F356408

General Info

Members Datasets Scaffolds Average Seq Length
244 158 488 277

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100339165|Ga0075429_1003391652
Length 307
Sequence MAVHRRGYRQYDGPRTPERWRFWILARYAFGHVFRFRLLVIFYVLCFVPTLIASSAVYLSHHVDVLMSLFPNARPPQVDLVPVTAEFFLFLMTIQAVLSVFVTALVGPGLVSPDLTNNALPLYFSRPFSRVEYVLGKFSVLFVLLFLVTGAPMLLIYLLKSALAGSQWFIDNIHIAFAILIGSLVWVTLISLVALASSAWLRWRPAAAGMLFALLFFPTGFGRAANEIMRMGWGSLLNAIVVIGTVWNSLFFINDAEGYARAARALNPMGFRTLPIPAWTAWLMVVLVCAVSLLLINRKIRAYEVVR

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
101 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.33
Nodule 0
Rhizoplane 0
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 7.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100339165 3300006880 Unclassified 1316
2 MRS1b_contig_2760101 2162886011 Unclassified 1184
3 Ga0065712_10077418 3300005290 Bacteria 3499
4 Ga0065712_10111097 3300005290 Bacteria 1824
5 Ga0065715_10027968 3300005293 Unclassified 2180
6 Ga0065715_10099713 3300005293 Bacteria 3379
7 Ga0065715_10135346 3300005293 Bacteria 1940
8 Ga0065707_10131831 3300005295 Bacteria 1907
9 Ga0068869_100097403 3300005334 Bacteria 2221
10 Ga0070666_10204829 3300005335 Bacteria 1388
11 Ga0070689_100017460 3300005340 Bacteria 5270
12 Ga0070689_100450273 3300005340 Bacteria 1095
13 Ga0070661_100043789 3300005344 Bacteria 3270
14 Ga0070669_100122640 3300005353 Bacteria 1985
15 Ga0070669_100230269 3300005353 Bacteria 1469
16 Ga0070675_100000232 3300005354 Bacteria 35813
17 Ga0070675_100006902 3300005354 Bacteria 8718
18 Ga0070675_100020829 3300005354 Bacteria 5233
19 Ga0070671_100021731 3300005355 Bacteria 5241
20 Ga0070673_100003259 3300005364 Bacteria 10069
21 Ga0070673_100037715 3300005364 Bacteria 3684
22 Ga0070673_100044869 3300005364 Bacteria 3425
23 Ga0070673_100169203 3300005364 Bacteria 1864
24 Ga0070688_100022679 3300005365 Bacteria 3684
25 Ga0070688_100035923 3300005365 Bacteria 3012
26 Ga0070659_100374244 3300005366 Bacteria 1199
27 Ga0070667_100021308 3300005367 Bacteria 5384
28 Ga0070709_10027899 3300005434 Bacteria 3362
29 Ga0070694_100249376 3300005444 Bacteria 1342
30 Ga0070678_100441390 3300005456 Bacteria 1138
31 Ga0070685_10007375 3300005466 Bacteria 5625
32 Ga0070685_10011334 3300005466 Bacteria 4669
33 Ga0070685_10025957 3300005466 Bacteria 3227
34 Ga0070685_10239891 3300005466 Bacteria 1196
35 Ga0070672_100127702 3300005543 Bacteria 2087
36 Ga0070672_100154019 3300005543 Bacteria 1903
37 Ga0070686_100011497 3300005544 Bacteria 5021
38 Ga0070686_100056532 3300005544 Bacteria 2517
39 Ga0070665_100022759 3300005548 Bacteria 6309
40 Ga0070665_100260581 3300005548 Bacteria 1735
41 Ga0068857_100313592 3300005577 Unclassified 1447
42 Ga0068857_100318826 3300005577 Bacteria 1435
43 Ga0068857_100783596 3300005577 Unclassified 910
44 Ga0068859_100000993 3300005617 Bacteria 29036
45 Ga0068859_100013583 3300005617 Bacteria 8163
46 Ga0068859_100018865 3300005617 Bacteria 6931
47 Ga0068859_100049575 3300005617 Bacteria 4217
48 Ga0068859_100175193 3300005617 Bacteria 2227
49 Ga0068864_100102502 3300005618 Bacteria 2540
50 Ga0068864_100171910 3300005618 Bacteria 1976
51 Ga0068861_100048111 3300005719 Bacteria 3222
52 Ga0068863_100002245 3300005841 Bacteria 19182
53 Ga0068858_100076415 3300005842 Bacteria 3110
54 Ga0068858_100518720 3300005842 Bacteria 1152
55 Ga0068862_100064231 3300005844 Bacteria 3160
56 Ga0075365_10097455 3300006038 Bacteria 2010
57 Ga0075364_10039154 3300006051 Bacteria 3072
58 Ga0075364_10131466 3300006051 Bacteria 1680
59 Ga0075364_10142738 3300006051 Bacteria 1611
60 Ga0075367_10002699 3300006178 Bacteria 8184
61 Ga0097621_100018223 3300006237 Bacteria 5357
62 Ga0075370_10248405 3300006353 Bacteria 1054
63 Ga0068871_100076468 3300006358 Bacteria 2765
64 Ga0075428_100000013 3300006844 Bacteria 167653
65 Ga0075428_100001732 3300006844 Bacteria 23290
66 Ga0075428_100107989 3300006844 Bacteria 3033
67 Ga0075428_100117103 3300006844 Bacteria 2902
68 Ga0075430_100002973 3300006846 Bacteria 14195
69 Ga0075430_100498342 3300006846 Bacteria 1005
70 Ga0075431_100008183 3300006847 Bacteria 10448
71 Ga0075431_100022335 3300006847 Bacteria 6467
72 Ga0075433_10008611 3300006852 Bacteria 8137
73 Ga0075434_100226694 3300006871 Bacteria 1888
74 Ga0075429_100087860 3300006880 Bacteria 2710
75 Ga0075429_100413242 3300006880 Bacteria 1182
76 Ga0068865_100043585 3300006881 Bacteria 3067
77 Ga0068865_100401053 3300006881 Bacteria 1123
78 Ga0097620_100000993 3300006931 Bacteria 29036
79 Ga0097620_100013583 3300006931 Bacteria 8163
80 Ga0097620_100018865 3300006931 Bacteria 6931
81 Ga0097620_100049573 3300006931 Bacteria 4217
82 Ga0097620_100175186 3300006931 Bacteria 2227
83 Ga0075435_100445596 3300007076 Bacteria 1116
84 Ga0105240_10049544 3300009093 Bacteria 5301
85 Ga0111539_10005316 3300009094 Bacteria 16663
86 Ga0111539_10007065 3300009094 Bacteria 14403
87 Ga0111539_10013062 3300009094 Bacteria 10389
88 Ga0111539_10016122 3300009094 Bacteria 9272
89 Ga0111539_10018581 3300009094 Bacteria 8612
90 Ga0114129_10012842 3300009147 Bacteria 11919
91 Ga0114129_10023669 3300009147 Bacteria 8706
92 Ga0114129_10049583 3300009147 Bacteria 5898
93 Ga0114129_10060525 3300009147 Bacteria 5294
94 Ga0114129_10064540 3300009147 Bacteria 5111
95 Ga0114129_10229537 3300009147 Bacteria 2500
96 Ga0114129_10521666 3300009147 Bacteria 1549
97 Ga0105248_10000562 3300009177 Bacteria 42094
98 Ga0105248_10052363 3300009177 Bacteria 4580
99 Ga0105248_10062332 3300009177 Bacteria 4188
100 Ga0105237_10027240 3300009545 Bacteria 5836
101 Ga0105238_10024681 3300009551 Bacteria 6128
102 Ga0105249_10062329 3300009553 Bacteria 3424
103 Ga0157374_10437255 3300013296 Bacteria 1308
104 Ga0163162_10000995 3300013306 Bacteria 26367
105 Ga0157375_10004297 3300013308 Bacteria 12361
106 Ga0157375_10121486 3300013308 Bacteria 2722
107 Ga0163163_10007949 3300014325 Bacteria 9380
108 Ga0157379_10000277 3300014968 Bacteria 40463
109 Ga0157376_10074406 3300014969 Bacteria 2895
110 Ga0163161_10066834 3300017792 Bacteria 2625
111 Ga0213876_10108950 3300021384 Bacteria 1470
112 Ga0213871_10000608 3300021441 Bacteria 5078
113 Ga0207680_10109357 3300025903 Bacteria 1790
114 Ga0207645_10051424 3300025907 Bacteria 2633
115 Ga0207662_10133239 3300025918 Bacteria 1568
116 Ga0207681_10100796 3300025923 Bacteria 2082
117 Ga0207694_10033293 3300025924 Bacteria 3948
118 Ga0207650_10014064 3300025925 Bacteria 5557
119 Ga0207659_10001291 3300025926 Bacteria 14971
120 Ga0207659_10001985 3300025926 Bacteria 12106
121 Ga0207659_10004565 3300025926 Bacteria 8374
122 Ga0207659_10148203 3300025926 Bacteria 1830
123 Ga0207644_10106317 3300025931 Bacteria 2116
124 Ga0207706_10373095 3300025933 Unclassified 1239
125 Ga0207670_10097976 3300025936 Bacteria 2089
126 Ga0207670_10145841 3300025936 Bacteria 1750
127 Ga0207711_10001521 3300025941 Bacteria 21549
128 Ga0207711_10105500 3300025941 Bacteria 2499
129 Ga0207651_10007268 3300025960 Bacteria 5887
130 Ga0207651_10060666 3300025960 Bacteria 2627
131 Ga0207651_10110503 3300025960 Bacteria 2062
132 Ga0207651_10114315 3300025960 Bacteria 2033
133 Ga0207658_10006343 3300025986 Bacteria 8073
134 Ga0207708_10151473 3300026075 Bacteria 1826
135 Ga0207641_10015607 3300026088 Bacteria 6225
136 Ga0207674_10147898 3300026116 Bacteria 2307
137 Ga0207674_10337717 3300026116 Bacteria 1457
138 Ga0207675_100064550 3300026118 Bacteria 3422
139 Ga0207683_10568093 3300026121 Bacteria 1049
140 Ga0207428_10001133 3300027907 Bacteria 28923
141 Ga0207428_10018382 3300027907 Bacteria 5973
142 Ga0207428_10338936 3300027907 Unclassified 1108
143 Ga0268266_10076077 3300028379 Bacteria 2917
144 Ga0268266_10108276 3300028379 Bacteria 2459
145 Ga0268264_10003384 3300028381 Bacteria 13773
146 Ga0265338_10017405 3300028800 Bacteria 7747
147 Ga0265762_1000133 3300030760 Bacteria 11173
148 Ga0265760_10039253 3300031090 Unclassified 1409
149 Ga0265339_10065884 3300031249 Bacteria 1941
150 Ga0307408_100004976 3300031548 Bacteria 8929
151 Ga0307408_100031301 3300031548 Bacteria 3704
152 Ga0307408_100239520 3300031548 Bacteria 1490
153 Ga0265342_10019567 3300031712 Bacteria 4361
154 Ga0316576_10048345 3300031727 Bacteria 3085
155 Ga0307405_10385652 3300031731 Bacteria 1092
156 Ga0307410_10124994 3300031852 Bacteria 1881
157 Ga0307416_100043517 3300032002 Bacteria 3516
158 Ga0307411_10277880 3300032005 Bacteria 1331
159 Ga0307415_100092701 3300032126 Bacteria 2191
160 Ga0373956_0094294 3300035119 Unclassified 1383
161 Ga0373931_0284251 3300035691 Unclassified 1017
162 Ga0373937_0530206 3300036401 Bacteria 1119
163 Ga0436365_1723879 3300039437 Bacteria 2408
164 Ga0436360_0270413 3300039438 Bacteria 17125
165 Ga0436362_0782895 3300039453 Unclassified 1138
166 Ga0439445_0047001 3300042004 Bacteria 1158
167 Ga0439435_0008043 3300042436 Bacteria 2437
168 Ga0453683_0075349 3300044673 Bacteria 2112
169 Ga0451576_0170247 3300045051 Bacteria 2273
170 Ga0495629_0000035 3300046459 Bacteria 118597
171 Ga0495641_0078344 3300046461 Unclassified 1481
172 Ga0495582_0032075 3300046473 Bacteria 2890
173 Ga0495639_0025286 3300046475 Bacteria 2618
174 Ga0495639_0026139 3300046475 Bacteria 2578
175 Ga0495594_0281732 3300046499 Bacteria 947
176 Ga0495618_0151782 3300046514 Unclassified 1480
177 Ga0495586_0048680 3300046535 Bacteria 2291
178 Ga0495634_0034461 3300046642 Bacteria 3474
179 Ga0495634_0257626 3300046642 Unclassified 1065
180 Ga0495635_0001362 3300046663 Bacteria 16266
181 Ga0495658_0000289 3300046683 Bacteria 28435
182 Ga0495613_0040098 3300046689 Bacteria 3470
183 Ga0495581_0000568 3300047315 Bacteria 19217
184 Ga0495672_0047044 3300047320 Bacteria 2569
185 Ga0495676_0385923 3300047321 Bacteria 931
186 Ga0495680_0003049 3300047322 Bacteria 16691
187 Ga0495614_0040007 3300048089 Bacteria 2012
188 Ga0501031_0001269 3300049568 Bacteria 15462
189 Ga0501032_0000906 3300049569 Bacteria 24003
190 Ga0501033_0023270 3300049570 Bacteria 4672
191 Ga0501034_0031922 3300049571 Bacteria 5350
192 Ga0501036_0000076 3300049572 Bacteria 60845
193 Ga0501037_0004098 3300049573 Bacteria 10569
194 Ga0501038_0000318 3300049574 Bacteria 41311
195 Ga0501039_0015731 3300049575 Bacteria 5790
196 Ga0501039_0330878 3300049575 Bacteria 1197
197 Ga0501043_0005071 3300049579 Bacteria 10653
198 Ga0501047_0009906 3300049581 Bacteria 9009
199 Ga0501048_0032109 3300049582 Bacteria 3796
200 Ga0501067_0003415 3300049583 Bacteria 8740
201 Ga0501068_0002093 3300049584 Bacteria 10645
202 Ga0501070_0003506 3300049586 Bacteria 13577
203 Ga0501072_0000396 3300049588 Bacteria 31095
204 Ga0501073_0006436 3300049589 Bacteria 8740
205 Ga0501074_0010732 3300049590 Bacteria 6655
206 Ga0501247_004935 3300049677 Bacteria 1475
207 Ga0501079_0003526 3300049741 Bacteria 11500
208 Ga0501080_0003089 3300049742 Bacteria 14704
209 Ga0501083_0016230 3300049744 Bacteria 5215
210 Ga0501035_0004880 3300049822 Bacteria 12723
211 Ga0501044_0033317 3300049823 Bacteria 5414
212 nmdc:mga00v17_143475_c1 3300050491 Bacteria 1532
213 nmdc:mga00v17_392588_c1 3300050491 Bacteria 902
214 nmdc:mga00v17_73777_c1 3300050491 Bacteria 2119
215 nmdc:mga0yw44_170600_c1 3300050492 Bacteria 1428
216 nmdc:mga06z11_23865_c1 3300050494 Bacteria 2878
217 nmdc:mga07m45_194693_c1 3300050496 Bacteria 1179
218 nmdc:mga05p37_108587_c1 3300050507 Bacteria 3413
219 nmdc:mga05p37_206853_c1 3300050507 Bacteria 2374
220 nmdc:mga05p37_2508_c1 3300050507 Bacteria 21346
221 nmdc:mga05p37_27758_c1 3300050507 Bacteria 6895
222 nmdc:mga05p37_38853_c1 3300050507 Bacteria 5839
223 nmdc:mga05p37_52402_c1 3300050507 Bacteria 5018
224 nmdc:mga05p37_81636_c1 3300050507 Unclassified 3215
225 nmdc:mga09592_189222_c1 3300050508 Bacteria 1781
226 nmdc:mga09592_21432_c1 3300050508 Bacteria 5325
227 nmdc:mga09592_2865_c1 3300050508 Bacteria 13988
228 nmdc:mga0qj67_2289_c1 3300050509 Bacteria 13604
229 nmdc:mga0qj67_28519_c1 3300050509 Bacteria 4333
230 nmdc:mga06r32_492147_c1 3300050510 Unclassified 1204
231 nmdc:mga06r32_59545_c1 3300050510 Bacteria 3673
232 nmdc:mga08y16_10809_c1 3300050511 Bacteria 9583
233 nmdc:mga08y16_12603_c1 3300050511 Bacteria 8893
234 nmdc:mga08y16_39273_c1 3300050511 Bacteria 4966
235 nmdc:mga08y16_453_c1 3300050511 Bacteria 38076
236 nmdc:mga0n895_210558_c1 3300050512 Bacteria 1974
237 nmdc:mga0n895_517126_c1 3300050512 Unclassified 1201
238 nmdc:mga0n895_636861_c1 3300050512 Unclassified 1066
239 nmdc:mga0rr50_338401_c1 3300050513 Unclassified 1264
240 nmdc:mga0a205_245630_c1 3300050515 Bacteria 1670
241 Ga0495619_0003871 3300053085 Bacteria 9621
242 Ga0500568_0016280 3300053139 Bacteria 3310
243 Ga0501084_0002510 3300054114 Bacteria 14770
244 Ga0501082_0007450 3300060353 Bacteria 9443
245 Ga0075429_100339165
246 MRS1b_contig_2760101
247 Ga0065712_10077418
248 Ga0065712_10111097
249 Ga0065715_10027968
250 Ga0065715_10099713
251 Ga0065715_10135346
252 Ga0065707_10131831
253 Ga0068869_100097403
254 Ga0070666_10204829
255 Ga0070689_100017460
256 Ga0070689_100450273
257 Ga0070661_100043789
258 Ga0070669_100122640
259 Ga0070669_100230269
260 Ga0070675_100000232
261 Ga0070675_100006902
262 Ga0070675_100020829
263 Ga0070671_100021731
264 Ga0070673_100003259
265 Ga0070673_100037715
266 Ga0070673_100044869
267 Ga0070673_100169203
268 Ga0070688_100022679
269 Ga0070688_100035923
270 Ga0070659_100374244
271 Ga0070667_100021308
272 Ga0070709_10027899
273 Ga0070694_100249376
274 Ga0070678_100441390
275 Ga0070685_10007375
276 Ga0070685_10011334
277 Ga0070685_10025957
278 Ga0070685_10239891
279 Ga0070672_100127702
280 Ga0070672_100154019
281 Ga0070686_100011497
282 Ga0070686_100056532
283 Ga0070665_100022759
284 Ga0070665_100260581
285 Ga0068857_100313592
286 Ga0068857_100318826
287 Ga0068857_100783596
288 Ga0068859_100000993
289 Ga0068859_100013583
290 Ga0068859_100018865
291 Ga0068859_100049575
292 Ga0068859_100175193
293 Ga0068864_100102502
294 Ga0068864_100171910
295 Ga0068861_100048111
296 Ga0068863_100002245
297 Ga0068858_100076415
298 Ga0068858_100518720
299 Ga0068862_100064231
300 Ga0075365_10097455
301 Ga0075364_10039154
302 Ga0075364_10131466
303 Ga0075364_10142738
304 Ga0075367_10002699
305 Ga0097621_100018223
306 Ga0075370_10248405
307 Ga0068871_100076468
308 Ga0075428_100000013
309 Ga0075428_100001732
310 Ga0075428_100107989
311 Ga0075428_100117103
312 Ga0075430_100002973
313 Ga0075430_100498342
314 Ga0075431_100008183
315 Ga0075431_100022335
316 Ga0075433_10008611
317 Ga0075434_100226694
318 Ga0075429_100087860
319 Ga0075429_100413242
320 Ga0068865_100043585
321 Ga0068865_100401053
322 Ga0097620_100000993
323 Ga0097620_100013583
324 Ga0097620_100018865
325 Ga0097620_100049573
326 Ga0097620_100175186
327 Ga0075435_100445596
328 Ga0105240_10049544
329 Ga0111539_10005316
330 Ga0111539_10007065
331 Ga0111539_10013062
332 Ga0111539_10016122
333 Ga0111539_10018581
334 Ga0114129_10012842
335 Ga0114129_10023669
336 Ga0114129_10049583
337 Ga0114129_10060525
338 Ga0114129_10064540
339 Ga0114129_10229537
340 Ga0114129_10521666
341 Ga0105248_10000562
342 Ga0105248_10052363
343 Ga0105248_10062332
344 Ga0105237_10027240
345 Ga0105238_10024681
346 Ga0105249_10062329
347 Ga0157374_10437255
348 Ga0163162_10000995
349 Ga0157375_10004297
350 Ga0157375_10121486
351 Ga0163163_10007949
352 Ga0157379_10000277
353 Ga0157376_10074406
354 Ga0163161_10066834
355 Ga0213876_10108950
356 Ga0213871_10000608
357 Ga0207680_10109357
358 Ga0207645_10051424
359 Ga0207662_10133239
360 Ga0207681_10100796
361 Ga0207694_10033293
362 Ga0207650_10014064
363 Ga0207659_10001291
364 Ga0207659_10001985
365 Ga0207659_10004565
366 Ga0207659_10148203
367 Ga0207644_10106317
368 Ga0207706_10373095
369 Ga0207670_10097976
370 Ga0207670_10145841
371 Ga0207711_10001521
372 Ga0207711_10105500
373 Ga0207651_10007268
374 Ga0207651_10060666
375 Ga0207651_10110503
376 Ga0207651_10114315
377 Ga0207658_10006343
378 Ga0207708_10151473
379 Ga0207641_10015607
380 Ga0207674_10147898
381 Ga0207674_10337717
382 Ga0207675_100064550
383 Ga0207683_10568093
384 Ga0207428_10001133
385 Ga0207428_10018382
386 Ga0207428_10338936
387 Ga0268266_10076077
388 Ga0268266_10108276
389 Ga0268264_10003384
390 Ga0265338_10017405
391 Ga0265762_1000133
392 Ga0265760_10039253
393 Ga0265339_10065884
394 Ga0307408_100004976
395 Ga0307408_100031301
396 Ga0307408_100239520
397 Ga0265342_10019567
398 Ga0316576_10048345
399 Ga0307405_10385652
400 Ga0307410_10124994
401 Ga0307416_100043517
402 Ga0307411_10277880
403 Ga0307415_100092701
404 Ga0373956_0094294
405 Ga0373931_0284251
406 Ga0373937_0530206
407 Ga0436365_1723879
408 Ga0436360_0270413
409 Ga0436362_0782895
410 Ga0439445_0047001
411 Ga0439435_0008043
412 Ga0453683_0075349
413 Ga0451576_0170247
414 Ga0495629_0000035
415 Ga0495641_0078344
416 Ga0495582_0032075
417 Ga0495639_0025286
418 Ga0495639_0026139
419 Ga0495594_0281732
420 Ga0495618_0151782
421 Ga0495586_0048680
422 Ga0495634_0034461
423 Ga0495634_0257626
424 Ga0495635_0001362
425 Ga0495658_0000289
426 Ga0495613_0040098
427 Ga0495581_0000568
428 Ga0495672_0047044
429 Ga0495676_0385923
430 Ga0495680_0003049
431 Ga0495614_0040007
432 Ga0501031_0001269
433 Ga0501032_0000906
434 Ga0501033_0023270
435 Ga0501034_0031922
436 Ga0501036_0000076
437 Ga0501037_0004098
438 Ga0501038_0000318
439 Ga0501039_0015731
440 Ga0501039_0330878
441 Ga0501043_0005071
442 Ga0501047_0009906
443 Ga0501048_0032109
444 Ga0501067_0003415
445 Ga0501068_0002093
446 Ga0501070_0003506
447 Ga0501072_0000396
448 Ga0501073_0006436
449 Ga0501074_0010732
450 Ga0501247_004935
451 Ga0501079_0003526
452 Ga0501080_0003089
453 Ga0501083_0016230
454 Ga0501035_0004880
455 Ga0501044_0033317
456 nmdc:mga00v17_143475_c1
457 nmdc:mga00v17_392588_c1
458 nmdc:mga00v17_73777_c1
459 nmdc:mga0yw44_170600_c1
460 nmdc:mga06z11_23865_c1
461 nmdc:mga07m45_194693_c1
462 nmdc:mga05p37_108587_c1
463 nmdc:mga05p37_206853_c1
464 nmdc:mga05p37_2508_c1
465 nmdc:mga05p37_27758_c1
466 nmdc:mga05p37_38853_c1
467 nmdc:mga05p37_52402_c1
468 nmdc:mga05p37_81636_c1
469 nmdc:mga09592_189222_c1
470 nmdc:mga09592_21432_c1
471 nmdc:mga09592_2865_c1
472 nmdc:mga0qj67_2289_c1
473 nmdc:mga0qj67_28519_c1
474 nmdc:mga06r32_492147_c1
475 nmdc:mga06r32_59545_c1
476 nmdc:mga08y16_10809_c1
477 nmdc:mga08y16_12603_c1
478 nmdc:mga08y16_39273_c1
479 nmdc:mga08y16_453_c1
480 nmdc:mga0n895_210558_c1
481 nmdc:mga0n895_517126_c1
482 nmdc:mga0n895_636861_c1
483 nmdc:mga0rr50_338401_c1
484 nmdc:mga0a205_245630_c1
485 Ga0495619_0003871
486 Ga0500568_0016280
487 Ga0501084_0002510
488 Ga0501082_0007450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.5618 21 258
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.5475 21 258
7o17-assembly1.cif.gz_D abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.5435 21 258
7osf-assembly1.cif.gz_E abc transporter complex nosdfyl, r-domain 1 0.5419 21 258
7o0z-assembly1.cif.gz_E abc transporter nosfy, nucleotide-free in gdn 0.5261 21 258
ID Description Score Start End Superfamily
af_A0A1D8PU98_268_422_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3738 21 161 1.20.1250.20
af_A0A1D8PU98_268_422_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.338 21 161 1.20.1250.20
af_Q6IHY4_1_217_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3124 1 182 1.25.10.10
af_I1LQ16_48_287_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.2827 19 151 1.20.1410.10
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.265 16 184 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A2U3LRG4-F1-model_v4 ABC transporter permease 0.8106 1 264 GO:0016020
AF-A0A2V9FCR6-F1-model_v4 ABC transporter permease 0.8076 1 262 GO:0016020
AF-A0A7T9GE62-F1-model_v4 deleted 0.8045 1 264
AF-A0A321M1I0-F1-model_v4 ABC transporter permease 0.8041 1 262 GO:0005886
GO:0140359
AF-A0A3N5YIL9-F1-model_v4 ABC transporter permease 0.8037 1 264 GO:0016020

Map