F356356

General Info

Members Datasets Scaffolds Average Seq Length
244 162 488 262

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1057685|Ga0081540_10576852
Length 241
Sequence VTAASRSRPLGRLEPPALMGVLVREIINFSSFWRGTTFSATVEPTIYLLAFGFGFGSLVSTVGGYDYVDFVGTGTVATAVLFSSAFPGMFSTYVKYEYQHTYDAILAAPVDTEELVTAEAMWISLRAGVYGCTPMLVAICFGLTPSWGMLAVPFINVIAGFGWASTPLFLVAGTFFPLDDLPEWVQVLAQFNPLYHCVQLVRDAVFGFDGWADLYHLAVLVAFGALMWRLAIWRMAAKLID

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
101 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
102 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
103 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 2506783011 Frankia datiscae Dg1 Isolate Nodule
162 2773857933 Frankia sp. BMG5.30 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 1.23
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0.82
Rhizoplane 11.89
Rhizosphere 84.84
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1057685 3300005983 Bacteria 1876
2 JGI25406J46586_10075044 3300003203 Unclassified 1050
3 Ga0070658_10224470 3300005327 Bacteria 1589
4 Ga0070683_100094524 3300005329 Bacteria 2809
5 Ga0070683_100387252 3300005329 Bacteria 1332
6 Ga0070683_100441586 3300005329 Bacteria 1241
7 Ga0068869_100191998 3300005334 Bacteria 1606
8 Ga0070680_100025823 3300005336 Bacteria 4696
9 Ga0070660_100017475 3300005339 Bacteria 5229
10 Ga0070660_100082519 3300005339 Bacteria 2524
11 Ga0070660_100302487 3300005339 Bacteria 1311
12 Ga0070660_100353815 3300005339 Bacteria 1210
13 Ga0070687_100073493 3300005343 Bacteria 1843
14 Ga0070692_10028432 3300005345 Bacteria 2778
15 Ga0070675_100417228 3300005354 Bacteria 1200
16 Ga0070659_100010038 3300005366 Bacteria 6969
17 Ga0070659_100096191 3300005366 Bacteria 2378
18 Ga0070659_100176092 3300005366 Bacteria 1754
19 Ga0070659_100216030 3300005366 Bacteria 1581
20 Ga0070701_10084368 3300005438 Bacteria 1727
21 Ga0070700_100026880 3300005441 Bacteria 3405
22 Ga0070694_100100934 3300005444 Bacteria 2041
23 Ga0070708_100027665 3300005445 Bacteria 4868
24 Ga0070662_100089116 3300005457 Bacteria 2314
25 Ga0070681_10003999 3300005458 Bacteria 13908
26 Ga0070681_10096319 3300005458 Bacteria 2907
27 Ga0070681_10393714 3300005458 Bacteria 1296
28 Ga0068867_100262839 3300005459 Bacteria 1408
29 Ga0070706_100229011 3300005467 Bacteria 1735
30 Ga0070699_100402418 3300005518 Bacteria 1238
31 Ga0070679_100017027 3300005530 Bacteria 7027
32 Ga0070679_100019568 3300005530 Bacteria 6586
33 Ga0070679_100160929 3300005530 Bacteria 2219
34 Ga0070684_100057232 3300005535 Bacteria 3403
35 Ga0070684_100131062 3300005535 Bacteria 2262
36 Ga0068853_100023015 3300005539 Bacteria 5211
37 Ga0068853_100073152 3300005539 Bacteria 2987
38 Ga0070686_100016173 3300005544 Bacteria 4336
39 Ga0070693_100043898 3300005547 Bacteria 2527
40 Ga0070665_100211230 3300005548 Bacteria 1941
41 Ga0070665_100548743 3300005548 Bacteria 1168
42 Ga0070665_100554952 3300005548 Bacteria 1161
43 Ga0070664_100046009 3300005564 Bacteria 3686
44 Ga0070664_100385648 3300005564 Bacteria 1280
45 Ga0068854_100150591 3300005578 Bacteria 1793
46 Ga0068854_100295507 3300005578 Bacteria 1309
47 Ga0070702_100121122 3300005615 Bacteria 1638
48 Ga0068852_100099283 3300005616 Bacteria 2624
49 Ga0068852_100173766 3300005616 Bacteria 2021
50 Ga0068864_100123794 3300005618 Bacteria 2315
51 Ga0068864_100686053 3300005618 Bacteria 1000
52 Ga0068861_100178860 3300005719 Bacteria 1764
53 Ga0068860_100428819 3300005843 Bacteria 1312
54 Ga0068862_100450247 3300005844 Bacteria 1214
55 Ga0081455_10008118 3300005937 Bacteria 10957
56 Ga0081455_10055846 3300005937 Bacteria 3356
57 Ga0081538_10011527 3300005981 Bacteria 7155
58 Ga0081538_10011668 3300005981 Bacteria 7103
59 Ga0081538_10032984 3300005981 Bacteria 3456
60 Ga0081538_10093921 3300005981 Bacteria 1538
61 Ga0081540_1013663 3300005983 Bacteria 5265
62 Ga0075363_100025907 3300006048 Bacteria 2996
63 Ga0068871_100311071 3300006358 Bacteria 1385
64 Ga0075428_100087786 3300006844 Bacteria 3392
65 Ga0075431_100213732 3300006847 Bacteria 1969
66 Ga0105240_10183656 3300009093 Bacteria 2466
67 Ga0105245_10030892 3300009098 Bacteria 4738
68 Ga0114129_10194784 3300009147 Bacteria 2749
69 Ga0105243_10205377 3300009148 Bacteria 1731
70 Ga0105243_10223714 3300009148 Bacteria 1665
71 Ga0105241_10051411 3300009174 Bacteria 3142
72 Ga0105248_10147028 3300009177 Bacteria 2659
73 Ga0105248_10323621 3300009177 Bacteria 1737
74 Ga0105237_10482400 3300009545 Bacteria 1246
75 Ga0105238_10044030 3300009551 Bacteria 4515
76 Ga0105238_10288089 3300009551 Bacteria 1624
77 Ga0105249_10681302 3300009553 Bacteria 1087
78 Ga0105239_10072495 3300010375 Bacteria 3786
79 Ga0105239_10225940 3300010375 Bacteria 2100
80 Ga0157370_10164957 3300013104 Bacteria 2060
81 Ga0157378_10197627 3300013297 Bacteria 1900
82 Ga0157375_10115185 3300013308 Bacteria 2791
83 Ga0157375_10209415 3300013308 Bacteria 2107
84 Ga0157377_10059861 3300014745 Bacteria 2172
85 Ga0157379_10154063 3300014968 Bacteria 2073
86 Ga0206356_11037269 3300020070 Bacteria 2001
87 Ga0206353_11568305 3300020082 Bacteria 1166
88 Ga0224712_10044973 3300022467 Bacteria 1687
89 Ga0207688_10008468 3300025901 Bacteria 5595
90 Ga0207688_10019155 3300025901 Bacteria 3725
91 Ga0207643_10030753 3300025908 Bacteria 2990
92 Ga0207705_10105614 3300025909 Bacteria 2076
93 Ga0207684_10113028 3300025910 Bacteria 2325
94 Ga0207654_10095036 3300025911 Bacteria 1825
95 Ga0207707_10011349 3300025912 Bacteria 7756
96 Ga0207707_10130746 3300025912 Bacteria 2196
97 Ga0207695_10315207 3300025913 Bacteria 1454
98 Ga0207693_10254555 3300025915 Bacteria 1377
99 Ga0207662_10061910 3300025918 Bacteria 2247
100 Ga0207657_10013355 3300025919 Bacteria 8057
101 Ga0207652_10289378 3300025921 Bacteria 1478
102 Ga0207690_10085382 3300025932 Bacteria 2216
103 Ga0207706_10010299 3300025933 Bacteria 8549
104 Ga0207706_10089281 3300025933 Bacteria 2710
105 Ga0207670_10491287 3300025936 Bacteria 995
106 Ga0207704_10365000 3300025938 Bacteria 1128
107 Ga0207691_10182495 3300025940 Bacteria 1833
108 Ga0207711_10303011 3300025941 Bacteria 1474
109 Ga0207689_10101648 3300025942 Bacteria 2361
110 Ga0207661_10114296 3300025944 Bacteria 2288
111 Ga0207661_10175631 3300025944 Bacteria 1867
112 Ga0207661_10219413 3300025944 Bacteria 1680
113 Ga0207661_10321380 3300025944 Bacteria 1391
114 Ga0207661_10469193 3300025944 Bacteria 1148
115 Ga0207679_10073241 3300025945 Bacteria 2591
116 Ga0207679_10298953 3300025945 Bacteria 1387
117 Ga0207667_10059096 3300025949 Bacteria 4017
118 Ga0207667_10346833 3300025949 Bacteria 1514
119 Ga0207712_10211247 3300025961 Bacteria 1546
120 Ga0207703_10149604 3300026035 Bacteria 2034
121 Ga0207639_10208556 3300026041 Bacteria 1680
122 Ga0207639_10526140 3300026041 Bacteria 1083
123 Ga0207678_10276758 3300026067 Bacteria 1440
124 Ga0207708_10020910 3300026075 Bacteria 4938
125 Ga0207702_10215969 3300026078 Bacteria 1785
126 Ga0207648_10035365 3300026089 Bacteria 4400
127 Ga0207648_10055460 3300026089 Bacteria 3459
128 Ga0207676_10327486 3300026095 Bacteria 1409
129 Ga0207674_10027476 3300026116 Bacteria 6019
130 Ga0207674_10042681 3300026116 Bacteria 4682
131 Ga0207674_10367761 3300026116 Bacteria 1390
132 Ga0207675_100333364 3300026118 Bacteria 1484
133 Ga0207683_10085642 3300026121 Bacteria 2801
134 Ga0207698_10041768 3300026142 Bacteria 3421
135 Ga0207698_10172408 3300026142 Bacteria 1907
136 Ga0207428_10037462 3300027907 Bacteria 3945
137 Ga0395899_0007301 3300037312 Bacteria 8548
138 Ga0395899_0075891 3300037312 Bacteria 2454
139 Ga0395899_0181927 3300037312 Bacteria 1475
140 Ga0395900_0031840 3300037418 Bacteria 5421
141 Ga0395900_0059214 3300037418 Bacteria 3942
142 Ga0395900_0117232 3300037418 Bacteria 2732
143 Ga0395898_0020123 3300037466 Bacteria 6779
144 Ga0395898_0029292 3300037466 Bacteria 5516
145 Ga0395898_0133046 3300037466 Bacteria 2381
146 Ga0395898_0180629 3300037466 Bacteria 2017
147 Ga0395905_0017798 3300037471 Bacteria 6750
148 Ga0395905_0031532 3300037471 Bacteria 4990
149 Ga0395905_0723684 3300037471 Bacteria 897
150 Ga0436364_0036644 3300037853 Bacteria 811
151 Ga0395901_0022452 3300038443 Bacteria 6467
152 Ga0395901_0054675 3300038443 Bacteria 4149
153 Ga0436363_0392838 3300039450 Bacteria 2285
154 Ga0451802_0900318 3300041460 Bacteria 1410
155 Ga0439458_0023241 3300042157 Bacteria 1445
156 Ga0450916_002917 3300042530 Bacteria 1852
157 Ga0439440_0013793 3300042993 Bacteria 1738
158 Ga0466963_0004664 3300044694 Bacteria 8000
159 Ga0466963_0018440 3300044694 Bacteria 4364
160 Ga0466971_0078261 3300044719 Bacteria 1506
161 Ga0466957_0003413 3300044842 Bacteria 8723
162 Ga0466960_0001679 3300044901 Bacteria 8113
163 Ga0451576_0466759 3300045051 Bacteria 1326
164 Ga0466958_0165865 3300045836 Bacteria 1397
165 Ga0466967_0003759 3300045976 Bacteria 10011
166 Ga0466967_0131604 3300045976 Bacteria 2323
167 Ga0495585_0081172 3300046492 Bacteria 1757
168 Ga0495663_0092521 3300046525 Bacteria 987
169 Ga0495666_0180230 3300046526 Bacteria 976
170 Ga0495656_0085027 3300046615 Bacteria 1436
171 Ga0495677_0135270 3300047445 Bacteria 945
172 Ga0496100_0215508 3300048903 Bacteria 1407
173 Ga0496101_0201649 3300048904 Bacteria 1538
174 Ga0496102_0103580 3300048905 Bacteria 2647
175 Ga0496102_0556615 3300048905 Bacteria 1070
176 Ga0496104_0051775 3300048907 Bacteria 3876
177 Ga0496104_0104272 3300048907 Bacteria 2717
178 Ga0496105_0051814 3300048908 Bacteria 3389
179 Ga0496105_0347517 3300048908 Bacteria 1185
180 Ga0496108_0018049 3300048911 Bacteria 5771
181 Ga0496108_0031219 3300048911 Bacteria 4418
182 Ga0496108_0044377 3300048911 Bacteria 3711
183 Ga0496108_0351619 3300048911 Bacteria 1286
184 Ga0496109_0001457 3300048912 Bacteria 19614
185 Ga0496109_0044255 3300048912 Bacteria 4038
186 Ga0496109_0082924 3300048912 Bacteria 2956
187 Ga0496109_0143721 3300048912 Bacteria 2231
188 Ga0496109_0418178 3300048912 Bacteria 1266
189 Ga0496110_0001304 3300048913 Bacteria 17907
190 Ga0496110_0040793 3300048913 Bacteria 4046
191 Ga0496111_0000338 3300048914 Bacteria 23346
192 Ga0496111_0000878 3300048914 Bacteria 16362
193 Ga0496112_0026385 3300048915 Bacteria 5588
194 Ga0496113_0000531 3300048916 Bacteria 18828
195 Ga0496113_0045567 3300048916 Bacteria 3253
196 Ga0496114_0014033 3300048917 Bacteria 6424
197 Ga0496114_0106736 3300048917 Bacteria 2396
198 Ga0496114_0375007 3300048917 Bacteria 1259
199 Ga0496114_0469725 3300048917 Bacteria 1113
200 Ga0496121_0013391 3300048924 Bacteria 8821
201 Ga0496124_0179967 3300048927 Bacteria 1628
202 Ga0501032_0315669 3300049569 Bacteria 1009
203 Ga0501034_0023111 3300049571 Bacteria 6336
204 Ga0501036_0055552 3300049572 Bacteria 3355
205 Ga0501038_0326742 3300049574 Bacteria 1199
206 Ga0501039_0409233 3300049575 Bacteria 1065
207 Ga0501040_0101800 3300049576 Bacteria 2004
208 Ga0501040_0122899 3300049576 Bacteria 1822
209 Ga0501040_0126137 3300049576 Bacteria 1798
210 Ga0501041_0351873 3300049577 Bacteria 931
211 Ga0501042_0274103 3300049578 Bacteria 1218
212 Ga0501047_0022593 3300049581 Bacteria 6040
213 Ga0501047_0077591 3300049581 Bacteria 3195
214 Ga0501048_0075178 3300049582 Bacteria 2383
215 Ga0501067_0076664 3300049583 Bacteria 1852
216 Ga0501069_0074972 3300049585 Bacteria 1899
217 Ga0501070_0107630 3300049586 Bacteria 2304
218 Ga0501070_0370873 3300049586 Bacteria 1160
219 Ga0501071_0133207 3300049587 Bacteria 1847
220 Ga0501072_0206686 3300049588 Bacteria 1565
221 Ga0501072_0301303 3300049588 Bacteria 1274
222 Ga0501072_0411367 3300049588 Bacteria 1073
223 Ga0501075_0159356 3300049591 Bacteria 1721
224 Ga0501076_0012041 3300049592 Bacteria 6464
225 Ga0501080_0017050 3300049742 Bacteria 6707
226 Ga0501080_0096612 3300049742 Bacteria 2743
227 Ga0501081_0152561 3300049743 Bacteria 1660
228 Ga0501083_0171888 3300049744 Bacteria 1416
229 Ga0501044_0444534 3300049823 Bacteria 1204
230 Ga0501044_0480695 3300049823 Bacteria 1145
231 Ga0501045_0060289 3300049824 Bacteria 2781
232 nmdc:mga08y16_241678_c1 3300050511 Bacteria 1866
233 nmdc:mga08y16_593091_c1 3300050511 Bacteria 1117
234 nmdc:mga08y16_916964_c1 3300050511 Bacteria 861
235 nmdc:mga0n895_315423_c1 3300050512 Bacteria 1584
236 nmdc:mga0rr50_499318_c1 3300050513 Bacteria 1034
237 nmdc:mga08x19_601049_c1 3300050514 Bacteria 780
238 nmdc:mga0a205_15822_c1 3300050515 Bacteria 7053
239 Ga0495655_0134263 3300053083 Bacteria 765
240 Ga0500616_0004921 3300053153 Bacteria 9278
241 Ga0590077_010085 3300059426 Bacteria 1941
242 Ga0501082_0122040 3300060353 Bacteria 2259
243 2506865052 2506783011 Bacteria 5323186
244 2774904495 2773857933 Bacteria 5818019
245 Ga0081540_1057685
246 JGI25406J46586_10075044
247 Ga0070658_10224470
248 Ga0070683_100094524
249 Ga0070683_100387252
250 Ga0070683_100441586
251 Ga0068869_100191998
252 Ga0070680_100025823
253 Ga0070660_100017475
254 Ga0070660_100082519
255 Ga0070660_100302487
256 Ga0070660_100353815
257 Ga0070687_100073493
258 Ga0070692_10028432
259 Ga0070675_100417228
260 Ga0070659_100010038
261 Ga0070659_100096191
262 Ga0070659_100176092
263 Ga0070659_100216030
264 Ga0070701_10084368
265 Ga0070700_100026880
266 Ga0070694_100100934
267 Ga0070708_100027665
268 Ga0070662_100089116
269 Ga0070681_10003999
270 Ga0070681_10096319
271 Ga0070681_10393714
272 Ga0068867_100262839
273 Ga0070706_100229011
274 Ga0070699_100402418
275 Ga0070679_100017027
276 Ga0070679_100019568
277 Ga0070679_100160929
278 Ga0070684_100057232
279 Ga0070684_100131062
280 Ga0068853_100023015
281 Ga0068853_100073152
282 Ga0070686_100016173
283 Ga0070693_100043898
284 Ga0070665_100211230
285 Ga0070665_100548743
286 Ga0070665_100554952
287 Ga0070664_100046009
288 Ga0070664_100385648
289 Ga0068854_100150591
290 Ga0068854_100295507
291 Ga0070702_100121122
292 Ga0068852_100099283
293 Ga0068852_100173766
294 Ga0068864_100123794
295 Ga0068864_100686053
296 Ga0068861_100178860
297 Ga0068860_100428819
298 Ga0068862_100450247
299 Ga0081455_10008118
300 Ga0081455_10055846
301 Ga0081538_10011527
302 Ga0081538_10011668
303 Ga0081538_10032984
304 Ga0081538_10093921
305 Ga0081540_1013663
306 Ga0075363_100025907
307 Ga0068871_100311071
308 Ga0075428_100087786
309 Ga0075431_100213732
310 Ga0105240_10183656
311 Ga0105245_10030892
312 Ga0114129_10194784
313 Ga0105243_10205377
314 Ga0105243_10223714
315 Ga0105241_10051411
316 Ga0105248_10147028
317 Ga0105248_10323621
318 Ga0105237_10482400
319 Ga0105238_10044030
320 Ga0105238_10288089
321 Ga0105249_10681302
322 Ga0105239_10072495
323 Ga0105239_10225940
324 Ga0157370_10164957
325 Ga0157378_10197627
326 Ga0157375_10115185
327 Ga0157375_10209415
328 Ga0157377_10059861
329 Ga0157379_10154063
330 Ga0206356_11037269
331 Ga0206353_11568305
332 Ga0224712_10044973
333 Ga0207688_10008468
334 Ga0207688_10019155
335 Ga0207643_10030753
336 Ga0207705_10105614
337 Ga0207684_10113028
338 Ga0207654_10095036
339 Ga0207707_10011349
340 Ga0207707_10130746
341 Ga0207695_10315207
342 Ga0207693_10254555
343 Ga0207662_10061910
344 Ga0207657_10013355
345 Ga0207652_10289378
346 Ga0207690_10085382
347 Ga0207706_10010299
348 Ga0207706_10089281
349 Ga0207670_10491287
350 Ga0207704_10365000
351 Ga0207691_10182495
352 Ga0207711_10303011
353 Ga0207689_10101648
354 Ga0207661_10114296
355 Ga0207661_10175631
356 Ga0207661_10219413
357 Ga0207661_10321380
358 Ga0207661_10469193
359 Ga0207679_10073241
360 Ga0207679_10298953
361 Ga0207667_10059096
362 Ga0207667_10346833
363 Ga0207712_10211247
364 Ga0207703_10149604
365 Ga0207639_10208556
366 Ga0207639_10526140
367 Ga0207678_10276758
368 Ga0207708_10020910
369 Ga0207702_10215969
370 Ga0207648_10035365
371 Ga0207648_10055460
372 Ga0207676_10327486
373 Ga0207674_10027476
374 Ga0207674_10042681
375 Ga0207674_10367761
376 Ga0207675_100333364
377 Ga0207683_10085642
378 Ga0207698_10041768
379 Ga0207698_10172408
380 Ga0207428_10037462
381 Ga0395899_0007301
382 Ga0395899_0075891
383 Ga0395899_0181927
384 Ga0395900_0031840
385 Ga0395900_0059214
386 Ga0395900_0117232
387 Ga0395898_0020123
388 Ga0395898_0029292
389 Ga0395898_0133046
390 Ga0395898_0180629
391 Ga0395905_0017798
392 Ga0395905_0031532
393 Ga0395905_0723684
394 Ga0436364_0036644
395 Ga0395901_0022452
396 Ga0395901_0054675
397 Ga0436363_0392838
398 Ga0451802_0900318
399 Ga0439458_0023241
400 Ga0450916_002917
401 Ga0439440_0013793
402 Ga0466963_0004664
403 Ga0466963_0018440
404 Ga0466971_0078261
405 Ga0466957_0003413
406 Ga0466960_0001679
407 Ga0451576_0466759
408 Ga0466958_0165865
409 Ga0466967_0003759
410 Ga0466967_0131604
411 Ga0495585_0081172
412 Ga0495663_0092521
413 Ga0495666_0180230
414 Ga0495656_0085027
415 Ga0495677_0135270
416 Ga0496100_0215508
417 Ga0496101_0201649
418 Ga0496102_0103580
419 Ga0496102_0556615
420 Ga0496104_0051775
421 Ga0496104_0104272
422 Ga0496105_0051814
423 Ga0496105_0347517
424 Ga0496108_0018049
425 Ga0496108_0031219
426 Ga0496108_0044377
427 Ga0496108_0351619
428 Ga0496109_0001457
429 Ga0496109_0044255
430 Ga0496109_0082924
431 Ga0496109_0143721
432 Ga0496109_0418178
433 Ga0496110_0001304
434 Ga0496110_0040793
435 Ga0496111_0000338
436 Ga0496111_0000878
437 Ga0496112_0026385
438 Ga0496113_0000531
439 Ga0496113_0045567
440 Ga0496114_0014033
441 Ga0496114_0106736
442 Ga0496114_0375007
443 Ga0496114_0469725
444 Ga0496121_0013391
445 Ga0496124_0179967
446 Ga0501032_0315669
447 Ga0501034_0023111
448 Ga0501036_0055552
449 Ga0501038_0326742
450 Ga0501039_0409233
451 Ga0501040_0101800
452 Ga0501040_0122899
453 Ga0501040_0126137
454 Ga0501041_0351873
455 Ga0501042_0274103
456 Ga0501047_0022593
457 Ga0501047_0077591
458 Ga0501048_0075178
459 Ga0501067_0076664
460 Ga0501069_0074972
461 Ga0501070_0107630
462 Ga0501070_0370873
463 Ga0501071_0133207
464 Ga0501072_0206686
465 Ga0501072_0301303
466 Ga0501072_0411367
467 Ga0501075_0159356
468 Ga0501076_0012041
469 Ga0501080_0017050
470 Ga0501080_0096612
471 Ga0501081_0152561
472 Ga0501083_0171888
473 Ga0501044_0444534
474 Ga0501044_0480695
475 Ga0501045_0060289
476 nmdc:mga08y16_241678_c1
477 nmdc:mga08y16_593091_c1
478 nmdc:mga08y16_916964_c1
479 nmdc:mga0n895_315423_c1
480 nmdc:mga0rr50_499318_c1
481 nmdc:mga08x19_601049_c1
482 nmdc:mga0a205_15822_c1
483 Ga0495655_0134263
484 Ga0500616_0004921
485 Ga0590077_010085
486 Ga0501082_0122040
487 2506865052
488 2774904495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

148

206

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.7477 18 260
6hco-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to estrone 3-sulfate and 5d3-fab 0.7463 18 259
7nez-assembly1.cif.gz_B structure of topotecan-bound abcg2 0.7406 18 259
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.7357 18 259
7p03-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation without nucleotides 0.7258 16 261
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8005 70 257 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7969 69 260 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7175 49 258 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5969 69 260 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5884 70 257 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A7V9FL22-F1-model_v4 Transport permease protein 0.9854 90 265 GO:0043190
GO:0140359
AF-A0A7W0JLX3-F1-model_v4 ABC transporter permease 0.985 56 265 GO:0043190
GO:0140359
AF-A0A7W0JLX3-F1-model_v4 ABC transporter permease 0.9804 56 265 GO:0043190
GO:0140359
AF-A0A7V9FL22-F1-model_v4 Transport permease protein 0.9744 90 265 GO:0043190
GO:0140359
AF-A0A7V9K3G7-F1-model_v4 Transport permease protein 0.9703 11 265 GO:0043190
GO:0140359

Map