F356501

General Info

Members Datasets Scaffolds Average Seq Length
244 133 486 533

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10049148|Ga0157371_100491481
Length 596
Sequence MVQWRQEWGLERRVWLIPHFFLKDCKRKWLVIRRWGEKFRGMCFVNSTLMKNIFLYTVLISSLFAACQNAGSHGSTDENAAEAKKNISKRDYSINKSNSYSDLFLDSMAMEKFVASKKLPDSIARRMRSFYNTRNYQFAWFSSDGMNEQTYAFWNLHDYVTTYDNDTSLKDKKLQRRMDALVAEESLSPTASPDYVNTELTLTEHFIKYVLNNYEKGYVKRKEMERFIPFKKEDPLAVADSLLNKKHKDDKYFADVNEPYKGLKDQLGRYYNIAKAGGWPQITGLKKSLKKGASDPAIPVIKRRLEMTGEMVGKDSSMVFNDTLENAVRTFQTSMGYKPDGVINSQLIKDMNVPASERLKQILLNMGRMRWMPTEPNGRLIIVNIPEFVLHVYENKKKAWDMNVVVGKEGHNTTMFTGDLNQVVFSPYWNVPPSIVQKEILPKMASNPNYLASQNMEQTGTDENGVPKIRQLPGEKNSLGRVKFLFPNSFNIYFHDTNAKSLFDKDKRAFSHGCIRLSEPEKMAEYLLRDQPEWTPEKIEEAMDSGHEQYVKLKSPVPVIITYYTAWVDDNGLLNFRDDIYSHDKDLGSKMFVGGY

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
133 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 0
Rhizosphere 97.54
Stem 0
Stem Tuber 0
Unclassified 9.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10049148 3300013102 Bacteria 2996
2 rootL2_10175948 3300003322 Bacteria 2789
3 Ga0065712_10003464 3300005290 Bacteria 3661
4 Ga0065712_10078400 3300005290 Bacteria 3353
5 Ga0065712_10089284 3300005290 Bacteria 2478
6 Ga0070658_10014938 3300005327 Bacteria 6218
7 Ga0070658_10108641 3300005327 Bacteria 2296
8 Ga0070676_10010199 3300005328 Bacteria 5094
9 Ga0070683_100009958 3300005329 Bacteria 8151
10 Ga0070683_100055324 3300005329 Bacteria 3682
11 Ga0070690_100067285 3300005330 Unclassified 2321
12 Ga0070670_100005921 3300005331 Bacteria 10337
13 Ga0070670_100019954 3300005331 Bacteria 5754
14 Ga0070670_100054441 3300005331 Unclassified 3435
15 Ga0068869_100002949 3300005334 Bacteria 10331
16 Ga0068869_100034116 3300005334 Bacteria 3598
17 Ga0068869_100044536 3300005334 Bacteria 3191
18 Ga0068869_100129113 3300005334 Bacteria 1941
19 Ga0070666_10030486 3300005335 Bacteria 3553
20 Ga0070682_100010328 3300005337 Bacteria 5298
21 Ga0068868_100098256 3300005338 Bacteria 2367
22 Ga0070660_100075061 3300005339 Bacteria 2647
23 Ga0070689_100004257 3300005340 Bacteria 9644
24 Ga0070689_100049516 3300005340 Unclassified 3244
25 Ga0070689_100054829 3300005340 Bacteria 3087
26 Ga0070687_100010403 3300005343 Bacteria 4023
27 Ga0070661_100009185 3300005344 Bacteria 6834
28 Ga0070661_100020896 3300005344 Bacteria 4672
29 Ga0070668_100039523 3300005347 Bacteria 3608
30 Ga0070669_100004497 3300005353 Bacteria 10059
31 Ga0070669_100048847 3300005353 Bacteria 3089
32 Ga0070669_100066695 3300005353 Bacteria 2653
33 Ga0070669_100069559 3300005353 Bacteria 2600
34 Ga0070675_100034518 3300005354 Bacteria 4106
35 Ga0070671_100030183 3300005355 Bacteria 4473
36 Ga0070671_100033594 3300005355 Unclassified 4244
37 Ga0070674_100003809 3300005356 Bacteria 8525
38 Ga0070673_100039377 3300005364 Bacteria 3616
39 Ga0070688_100002831 3300005365 Bacteria 8833
40 Ga0070688_100004114 3300005365 Bacteria 7549
41 Ga0070659_100002903 3300005366 Bacteria 12209
42 Ga0070659_100023272 3300005366 Bacteria 4739
43 Ga0070701_10026706 3300005438 Bacteria 2819
44 Ga0070663_100019010 3300005455 Bacteria 4518
45 Ga0070678_100068313 3300005456 Bacteria 2649
46 Ga0068867_100011283 3300005459 Bacteria 6302
47 Ga0070685_10004480 3300005466 Bacteria 7066
48 Ga0070685_10037356 3300005466 Bacteria 2750
49 Ga0070698_100001241 3300005471 Bacteria 28439
50 Ga0070679_100000567 3300005530 Bacteria 31353
51 Ga0070679_100001843 3300005530 Bacteria 19045
52 Ga0070684_100000232 3300005535 Bacteria 38587
53 Ga0070684_100002304 3300005535 Bacteria 14083
54 Ga0070684_100044182 3300005535 Bacteria 3852
55 Ga0070684_100189179 3300005535 Bacteria 1873
56 Ga0068853_100009235 3300005539 Bacteria 7946
57 Ga0068853_100034647 3300005539 Bacteria 4286
58 Ga0068853_100068484 3300005539 Unclassified 3086
59 Ga0070686_100008636 3300005544 Bacteria 5708
60 Ga0070686_100012440 3300005544 Bacteria 4849
61 Ga0070686_100037387 3300005544 Bacteria 3011
62 Ga0068855_100006778 3300005563 Bacteria 13891
63 Ga0068855_100023018 3300005563 Bacteria 7467
64 Ga0070664_100005592 3300005564 Bacteria 10102
65 Ga0070664_100014649 3300005564 Bacteria 6401
66 Ga0070664_100041398 3300005564 Bacteria 3887
67 Ga0068854_100032188 3300005578 Bacteria 3646
68 Ga0068852_100000563 3300005616 Bacteria 24454
69 Ga0068852_100033038 3300005616 Bacteria 4291
70 Ga0068852_100034989 3300005616 Unclassified 4184
71 Ga0068852_100080199 3300005616 Bacteria 2893
72 Ga0068859_100033339 3300005617 Bacteria 5172
73 Ga0068864_100016548 3300005618 Bacteria 6138
74 Ga0068864_100036642 3300005618 Bacteria 4182
75 Ga0068864_100045766 3300005618 Bacteria 3754
76 Ga0068864_100103467 3300005618 Bacteria 2528
77 Ga0068861_100003382 3300005719 Bacteria 10578
78 Ga0068861_100041102 3300005719 Bacteria 3462
79 Ga0068861_100051998 3300005719 Bacteria 3112
80 Ga0068851_10007767 3300005834 Bacteria 4934
81 Ga0068870_10008556 3300005840 Unclassified 4609
82 Ga0068863_100052899 3300005841 Bacteria 3848
83 Ga0068863_100081458 3300005841 Bacteria 3066
84 Ga0068863_100219020 3300005841 Unclassified 1833
85 Ga0068858_100065077 3300005842 Bacteria 3373
86 Ga0068862_100062893 3300005844 Bacteria 3193
87 Ga0097621_100011779 3300006237 Bacteria 6458
88 Ga0097621_100018178 3300006237 Bacteria 5363
89 Ga0068871_100028172 3300006358 Bacteria 4401
90 Ga0068871_100037672 3300006358 Bacteria 3857
91 Ga0075428_100010044 3300006844 Bacteria 10516
92 Ga0097620_100033339 3300006931 Bacteria 5172
93 Ga0105240_10106591 3300009093 Bacteria 3399
94 Ga0111539_10061973 3300009094 Bacteria 4429
95 Ga0111539_10146352 3300009094 Bacteria 2766
96 Ga0111539_10190724 3300009094 Bacteria 2391
97 Ga0105247_10001867 3300009101 Bacteria 14743
98 Ga0114129_10005331 3300009147 Bacteria 18156
99 Ga0105242_10012376 3300009176 Bacteria 6567
100 Ga0105242_10041224 3300009176 Bacteria 3723
101 Ga0105248_10212964 3300009177 Bacteria 2177
102 Ga0105237_10002998 3300009545 Bacteria 20402
103 Ga0105249_10002678 3300009553 Bacteria 15401
104 Ga0157373_10010037 3300013100 Bacteria 6977
105 Ga0157373_10015777 3300013100 Bacteria 5515
106 Ga0157371_10000927 3300013102 Bacteria 32867
107 Ga0157371_10001581 3300013102 Bacteria 23381
108 Ga0157371_10038495 3300013102 Bacteria 3421
109 Ga0157371_10059177 3300013102 Unclassified 2716
110 Ga0157370_10001703 3300013104 Bacteria 27062
111 Ga0157370_10016943 3300013104 Bacteria 7366
112 Ga0157369_10092888 3300013105 Unclassified 3221
113 Ga0157369_10096306 3300013105 Bacteria 3158
114 Ga0157374_10003272 3300013296 Bacteria 13606
115 Ga0157378_10069997 3300013297 Bacteria 3149
116 Ga0157378_10118633 3300013297 Bacteria 2436
117 Ga0157378_10180312 3300013297 Bacteria 1986
118 Ga0163162_10006376 3300013306 Bacteria 11422
119 Ga0163162_10117299 3300013306 Bacteria 2763
120 Ga0157372_10003182 3300013307 Bacteria 17706
121 Ga0157372_10031363 3300013307 Bacteria 5820
122 Ga0157372_10034507 3300013307 Bacteria 5561
123 Ga0157372_10042920 3300013307 Bacteria 5005
124 Ga0157372_10099137 3300013307 Unclassified 3323
125 Ga0157372_10158904 3300013307 Bacteria 2611
126 Ga0157372_10207292 3300013307 Bacteria 2271
127 Ga0157375_10006759 3300013308 Bacteria 9988
128 Ga0157375_10039999 3300013308 Bacteria 4516
129 Ga0157375_10051164 3300013308 Bacteria 4056
130 Ga0163163_10021088 3300014325 Bacteria 6146
131 Ga0163163_10024152 3300014325 Bacteria 5783
132 Ga0163163_10025780 3300014325 Bacteria 5608
133 Ga0163163_10040361 3300014325 Unclassified 4557
134 Ga0157380_10009662 3300014326 Bacteria 6917
135 Ga0157377_10007687 3300014745 Bacteria 5222
136 Ga0157377_10013456 3300014745 Bacteria 4141
137 Ga0157377_10055903 3300014745 Bacteria 2239
138 Ga0157376_10026139 3300014969 Bacteria 4609
139 Ga0157376_10033933 3300014969 Bacteria 4114
140 Ga0157376_10063722 3300014969 Bacteria 3106
141 Ga0157376_10076114 3300014969 Bacteria 2866
142 Ga0157376_10117300 3300014969 Unclassified 2353
143 Ga0163161_10027717 3300017792 Bacteria 4019
144 Ga0163161_10063150 3300017792 Unclassified 2699
145 Ga0213876_10002922 3300021384 Bacteria 9906
146 Ga0207710_10001020 3300025900 Bacteria 14622
147 Ga0207647_10000017 3300025904 Bacteria 129999
148 Ga0207645_10040871 3300025907 Unclassified 2970
149 Ga0207643_10002262 3300025908 Bacteria 10493
150 Ga0207705_10003539 3300025909 Bacteria 11893
151 Ga0207705_10009571 3300025909 Bacteria 7049
152 Ga0207705_10061794 3300025909 Bacteria 2706
153 Ga0207660_10020786 3300025917 Bacteria 4411
154 Ga0207662_10003931 3300025918 Bacteria 7745
155 Ga0207662_10018199 3300025918 Bacteria 3982
156 Ga0207657_10122818 3300025919 Bacteria 2135
157 Ga0207649_10007677 3300025920 Bacteria 5867
158 Ga0207649_10021758 3300025920 Bacteria 3697
159 Ga0207652_10000029 3300025921 Bacteria 149054
160 Ga0207652_10001189 3300025921 Bacteria 23425
161 Ga0207681_10024666 3300025923 Bacteria 3861
162 Ga0207681_10077434 3300025923 Bacteria 2338
163 Ga0207650_10048970 3300025925 Unclassified 3118
164 Ga0207650_10050477 3300025925 Unclassified 3076
165 Ga0207659_10065556 3300025926 Bacteria 2632
166 Ga0207644_10033044 3300025931 Bacteria 3613
167 Ga0207644_10067375 3300025931 Bacteria 2609
168 Ga0207706_10009214 3300025933 Bacteria 9068
169 Ga0207686_10001766 3300025934 Bacteria 12028
170 Ga0207670_10004749 3300025936 Bacteria 7369
171 Ga0207670_10005483 3300025936 Bacteria 6970
172 Ga0207670_10040684 3300025936 Bacteria 3052
173 Ga0207669_10002707 3300025937 Bacteria 7584
174 Ga0207691_10014784 3300025940 Bacteria 7438
175 Ga0207691_10056461 3300025940 Bacteria 3576
176 Ga0207691_10071783 3300025940 Bacteria 3124
177 Ga0207689_10024182 3300025942 Bacteria 5096
178 Ga0207689_10027228 3300025942 Bacteria 4786
179 Ga0207689_10036641 3300025942 Bacteria 4072
180 Ga0207689_10039329 3300025942 Bacteria 3915
181 Ga0207661_10002840 3300025944 Bacteria 11968
182 Ga0207679_10013108 3300025945 Bacteria 5428
183 Ga0207667_10001484 3300025949 Bacteria 29439
184 Ga0207651_10160239 3300025960 Bacteria 1763
185 Ga0207712_10002600 3300025961 Bacteria 11579
186 Ga0207668_10052483 3300025972 Bacteria 2821
187 Ga0207658_10026325 3300025986 Unclassified 4078
188 Ga0207677_10116209 3300026023 Bacteria 2003
189 Ga0207708_10035730 3300026075 Bacteria 3782
190 Ga0207641_10033652 3300026088 Bacteria 4258
191 Ga0207641_10056616 3300026088 Bacteria 3333
192 Ga0207648_10018930 3300026089 Bacteria 6220
193 Ga0207648_10036897 3300026089 Bacteria 4305
194 Ga0207676_10049136 3300026095 Bacteria 3279
195 Ga0207676_10063150 3300026095 Bacteria 2940
196 Ga0207676_10118217 3300026095 Unclassified 2231
197 Ga0207674_10000755 3300026116 Bacteria 42269
198 Ga0207674_10012816 3300026116 Bacteria 9359
199 Ga0207675_100005880 3300026118 Bacteria 11706
200 Ga0207675_100039927 3300026118 Bacteria 4379
201 Ga0207683_10019022 3300026121 Bacteria 5862
202 Ga0207698_10006763 3300026142 Bacteria 7164
203 Ga0207698_10020334 3300026142 Bacteria 4567
204 Ga0207698_10037744 3300026142 Unclassified 3561
205 Ga0207698_10104244 3300026142 Bacteria 2359
206 Ga0207428_10105647 3300027907 Bacteria 2171
207 Ga0268264_10004926 3300028381 Bacteria 11311
208 Ga0265327_10000609 3300031251 Bacteria 59168
209 Ga0307410_10050244 3300031852 Bacteria 2803
210 Ga0307414_10056812 3300032004 Bacteria 2748
211 Ga0373924_0013460 3300035410 Bacteria 3075
212 Ga0395899_0002106 3300037312 Bacteria 16349
213 Ga0395899_0033692 3300037312 Bacteria 3846
214 Ga0395900_0001729 3300037418 Bacteria 25209
215 Ga0395900_0018207 3300037418 Bacteria 7165
216 Ga0395900_0049518 3300037418 Bacteria 4329
217 Ga0395900_0081906 3300037418 Bacteria 3315
218 Ga0395900_0182816 3300037418 Bacteria 2129
219 Ga0395898_0003753 3300037466 Bacteria 16827
220 Ga0395898_0003955 3300037466 Bacteria 16333
221 Ga0395898_0044566 3300037466 Bacteria 4365
222 Ga0395898_0064057 3300037466 Unclassified 3566
223 Ga0395905_0020312 3300037471 Bacteria 6292
224 Ga0395905_0085746 3300037471 Bacteria 2951
225 Ga0395901_0004807 3300038443 Bacteria 13629
226 Ga0395901_0016195 3300038443 Bacteria 7595
227 Ga0436365_0231318 3300039437 Bacteria 17390
228 Ga0436365_0476759 3300039437 Bacteria 33326
229 Ga0439449_0004653 3300042007 Bacteria 5298
230 Ga0439457_006400 3300042014 Bacteria 2889
231 Ga0451577_0055342 3300042876 Bacteria 3541
232 Ga0451577_0153012 3300042876 Bacteria 2076
233 Ga0495583_0015645 3300046506 Bacteria 4114
234 Ga0495628_0037710 3300046516 Bacteria 3874
235 Ga0495630_0060363 3300046517 Bacteria 2846
236 Ga0501034_0010041 3300049571 Bacteria 9886
237 Ga0501034_0024868 3300049571 Bacteria 6093
238 Ga0501043_0009096 3300049579 Bacteria 7812
239 Ga0501259_001418 3300049688 Bacteria 3985
240 Ga0501044_0152419 3300049823 Unclassified 2293
241 nmdc:mga05p37_38869_c1 3300050507 Bacteria 5837
242 Ga0500578_0000054 3300053086 Bacteria 121082
243 Ga0500568_0000511 3300053139 Bacteria 28633
244 Ga0157371_10049148
245 rootL2_10175948
246 Ga0065712_10003464
247 Ga0065712_10078400
248 Ga0065712_10089284
249 Ga0070658_10014938
250 Ga0070658_10108641
251 Ga0070676_10010199
252 Ga0070683_100009958
253 Ga0070683_100055324
254 Ga0070690_100067285
255 Ga0070670_100005921
256 Ga0070670_100019954
257 Ga0070670_100054441
258 Ga0068869_100002949
259 Ga0068869_100034116
260 Ga0068869_100044536
261 Ga0068869_100129113
262 Ga0070666_10030486
263 Ga0070682_100010328
264 Ga0068868_100098256
265 Ga0070660_100075061
266 Ga0070689_100004257
267 Ga0070689_100049516
268 Ga0070689_100054829
269 Ga0070687_100010403
270 Ga0070661_100009185
271 Ga0070661_100020896
272 Ga0070668_100039523
273 Ga0070669_100004497
274 Ga0070669_100048847
275 Ga0070669_100066695
276 Ga0070669_100069559
277 Ga0070675_100034518
278 Ga0070671_100030183
279 Ga0070671_100033594
280 Ga0070674_100003809
281 Ga0070673_100039377
282 Ga0070688_100002831
283 Ga0070688_100004114
284 Ga0070659_100002903
285 Ga0070659_100023272
286 Ga0070701_10026706
287 Ga0070663_100019010
288 Ga0070678_100068313
289 Ga0068867_100011283
290 Ga0070685_10004480
291 Ga0070685_10037356
292 Ga0070698_100001241
293 Ga0070679_100000567
294 Ga0070679_100001843
295 Ga0070684_100000232
296 Ga0070684_100002304
297 Ga0070684_100044182
298 Ga0070684_100189179
299 Ga0068853_100009235
300 Ga0068853_100034647
301 Ga0068853_100068484
302 Ga0070686_100008636
303 Ga0070686_100012440
304 Ga0070686_100037387
305 Ga0068855_100006778
306 Ga0068855_100023018
307 Ga0070664_100005592
308 Ga0070664_100014649
309 Ga0070664_100041398
310 Ga0068854_100032188
311 Ga0068852_100000563
312 Ga0068852_100033038
313 Ga0068852_100034989
314 Ga0068852_100080199
315 Ga0068859_100033339
316 Ga0068864_100016548
317 Ga0068864_100036642
318 Ga0068864_100045766
319 Ga0068864_100103467
320 Ga0068861_100003382
321 Ga0068861_100041102
322 Ga0068861_100051998
323 Ga0068851_10007767
324 Ga0068870_10008556
325 Ga0068863_100052899
326 Ga0068863_100081458
327 Ga0068863_100219020
328 Ga0068858_100065077
329 Ga0068862_100062893
330 Ga0097621_100011779
331 Ga0097621_100018178
332 Ga0068871_100028172
333 Ga0068871_100037672
334 Ga0075428_100010044
335 Ga0097620_100033339
336 Ga0105240_10106591
337 Ga0111539_10061973
338 Ga0111539_10146352
339 Ga0111539_10190724
340 Ga0105247_10001867
341 Ga0114129_10005331
342 Ga0105242_10012376
343 Ga0105242_10041224
344 Ga0105248_10212964
345 Ga0105237_10002998
346 Ga0105249_10002678
347 Ga0157373_10010037
348 Ga0157373_10015777
349 Ga0157371_10000927
350 Ga0157371_10001581
351 Ga0157371_10038495
352 Ga0157371_10059177
353 Ga0157370_10001703
354 Ga0157370_10016943
355 Ga0157369_10092888
356 Ga0157369_10096306
357 Ga0157374_10003272
358 Ga0157378_10069997
359 Ga0157378_10118633
360 Ga0157378_10180312
361 Ga0163162_10006376
362 Ga0163162_10117299
363 Ga0157372_10003182
364 Ga0157372_10031363
365 Ga0157372_10034507
366 Ga0157372_10042920
367 Ga0157372_10099137
368 Ga0157372_10158904
369 Ga0157372_10207292
370 Ga0157375_10006759
371 Ga0157375_10039999
372 Ga0157375_10051164
373 Ga0163163_10021088
374 Ga0163163_10024152
375 Ga0163163_10025780
376 Ga0163163_10040361
377 Ga0157380_10009662
378 Ga0157377_10007687
379 Ga0157377_10013456
380 Ga0157377_10055903
381 Ga0157376_10026139
382 Ga0157376_10033933
383 Ga0157376_10063722
384 Ga0157376_10076114
385 Ga0157376_10117300
386 Ga0163161_10027717
387 Ga0163161_10063150
388 Ga0213876_10002922
389 Ga0207710_10001020
390 Ga0207647_10000017
391 Ga0207645_10040871
392 Ga0207643_10002262
393 Ga0207705_10003539
394 Ga0207705_10009571
395 Ga0207705_10061794
396 Ga0207660_10020786
397 Ga0207662_10003931
398 Ga0207662_10018199
399 Ga0207657_10122818
400 Ga0207649_10007677
401 Ga0207649_10021758
402 Ga0207652_10000029
403 Ga0207652_10001189
404 Ga0207681_10024666
405 Ga0207681_10077434
406 Ga0207650_10048970
407 Ga0207650_10050477
408 Ga0207659_10065556
409 Ga0207644_10033044
410 Ga0207644_10067375
411 Ga0207706_10009214
412 Ga0207686_10001766
413 Ga0207670_10004749
414 Ga0207670_10005483
415 Ga0207670_10040684
416 Ga0207669_10002707
417 Ga0207691_10014784
418 Ga0207691_10056461
419 Ga0207691_10071783
420 Ga0207689_10024182
421 Ga0207689_10027228
422 Ga0207689_10036641
423 Ga0207689_10039329
424 Ga0207661_10002840
425 Ga0207679_10013108
426 Ga0207667_10001484
427 Ga0207651_10160239
428 Ga0207712_10002600
429 Ga0207668_10052483
430 Ga0207658_10026325
431 Ga0207677_10116209
432 Ga0207708_10035730
433 Ga0207641_10033652
434 Ga0207641_10056616
435 Ga0207648_10018930
436 Ga0207648_10036897
437 Ga0207676_10049136
438 Ga0207676_10063150
439 Ga0207676_10118217
440 Ga0207674_10000755
441 Ga0207674_10012816
442 Ga0207675_100005880
443 Ga0207675_100039927
444 Ga0207683_10019022
445 Ga0207698_10006763
446 Ga0207698_10020334
447 Ga0207698_10037744
448 Ga0207698_10104244
449 Ga0207428_10105647
450 Ga0268264_10004926
451 Ga0265327_10000609
452 Ga0307410_10050244
453 Ga0307414_10056812
454 Ga0373924_0013460
455 Ga0395899_0002106
456 Ga0395899_0033692
457 Ga0395900_0001729
458 Ga0395900_0018207
459 Ga0395900_0049518
460 Ga0395900_0081906
461 Ga0395900_0182816
462 Ga0395898_0003753
463 Ga0395898_0003955
464 Ga0395898_0044566
465 Ga0395898_0064057
466 Ga0395905_0020312
467 Ga0395905_0085746
468 Ga0395901_0004807
469 Ga0395901_0016195
470 Ga0436365_0231318
471 Ga0436365_0476759
472 Ga0439449_0004653
473 Ga0439457_006400
474 Ga0451577_0055342
475 Ga0451577_0153012
476 Ga0495583_0015645
477 Ga0495628_0037710
478 Ga0495630_0060363
479 Ga0501034_0010041
480 Ga0501034_0024868
481 Ga0501043_0009096
482 Ga0501259_001418
483 Ga0501044_0152419
484 nmdc:mga05p37_38869_c1
485 Ga0500578_0000054
486 Ga0500568_0000511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

378

561

0.91

PF20142

Scaffold

Scaffold domain

125

267

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ao7-assembly1.cif.gz_A crystal structure of sltb3 from pseudomonas aeruginosa in complex with nag-anhnam-pentapeptide 0.9172 242 294
6tci-assembly1.cif.gz_A the crystal structure of sleb n-terminal domain 0.9141 224 292
5tv7-assembly2.cif.gz_B 2.05 angstrom resolution crystal structure of peptidoglycan-binding protein from clostridioides difficile in complex with glutamine hydroxamate. 0.9023 228 293
3bkv-assembly1.cif.gz_A x-ray structure of the bacteriophage phikz lytic transglycosylase, gp144, in complex with chitotetraose, (nag)4 0.8637 225 292
5nm7-assembly1.cif.gz_G crystal structure of burkholderia ap3 phage endolysin 0.8545 227 292
ID Description Score Start End Superfamily
af_K7K641_72_302_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9332 232 290 3.40.390.10
af_I1N5Y3_46_297_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9217 230 290 3.40.390.10
af_I1J5F1_56_315_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9151 234 291 3.40.390.10
af_Q94LQ4_46_318_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9058 232 291 3.40.390.10
af_K7MVY1_43_328_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.9021 230 290 3.40.390.10
ID Description Score Start End GO Terms
AF-A0A4Q5YAF8-F1-model_v4 deleted 0.947 230 524
AF-A0A4Q1CNV7-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9434 200 534 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A3C0IN50-F1-model_v4 Murein L,D-transpeptidase 0.9428 205 533 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A4Q5YAF8-F1-model_v4 deleted 0.9408 230 524
AF-A0A4Q5T0S5-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.937 200 524 GO:0008360
GO:0009252
GO:0016740
GO:0071555

Map