1 3300050494 Bacteria 11343
197 nmdc:mga04h51_1299_c1 3300050495 Bacteria 5763
198 nmdc:mga07m45_234380_c1 3300050496 Bacteria 1068
199 nmdc:mga07m45_415319_c1 3300050496 Bacteria 781
200 Ga0500610_0165853 3300053079 Bacteria 1095
201 Ga0495595_0683122 3300053084 Bacteria 526
202 Ga0495619_0019717 3300053085 Bacteria 4290
203 Ga0500578_0070937 3300053086 Bacteria 2221
204 Ga0500644_0089016 3300053088 Bacteria 1151
205 Ga0500583_0028715 3300053092 Bacteria 2417
206 Ga0500640_003301 3300053095 Bacteria 5598
207 Ga0500560_000186 3300053107 Bacteria 7321
208 Ga0500572_008511 3300053111 Bacteria 2402
209 Ga0500614_038949 3300053123 Bacteria 1200
210 Ga0500573_0040792 3300053140 Bacteria 2681
211 Ga0500577_0260244 3300053142 Bacteria 755
212 Ga0500624_001508 3300053157 Bacteria 3680
213 Ga0500633_0145473 3300053160 Bacteria 888
214 Ga0500636_0137886 3300053177 Bacteria 1353
215 Ga0466962_0074240 3300061719 Bacteria 1625
216 2554261210 2554235005 Bacteria 6457341
217 2585306634 2582581313 Bacteria 10042643
218 2616904341 2616644941 Bacteria 8510691
219 2644263499 2643221647 Bacteria 10741251
220 2644442160 2643221678 Bacteria 9540101
221 2784586415 2784132148 Bacteria 8627943
222 2785346208 2784746763 Bacteria 9783172
223 2786667793 2786546132 Bacteria 10419719
224 2808847234 2808606359 Bacteria 9866990
225 2808918041 2808606375 Bacteria 9466072
226 2809229918 2808606448 Bacteria 8656184
227 2812482691 2811994917 Bacteria 7761064
228 2867437521 2867428634 Bacteria 9590268
229 2877683804 2877676314 Bacteria 9512378
230 2912723018 2912715099 Bacteria 9460473
231 2912764784 2912757875 Bacteria 7940295
232 2919469915 2919468124 Bacteria 9133025
233 2946065252 2946064051 Bacteria 8957905
234 2947232196 2947224130 Bacteria 9938529
235 2954389110 2954380949 Bacteria 10050426
236 2954673933 2954673503 Bacteria 9685905
237 2954690058 2954682443 Bacteria 9862841
238 3006398338 3006393351 Bacteria 6615579
239 3006497034 3006493962 Bacteria 8825450
240 8008581101 8008574985 Bacteria 7815457
241 8023626017 8023623736 Bacteria 8593882
242 8025538395 8025530807 Bacteria 8495698
243 8048407376 8048406513 Bacteria 8936924
244 8054163260 8054160619 Bacteria 7783213
245 nmdc:mga06z11_816099_c1
246 JGI24737J22298_10049377
247 JGI24738J21930_10006560
248 rootH1_10009792
249 rootH1_10070384
250 rootH1_10084770
251 rootH2_10034945
252 rootH1_10005364
253 Ga0006562J51391_1144267
254 Ga0006562J51391_1144268
255 Ga0068855_102089217
256 Ga0068854_100167485
257 Ga0081455_10363866
258 Ga0075368_10002663
259 Ga0075368_10209981
260 Ga0075363_100027472
261 Ga0075363_100359216
262 Ga0075367_10001623
263 Ga0075367_11044409
264 Ga0075370_10271250
265 Ga0075370_10297804
266 Ga0099826_10136528
267 Ga0105244_10219613
268 Ga0105246_10069544
269 Ga0182008_10016966
270 Ga0182007_10001664
271 Ga0207647_10030522
272 Ga0207667_10907010
273 Ga0207640_11172514
274 Ga0207674_10554884
275 Ga0209813_10014615
276 Ga0209813_10129038
277 Ga0307517_10001103
278 Ga0307515_10000524
279 Ga0307515_10499525
280 Ga0307511_10035228
281 Ga0307509_10178006
282 Ga0307508_10015003
283 Ga0307514_10001124
284 Ga0307514_10206586
285 Ga0307516_10002535
286 Ga0307518_10043173
287 Ga0307518_10125625
288 Ga0307507_10008621
289 Ga0307507_10019776
290 Ga0307507_10558702
291 Ga0307510_10007905
292 Ga0373945_0526986
293 Ga0395899_0874246
294 Ga0395898_0001831
295 Ga0395898_0499539
296 Ga0395905_0132140
297 Ga0395905_1665126
298 Ga0395901_0263544
299 Ga0395901_1440666
300 Ga0395901_2106058
301 Ga0439436_0002819
302 Ga0439436_0004646
303 Ga0439438_092359
304 Ga0439439_0017573
305 Ga0451839_0284865
306 Ga0439433_0194389
307 Ga0439442_072612
308 Ga0439448_0009950
309 Ga0439448_0105782
310 Ga0439449_0021507
311 Ga0439449_0053263
312 Ga0439449_0071267
313 Ga0439449_0207595
314 Ga0439449_0390607
315 Ga0439450_208701
316 Ga0439454_055695
317 Ga0439455_0117735
318 Ga0439455_0125176
319 Ga0439457_000715
320 Ga0439457_003363
321 Ga0439462_0035160
322 Ga0450903_000015
323 Ga0466972_0021678
324 Ga0466972_0068610
325 Ga0466972_0100926
326 Ga0466965_0309186
327 Ga0466966_0017856
328 Ga0466966_0581273
329 Ga0466961_0085302
330 Ga0466963_0049769
331 Ga0466964_0122980
332 Ga0466971_0219193
333 Ga0466970_0020617
334 Ga0466970_0148955
335 Ga0466957_0188324
336 Ga0466960_0035306
337 Ga0466960_0093594
338 Ga0466959_0235291
339 Ga0466959_0526486
340 Ga0466958_0231450
341 Ga0466967_0023080
342 Ga0495603_0000223
343 Ga0495603_0046161
344 Ga0495629_0000584
345 Ga0495629_0013800
346 Ga0495629_0014360
347 Ga0495638_0307035
348 Ga0495638_0316620
349 Ga0495651_0004370
350 Ga0495653_0498705
351 Ga0495662_0000774
352 Ga0495662_0033799
353 Ga0495664_0002008
354 Ga0495585_0203768
355 Ga0495594_0005758
356 Ga0495594_0009648
357 Ga0495583_0145579
358 Ga0495618_0048108
359 Ga0495630_0501719
360 Ga0495630_0624776
361 Ga0495632_0141722
362 Ga0495643_0194366
363 Ga0495666_0173299
364 Ga0495652_0007564
365 Ga0495640_0004913
366 Ga0495586_0153295
367 Ga0495587_0025475
368 Ga0495645_0009175
369 Ga0495622_0169519
370 Ga0495622_0226207
371 Ga0495633_0435165
372 Ga0495633_0522788
373 Ga0495668_0246175
374 Ga0495634_0008506
375 Ga0495611_0255577
376 Ga0495625_0019192
377 Ga0495625_0065027
378 Ga0495588_0003054
379 Ga0495588_0016597
380 Ga0495588_0046050
381 Ga0495657_0000837
382 Ga0495657_0023039
383 Ga0495646_0004911
384 Ga0495658_0021034
385 Ga0495613_0000820
386 Ga0495613_0001328
387 Ga0495613_0004081
388 Ga0495671_0077327
389 Ga0495649_0668167
390 Ga0495589_0095646
391 Ga0495600_0000809
392 Ga0495581_0021016
393 Ga0495604_0004123
394 Ga0495604_0142314
395 Ga0495636_0006692
396 Ga0495636_0011702
397 Ga0495636_0071357
398 Ga0495674_0052554
399 Ga0495676_0002159
400 Ga0495676_0011179
401 Ga0495687_004777
402 Ga0495687_087061
403 Ga0495675_0027835
404 Ga0495685_001404
405 Ga0495685_002306
406 Ga0495685_013932
407 Ga0495685_053785
408 Ga0495681_0001081
409 Ga0495681_0380265
410 Ga0495684_0120974
411 Ga0495686_0048597
412 Ga0495686_0211717
413 Ga0495593_0033475
414 Ga0495602_0119941
415 Ga0495614_0001149
416 Ga0495614_0001597
417 Ga0495614_0003031
418 Ga0496106_0013245
419 Ga0496113_0490230
420 Ga0501032_0035705
421 Ga0501033_0003066
422 Ga0501034_0688474
423 Ga0501034_0719928
424 Ga0501036_0185936
425 Ga0501038_0005122
426 Ga0501039_0327659
427 Ga0501043_0023419
428 Ga0501043_0266812
429 Ga0501047_0107559
430 Ga0501047_0269989
431 Ga0501070_0363257
432 Ga0501072_1269622
433 Ga0501199_050391
434 Ga0501035_0094665
435 Ga0501035_0112785
436 Ga0501035_0851340
437 Ga0501044_0586801
438 nmdc:mga03n38_19709_c1
439 nmdc:mga06z11_418877_c1
440 nmdc:mga06z11_825_c1
441 nmdc:mga04h51_1299_c1
442 nmdc:mga07m45_234380_c1
443 nmdc:mga07m45_415319_c1
444 Ga0500610_0165853
445 Ga0495595_0683122
446 Ga0495619_0019717
447 Ga0500578_0070937
448 Ga0500644_0089016
449 Ga0500583_0028715
450 Ga0500640_003301
451 Ga0500560_000186
452 Ga0500572_008511
453 Ga0500614_038949
454 Ga0500573_0040792
455 Ga0500577_0260244
456 Ga0500624_001508
457 Ga0500633_0145473
458 Ga0500636_0137886
459 Ga0466962_0074240
460 2554261210
461 2585306634
462 2616904341
463 2644263499
464 2644442160
465 2784586415
466 2785346208
467 2786667793
468 2808847234
469 2808918041
470 2809229918
471 2812482691
472 2867437521
473 2877683804
474 2912723018
475 2912764784
476 2919469915
477 2946065252
478 2947232196
479 2954389110
480 2954673933
481 2954690058
482 3006398338
483 3006497034
484 8008581101
485 8023626017
486 8025538395
487 8048407376
488 8054163260

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cbj-assembly2.cif.gz_B structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase in complex with pugnac 0.7346 31 66
5hop-assembly1.cif.gz_B 1.65 angstrom resolution crystal structure of lmo0182 (residues 1-245) from listeria monocytogenes egd-e 0.7311 30 62
2v5d-assembly1.cif.gz_A structure of a family 84 glycoside hydrolase and a family 32 carbohydrate-binding module in tandem from clostridium perfringens. 0.722 31 67
7t8u-assembly1.cif.gz_C structure of psmbeta2 nanotubes 0.7162 31 70
4zxl-assembly1.cif.gz_A cpoga d298n in complex with drosophila hcf -derived thr-o-glcnac peptide 0.7135 31 67
ID Description Score Start End Superfamily
af_Q5N6W3_245_365_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9499 34 57 1.10.510.10
af_G5ED37_223_335_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.926 30 56 1.25.40.10
af_Q65XK6_107_230_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7848 30 62 1.25.40.10
af_P49373_1_79_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.7842 28 60 1.20.930.10
af_Q9V466_572_845_1.20.190.50 Mainly Alpha;Up-down Bundle;Delta-Endotoxin; domain 1; 0.7696 31 63 1.20.190.50
ID Description Score Start End GO Terms
AF-A0A2D3UKW2-F1-model_v4 deleted 0.9955 27 98
AF-A0A1A9QVE8-F1-model_v4 deleted 0.9903 27 98
AF-A0A6G4XGQ7-F1-model_v4 Uncharacterized protein 0.9835 24 98
AF-A0A239D170-F1-model_v4 ANTAR domain-containing protein 0.9818 27 98
AF-A0A1E5PI64-F1-model_v4 Uncharacterized protein 0.9802 27 98

Map