F356481

General Info

Members Datasets Scaffolds Average Seq Length
244 144 488 320

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10082351|Ga0105248_100823511
Length 336
Sequence MPSLPRIRSRRAVPGGPVADTRPRVTELHSEGLTWVHCLAPTTEEAQQLAARFGWHPLDVEDVLSRRQRPKIDVYPEGENGASGYLFAVFHFPVYDAAAGRLEAAELDVFIGPDYIVTLPMIELRPVSYLFRRADENEDFRQKNLSLGSGRLLYEILDDLYDYCFPILDKIGLKLEEIDQEIGGDDRQSARDLVTDIHRVKQEIISYRKIIKPQRATLRVLERRIEDFLPEDLELYFDDIVDASERIWDILDNYKEVVEALEDTNESLISHQQNDILYVLTIFSVVMLPLTFLTGFFGMNVHFPGFDTAAGFIVTVGLFLVTIVGMLGFFRWKKWL

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.69
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 3.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10082351 3300009177 Bacteria 3618
2 JGI24738J21930_10006697 3300002075 Unclassified 2681
3 Ga0058863_11769670 3300004799 Bacteria 1298
4 Ga0070683_100004189 3300005329 Bacteria 11826
5 Ga0070683_100081577 3300005329 Bacteria 3028
6 Ga0070680_100015740 3300005336 Bacteria 5938
7 Ga0070680_100017317 3300005336 Bacteria 5679
8 Ga0070680_100034542 3300005336 Bacteria 4076
9 Ga0070682_100019175 3300005337 Bacteria 4008
10 Ga0070682_100041829 3300005337 Bacteria 2826
11 Ga0070661_100112440 3300005344 Bacteria 2034
12 Ga0070709_10035227 3300005434 Bacteria 3041
13 Ga0070714_100021064 3300005435 Bacteria 5330
14 Ga0070714_100114699 3300005435 Bacteria 2390
15 Ga0070713_100045605 3300005436 Bacteria 3593
16 Ga0070710_10005934 3300005437 Bacteria 5832
17 Ga0070711_100016204 3300005439 Bacteria 4730
18 Ga0070662_100154336 3300005457 Bacteria 1791
19 Ga0070681_10114155 3300005458 Bacteria 2640
20 Ga0070681_10212442 3300005458 Bacteria 1851
21 Ga0070698_100274157 3300005471 Bacteria 1618
22 Ga0070679_100212407 3300005530 Bacteria 1898
23 Ga0070686_100042558 3300005544 Bacteria 2846
24 Ga0070695_100071760 3300005545 Bacteria 2269
25 Ga0070704_100273895 3300005549 Bacteria 1395
26 Ga0081455_10007129 3300005937 Bacteria 11835
27 Ga0081455_10067265 3300005937 Bacteria 2986
28 Ga0081538_10060654 3300005981 Bacteria 2173
29 Ga0081539_10019852 3300005985 Bacteria 4577
30 Ga0070717_10024988 3300006028 Bacteria 4745
31 Ga0070716_100055850 3300006173 Bacteria 2261
32 Ga0070712_100029178 3300006175 Bacteria 3696
33 Ga0068871_100107229 3300006358 Bacteria 2346
34 Ga0075428_100065103 3300006844 Bacteria 3992
35 Ga0075428_100276823 3300006844 Bacteria 1805
36 Ga0075431_100057306 3300006847 Bacteria 4019
37 Ga0075435_100069779 3300007076 Unclassified 2867
38 Ga0111539_10121605 3300009094 Bacteria 3059
39 Ga0111539_10356743 3300009094 Bacteria 1702
40 Ga0114129_10226086 3300009147 Bacteria 2522
41 Ga0114129_10276327 3300009147 Bacteria 2246
42 Ga0105243_10024638 3300009148 Bacteria 4591
43 Ga0105248_10124604 3300009177 Bacteria 2907
44 Ga0157370_10072792 3300013104 Bacteria 3242
45 Ga0157369_10032243 3300013105 Bacteria 5764
46 Ga0157375_10114550 3300013308 Bacteria 2798
47 Ga0182008_10088653 3300014497 Bacteria 1524
48 Ga0207692_10014123 3300025898 Bacteria 3483
49 Ga0207699_10038470 3300025906 Bacteria 2742
50 Ga0207705_10034320 3300025909 Bacteria 3627
51 Ga0207707_10086990 3300025912 Bacteria 2731
52 Ga0207707_10246155 3300025912 Bacteria 1553
53 Ga0207660_10017952 3300025917 Bacteria 4711
54 Ga0207660_10024623 3300025917 Bacteria 4077
55 Ga0207657_10017732 3300025919 Bacteria 6817
56 Ga0207652_10149040 3300025921 Bacteria 2094
57 Ga0207659_10171883 3300025926 Unclassified 1710
58 Ga0207664_10006665 3300025929 Bacteria 7962
59 Ga0207664_10029604 3300025929 Bacteria 4172
60 Ga0207665_10001100 3300025939 Bacteria 18216
61 Ga0207711_10425791 3300025941 Bacteria 1235
62 Ga0207661_10102955 3300025944 Bacteria 2402
63 Ga0207661_10434177 3300025944 Bacteria 1194
64 Ga0207667_10186765 3300025949 Bacteria 2127
65 Ga0207677_10079767 3300026023 Bacteria 2342
66 Ga0207675_100020331 3300026118 Bacteria 6189
67 Ga0207428_10021140 3300027907 Bacteria 5512
68 Ga0207428_10022783 3300027907 Bacteria 5279
69 Ga0265334_10021551 3300028573 Bacteria 2632
70 Ga0265322_10028404 3300028654 Bacteria 1598
71 Ga0265338_10051631 3300028800 Bacteria 3699
72 Ga0265320_10068221 3300031240 Bacteria 1681
73 Ga0265329_10027987 3300031242 Bacteria 1850
74 Ga0265340_10098265 3300031247 Bacteria 1363
75 Ga0265331_10126366 3300031250 Bacteria 1168
76 Ga0265327_10038746 3300031251 Bacteria 2597
77 Ga0265313_10006664 3300031595 Bacteria 8099
78 Ga0265314_10022134 3300031711 Bacteria 4872
79 Ga0265342_10080097 3300031712 Bacteria 1888
80 Ga0307409_100047756 3300031995 Bacteria 3252
81 Ga0316583_10028412 3300032133 Bacteria 1995
82 Ga0373943_0067349 3300035170 Bacteria 1806
83 Ga0395899_0055996 3300037312 Bacteria 2915
84 Ga0395899_0097431 3300037312 Bacteria 2126
85 Ga0395899_0253320 3300037312 Bacteria 1207
86 Ga0395900_0009702 3300037418 Bacteria 9865
87 Ga0395900_0052831 3300037418 Bacteria 4182
88 Ga0395900_0059629 3300037418 Bacteria 3929
89 Ga0395900_0203331 3300037418 Bacteria 2003
90 Ga0395898_0001107 3300037466 Bacteria 41584
91 Ga0395898_0049705 3300037466 Bacteria 4108
92 Ga0395898_0069700 3300037466 Bacteria 3402
93 Ga0395898_0136053 3300037466 Bacteria 2353
94 Ga0395898_0147109 3300037466 Bacteria 2255
95 Ga0395898_0243840 3300037466 Bacteria 1714
96 Ga0395898_0434829 3300037466 Bacteria 1250
97 Ga0395905_0221139 3300037471 Bacteria 1772
98 Ga0395905_0330949 3300037471 Bacteria 1414
99 Ga0395901_0002293 3300038443 Bacteria 19499
100 Ga0395901_0059814 3300038443 Bacteria 3964
101 Ga0395901_0113142 3300038443 Bacteria 2850
102 Ga0395901_0457559 3300038443 Bacteria 1304
103 Ga0436360_0752468 3300039438 Bacteria 9657
104 Ga0439438_010270 3300041405 Bacteria 2970
105 Ga0439439_0069758 3300041406 Bacteria 940
106 Ga0439465_0125529 3300041413 Bacteria 903
107 Ga0439434_0006327 3300042435 Bacteria 3453
108 Ga0466964_0005274 3300044706 Bacteria 4793
109 Ga0466957_0057014 3300044842 Bacteria 2390
110 Ga0466960_0035558 3300044901 Bacteria 2329
111 Ga0466967_0000518 3300045976 Bacteria 18756
112 Ga0466967_0007161 3300045976 Bacteria 8011
113 Ga0495592_0080589 3300046454 Bacteria 2355
114 Ga0495651_0014157 3300046462 Bacteria 6165
115 Ga0495653_0027923 3300046463 Bacteria 4517
116 Ga0495582_0204982 3300046473 Bacteria 1126
117 Ga0495608_0045490 3300046511 Bacteria 2925
118 Ga0495618_0162904 3300046514 Bacteria 1421
119 Ga0495630_0021041 3300046517 Bacteria 4816
120 Ga0495630_0034586 3300046517 Bacteria 3773
121 Ga0495644_0087326 3300046523 Bacteria 1176
122 Ga0495640_0028415 3300046533 Bacteria 4027
123 Ga0495640_0221599 3300046533 Bacteria 1193
124 Ga0495645_0072805 3300046543 Bacteria 2476
125 Ga0495634_0007192 3300046642 Bacteria 8392
126 Ga0495657_0036508 3300046675 Bacteria 3396
127 Ga0495658_0060658 3300046683 Bacteria 2170
128 Ga0495649_0067213 3300046694 Bacteria 1923
129 Ga0495604_0064464 3300047317 Bacteria 2792
130 Ga0495674_0009681 3300047319 Bacteria 9147
131 Ga0495680_0016932 3300047322 Bacteria 6242
132 Ga0496101_0013544 3300048904 Bacteria 5468
133 Ga0496102_0045097 3300048905 Bacteria 4002
134 Ga0496104_0172158 3300048907 Bacteria 2076
135 Ga0496110_0094710 3300048913 Bacteria 2674
136 Ga0496114_0146546 3300048917 Bacteria 2047
137 Ga0496114_0186183 3300048917 Bacteria 1814
138 Ga0496114_0290958 3300048917 Bacteria 1441
139 Ga0496115_0002681 3300048918 Bacteria 12765
140 Ga0496115_0291272 3300048918 Unclassified 1339
141 Ga0501031_0008333 3300049568 Bacteria 6744
142 Ga0501031_0019218 3300049568 Bacteria 4448
143 Ga0501031_0026427 3300049568 Bacteria 3784
144 Ga0501032_0052838 3300049569 Unclassified 2737
145 Ga0501032_0133856 3300049569 Bacteria 1634
146 Ga0501036_0008264 3300049572 Bacteria 8532
147 Ga0501036_0039902 3300049572 Bacteria 3971
148 Ga0501036_0097481 3300049572 Bacteria 2485
149 Ga0501036_0125182 3300049572 Bacteria 2170
150 Ga0501036_0232103 3300049572 Bacteria 1548
151 Ga0501037_0008826 3300049573 Bacteria 7385
152 Ga0501038_0013714 3300049574 Bacteria 7388
153 Ga0501038_0040516 3300049574 Bacteria 4067
154 Ga0501039_0002901 3300049575 Bacteria 12830
155 Ga0501039_0004158 3300049575 Bacteria 10896
156 Ga0501039_0015857 3300049575 Bacteria 5769
157 Ga0501039_0044249 3300049575 Bacteria 3438
158 Ga0501039_0119442 3300049575 Bacteria 2065
159 Ga0501040_0009618 3300049576 Bacteria 6309
160 Ga0501040_0033227 3300049576 Bacteria 3493
161 Ga0501040_0117170 3300049576 Bacteria 1866
162 Ga0501040_0325935 3300049576 Bacteria 1099
163 Ga0501041_0004014 3300049577 Bacteria 8495
164 Ga0501041_0007712 3300049577 Bacteria 6315
165 Ga0501041_0023700 3300049577 Bacteria 3680
166 Ga0501041_0101117 3300049577 Bacteria 1784
167 Ga0501041_0105642 3300049577 Bacteria 1745
168 Ga0501042_0004806 3300049578 Bacteria 8635
169 Ga0501042_0027412 3300049578 Bacteria 4006
170 Ga0501042_0045733 3300049578 Bacteria 3120
171 Ga0501042_0054593 3300049578 Bacteria 2850
172 Ga0501046_0007255 3300049580 Bacteria 9746
173 Ga0501046_0024648 3300049580 Bacteria 4930
174 Ga0501048_0004045 3300049582 Bacteria 11160
175 Ga0501048_0006289 3300049582 Bacteria 9028
176 Ga0501048_0015799 3300049582 Bacteria 5570
177 Ga0501067_0011756 3300049583 Bacteria 4848
178 Ga0501068_0001000 3300049584 Bacteria 14881
179 Ga0501068_0011858 3300049584 Bacteria 4927
180 Ga0501070_0415023 3300049586 Bacteria 1087
181 Ga0501071_0004833 3300049587 Bacteria 8589
182 Ga0501071_0045274 3300049587 Bacteria 3158
183 Ga0501071_0049670 3300049587 Bacteria 3020
184 Ga0501072_0000911 3300049588 Bacteria 21699
185 Ga0501072_0002047 3300049588 Bacteria 14994
186 Ga0501072_0048009 3300049588 Bacteria 3362
187 Ga0501072_0063689 3300049588 Bacteria 2909
188 Ga0501073_0029792 3300049589 Bacteria 3900
189 Ga0501074_0007543 3300049590 Bacteria 7872
190 Ga0501074_0019860 3300049590 Bacteria 4880
191 Ga0501074_0203549 3300049590 Bacteria 1410
192 Ga0501075_0002428 3300049591 Bacteria 12401
193 Ga0501075_0008117 3300049591 Bacteria 7303
194 Ga0501075_0056504 3300049591 Bacteria 2954
195 Ga0501075_0066033 3300049591 Bacteria 2730
196 Ga0501076_0005442 3300049592 Bacteria 9157
197 Ga0501076_0008203 3300049592 Bacteria 7651
198 Ga0501076_0009398 3300049592 Bacteria 7220
199 Ga0501076_0009748 3300049592 Bacteria 7096
200 Ga0501076_0381674 3300049592 Bacteria 1158
201 Ga0501077_0002446 3300049593 Bacteria 11126
202 Ga0501077_0012003 3300049593 Bacteria 5421
203 Ga0501079_0010520 3300049741 Bacteria 7033
204 Ga0501080_0003789 3300049742 Bacteria 13352
205 Ga0501080_0059747 3300049742 Bacteria 3548
206 Ga0501080_0096882 3300049742 Bacteria 2739
207 Ga0501080_0176382 3300049742 Bacteria 1968
208 Ga0501080_0235548 3300049742 Unclassified 1672
209 Ga0501081_0012423 3300049743 Bacteria 5596
210 Ga0501081_0016210 3300049743 Bacteria 4923
211 Ga0501081_0041637 3300049743 Bacteria 3146
212 Ga0501081_0147585 3300049743 Bacteria 1688
213 Ga0501081_0158735 3300049743 Unclassified 1628
214 Ga0501083_0016957 3300049744 Bacteria 5086
215 Ga0501083_0018364 3300049744 Bacteria 4874
216 Ga0501083_0126208 3300049744 Bacteria 1677
217 Ga0501035_0007932 3300049822 Bacteria 9912
218 Ga0501035_0040375 3300049822 Bacteria 4217
219 Ga0501035_0277981 3300049822 Bacteria 1416
220 Ga0501044_0111768 3300049823 Bacteria 2739
221 Ga0501045_0016037 3300049824 Bacteria 5316
222 Ga0501045_0030163 3300049824 Bacteria 3923
223 Ga0501045_0039259 3300049824 Bacteria 3444
224 Ga0501045_0042261 3300049824 Bacteria 3318
225 nmdc:mga05p37_70262_c1 3300050507 Bacteria 4307
226 nmdc:mga09592_111948_c1 3300050508 Bacteria 2342
227 nmdc:mga0qj67_47830_c1 3300050509 Unclassified 3379
228 nmdc:mga06r32_54214_c1 3300050510 Bacteria 3844
229 nmdc:mga08y16_60633_c1 3300050511 Bacteria 3951
230 nmdc:mga0rr50_79442_c1 3300050513 Bacteria 2527
231 nmdc:mga08x19_24513_c1 3300050514 Bacteria 3751
232 nmdc:mga0a205_408002_c1 3300050515 Unclassified 1222
233 Ga0495601_0016643 3300053077 Bacteria 4458
234 Ga0495619_0010985 3300053085 Bacteria 5699
235 Ga0495619_0023394 3300053085 Bacteria 3961
236 Ga0501084_0004466 3300054114 Bacteria 11422
237 Ga0501084_0047318 3300054114 Bacteria 3602
238 Ga0501084_0050989 3300054114 Bacteria 3463
239 Ga0501084_0154686 3300054114 Bacteria 1933
240 Ga0501082_0009134 3300060353 Bacteria 8546
241 Ga0501082_0013110 3300060353 Bacteria 7127
242 Ga0501082_0383977 3300060353 Bacteria 1225
243 Ga0530510_0002457 3300061734 Bacteria 12770
244 Ga0530510_0003852 3300061734 Bacteria 10336
245 Ga0105248_10082351
246 JGI24738J21930_10006697
247 Ga0058863_11769670
248 Ga0070683_100004189
249 Ga0070683_100081577
250 Ga0070680_100015740
251 Ga0070680_100017317
252 Ga0070680_100034542
253 Ga0070682_100019175
254 Ga0070682_100041829
255 Ga0070661_100112440
256 Ga0070709_10035227
257 Ga0070714_100021064
258 Ga0070714_100114699
259 Ga0070713_100045605
260 Ga0070710_10005934
261 Ga0070711_100016204
262 Ga0070662_100154336
263 Ga0070681_10114155
264 Ga0070681_10212442
265 Ga0070698_100274157
266 Ga0070679_100212407
267 Ga0070686_100042558
268 Ga0070695_100071760
269 Ga0070704_100273895
270 Ga0081455_10007129
271 Ga0081455_10067265
272 Ga0081538_10060654
273 Ga0081539_10019852
274 Ga0070717_10024988
275 Ga0070716_100055850
276 Ga0070712_100029178
277 Ga0068871_100107229
278 Ga0075428_100065103
279 Ga0075428_100276823
280 Ga0075431_100057306
281 Ga0075435_100069779
282 Ga0111539_10121605
283 Ga0111539_10356743
284 Ga0114129_10226086
285 Ga0114129_10276327
286 Ga0105243_10024638
287 Ga0105248_10124604
288 Ga0157370_10072792
289 Ga0157369_10032243
290 Ga0157375_10114550
291 Ga0182008_10088653
292 Ga0207692_10014123
293 Ga0207699_10038470
294 Ga0207705_10034320
295 Ga0207707_10086990
296 Ga0207707_10246155
297 Ga0207660_10017952
298 Ga0207660_10024623
299 Ga0207657_10017732
300 Ga0207652_10149040
301 Ga0207659_10171883
302 Ga0207664_10006665
303 Ga0207664_10029604
304 Ga0207665_10001100
305 Ga0207711_10425791
306 Ga0207661_10102955
307 Ga0207661_10434177
308 Ga0207667_10186765
309 Ga0207677_10079767
310 Ga0207675_100020331
311 Ga0207428_10021140
312 Ga0207428_10022783
313 Ga0265334_10021551
314 Ga0265322_10028404
315 Ga0265338_10051631
316 Ga0265320_10068221
317 Ga0265329_10027987
318 Ga0265340_10098265
319 Ga0265331_10126366
320 Ga0265327_10038746
321 Ga0265313_10006664
322 Ga0265314_10022134
323 Ga0265342_10080097
324 Ga0307409_100047756
325 Ga0316583_10028412
326 Ga0373943_0067349
327 Ga0395899_0055996
328 Ga0395899_0097431
329 Ga0395899_0253320
330 Ga0395900_0009702
331 Ga0395900_0052831
332 Ga0395900_0059629
333 Ga0395900_0203331
334 Ga0395898_0001107
335 Ga0395898_0049705
336 Ga0395898_0069700
337 Ga0395898_0136053
338 Ga0395898_0147109
339 Ga0395898_0243840
340 Ga0395898_0434829
341 Ga0395905_0221139
342 Ga0395905_0330949
343 Ga0395901_0002293
344 Ga0395901_0059814
345 Ga0395901_0113142
346 Ga0395901_0457559
347 Ga0436360_0752468
348 Ga0439438_010270
349 Ga0439439_0069758
350 Ga0439465_0125529
351 Ga0439434_0006327
352 Ga0466964_0005274
353 Ga0466957_0057014
354 Ga0466960_0035558
355 Ga0466967_0000518
356 Ga0466967_0007161
357 Ga0495592_0080589
358 Ga0495651_0014157
359 Ga0495653_0027923
360 Ga0495582_0204982
361 Ga0495608_0045490
362 Ga0495618_0162904
363 Ga0495630_0021041
364 Ga0495630_0034586
365 Ga0495644_0087326
366 Ga0495640_0028415
367 Ga0495640_0221599
368 Ga0495645_0072805
369 Ga0495634_0007192
370 Ga0495657_0036508
371 Ga0495658_0060658
372 Ga0495649_0067213
373 Ga0495604_0064464
374 Ga0495674_0009681
375 Ga0495680_0016932
376 Ga0496101_0013544
377 Ga0496102_0045097
378 Ga0496104_0172158
379 Ga0496110_0094710
380 Ga0496114_0146546
381 Ga0496114_0186183
382 Ga0496114_0290958
383 Ga0496115_0002681
384 Ga0496115_0291272
385 Ga0501031_0008333
386 Ga0501031_0019218
387 Ga0501031_0026427
388 Ga0501032_0052838
389 Ga0501032_0133856
390 Ga0501036_0008264
391 Ga0501036_0039902
392 Ga0501036_0097481
393 Ga0501036_0125182
394 Ga0501036_0232103
395 Ga0501037_0008826
396 Ga0501038_0013714
397 Ga0501038_0040516
398 Ga0501039_0002901
399 Ga0501039_0004158
400 Ga0501039_0015857
401 Ga0501039_0044249
402 Ga0501039_0119442
403 Ga0501040_0009618
404 Ga0501040_0033227
405 Ga0501040_0117170
406 Ga0501040_0325935
407 Ga0501041_0004014
408 Ga0501041_0007712
409 Ga0501041_0023700
410 Ga0501041_0101117
411 Ga0501041_0105642
412 Ga0501042_0004806
413 Ga0501042_0027412
414 Ga0501042_0045733
415 Ga0501042_0054593
416 Ga0501046_0007255
417 Ga0501046_0024648
418 Ga0501048_0004045
419 Ga0501048_0006289
420 Ga0501048_0015799
421 Ga0501067_0011756
422 Ga0501068_0001000
423 Ga0501068_0011858
424 Ga0501070_0415023
425 Ga0501071_0004833
426 Ga0501071_0045274
427 Ga0501071_0049670
428 Ga0501072_0000911
429 Ga0501072_0002047
430 Ga0501072_0048009
431 Ga0501072_0063689
432 Ga0501073_0029792
433 Ga0501074_0007543
434 Ga0501074_0019860
435 Ga0501074_0203549
436 Ga0501075_0002428
437 Ga0501075_0008117
438 Ga0501075_0056504
439 Ga0501075_0066033
440 Ga0501076_0005442
441 Ga0501076_0008203
442 Ga0501076_0009398
443 Ga0501076_0009748
444 Ga0501076_0381674
445 Ga0501077_0002446
446 Ga0501077_0012003
447 Ga0501079_0010520
448 Ga0501080_0003789
449 Ga0501080_0059747
450 Ga0501080_0096882
451 Ga0501080_0176382
452 Ga0501080_0235548
453 Ga0501081_0012423
454 Ga0501081_0016210
455 Ga0501081_0041637
456 Ga0501081_0147585
457 Ga0501081_0158735
458 Ga0501083_0016957
459 Ga0501083_0018364
460 Ga0501083_0126208
461 Ga0501035_0007932
462 Ga0501035_0040375
463 Ga0501035_0277981
464 Ga0501044_0111768
465 Ga0501045_0016037
466 Ga0501045_0030163
467 Ga0501045_0039259
468 Ga0501045_0042261
469 nmdc:mga05p37_70262_c1
470 nmdc:mga09592_111948_c1
471 nmdc:mga0qj67_47830_c1
472 nmdc:mga06r32_54214_c1
473 nmdc:mga08y16_60633_c1
474 nmdc:mga0rr50_79442_c1
475 nmdc:mga08x19_24513_c1
476 nmdc:mga0a205_408002_c1
477 Ga0495601_0016643
478 Ga0495619_0010985
479 Ga0495619_0023394
480 Ga0501084_0004466
481 Ga0501084_0047318
482 Ga0501084_0050989
483 Ga0501084_0154686
484 Ga0501082_0009134
485 Ga0501082_0013110
486 Ga0501082_0383977
487 Ga0530510_0002457
488 Ga0530510_0003852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

30

332

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4egw-assembly1.cif.gz_B the structure of the soluble domain of cora from methanocaldococcus jannaschii 0.888 29 248
5jtg-assembly1.cif.gz_E crystal structure of thermotoga maritima mutant d89k/d253k 0.8521 29 318
8slb-assembly1.cif.gz_A x-ray structure of cora n-terminal domain in complex with conformation-specific synthetic antibody c12 0.8518 29 229
4ev6-assembly1.cif.gz_E the complete structure of cora magnesium transporter from methanocaldococcus jannaschii 0.8452 29 321
2iub-assembly2.cif.gz_I crystal structure of a divalent metal ion transporter cora at 2.9 a resolution. 0.8396 29 318
ID Description Score Start End Superfamily
3jcfA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9118 138 243 1.20.58.340
4eebC02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9092 138 243 1.20.58.340
4i0uJ02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9076 138 243 1.20.58.340
4i0uI02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9071 137 243 1.20.58.340
2iubA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9061 138 243 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A1G2BR17-F1-model_v4 Magnesium transporter 0.9419 23 321 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A847FWF8-F1-model_v4 Magnesium transporter CorA family protein 0.9393 23 321 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A1F7USC8-F1-model_v4 Magnesium transport protein CorA 0.9384 23 321 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-X1BNI2-F1-model_v4 Magnesium transport protein CorA 0.9344 81 321 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A7Y5QFL5-F1-model_v4 Magnesium transporter CorA family protein 0.9323 23 321 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Map