F356301

General Info

Members Datasets Scaffolds Average Seq Length
244 128 488 253

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100000239|Ga0070679_1000002395
Length 296
Sequence MKRREEVNYFVNHGSCLQPWFVSHEPHFANEVSVQIRHQKIIHQPSTMNSRRDFIKNSTLSLGLISLPSLLSAEKKETGKGKKIVCIGGHPDDPESGCGGTLAKLRNAGHEVTIIYLTTGEAGIPGKSHDEAAAIRRQEAINACKVLDAKPVFAGQIDGDTICNNEWLTKIQQLITDEKPDIVFTQWPLDSHKDHQVASLLTIQTWIRNPQQFSLYFYEVCIGEQTLIFHPTDYVDITDTQDQKKKAVYCHISQDPPGIYDCGHAAMEDFRGRELGVKAAEGFVRMAGKLQGGMGF

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.28
Nodule 0
Rhizoplane 0
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 11.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100000239 3300005530 Bacteria 45591
2 JGI25162J39368_1002754 3300002737 Bacteria 6281
3 JGI25164J39214_1000820 3300002772 Bacteria 10880
4 JGI25165J46597_1001976 3300003214 Bacteria 7927
5 rootH2_10095273 3300003320 Bacteria 2837
6 rootL2_10102293 3300003322 Bacteria 1350
7 rootH1_10004576 3300003323 Bacteria 68064
8 rootH1_10015499 3300003323 Bacteria 86587
9 rootH1_10046209 3300003323 Bacteria 6136
10 Ga0070658_10000075 3300005327 Bacteria 95412
11 Ga0070658_10036195 3300005327 Bacteria 3978
12 Ga0070658_10517613 3300005327 Bacteria 1031
13 Ga0070676_10001405 3300005328 Bacteria 12139
14 Ga0070676_10383439 3300005328 Unclassified 974
15 Ga0070683_100674605 3300005329 Bacteria 990
16 Ga0070690_100574304 3300005330 Bacteria 853
17 Ga0070680_100004448 3300005336 Bacteria 10554
18 Ga0070680_100171373 3300005336 Bacteria 1826
19 Ga0070680_100447477 3300005336 Bacteria 1103
20 Ga0068868_100007356 3300005338 Bacteria 7841
21 Ga0070660_100011254 3300005339 Bacteria 6350
22 Ga0070687_100203912 3300005343 Bacteria 1200
23 Ga0070675_100081512 3300005354 Bacteria 2698
24 Ga0070671_100020828 3300005355 Bacteria 5349
25 Ga0070671_100035905 3300005355 Unclassified 4108
26 Ga0070659_100269314 3300005366 Bacteria 1415
27 Ga0070667_100016735 3300005367 Bacteria 6069
28 Ga0070667_100204563 3300005367 Unclassified 1753
29 Ga0070678_100017755 3300005456 Unclassified 4590
30 Ga0070662_100000167 3300005457 Bacteria 38204
31 Ga0070662_100000901 3300005457 Bacteria 18158
32 Ga0070681_10166190 3300005458 Bacteria 2129
33 Ga0070681_10196912 3300005458 Bacteria 1934
34 Ga0070681_10376523 3300005458 Bacteria 1330
35 Ga0070681_10514923 3300005458 Bacteria 1110
36 Ga0068867_100003317 3300005459 Bacteria 11339
37 Ga0068867_100032213 3300005459 Bacteria 3789
38 Ga0068867_100258030 3300005459 Bacteria 1420
39 Ga0070679_100004660 3300005530 Bacteria 12654
40 Ga0068853_100002213 3300005539 Bacteria 14526
41 Ga0068853_100055010 3300005539 Bacteria 3430
42 Ga0068853_100705576 3300005539 Bacteria 962
43 Ga0070672_100285745 3300005543 Bacteria 1396
44 Ga0068855_100000286 3300005563 Bacteria 62438
45 Ga0068855_100002441 3300005563 Bacteria 22952
46 Ga0068855_100002947 3300005563 Bacteria 20801
47 Ga0068855_100009680 3300005563 Bacteria 11633
48 Ga0068855_100244348 3300005563 Bacteria 2004
49 Ga0068855_100468569 3300005563 Bacteria 1372
50 Ga0068856_100000976 3300005614 Bacteria 30515
51 Ga0068856_100018194 3300005614 Bacteria 6812
52 Ga0068852_100195904 3300005616 Unclassified 1909
53 Ga0068864_100250083 3300005618 Bacteria 1645
54 Ga0068863_100124265 3300005841 Bacteria 2462
55 Ga0068863_100379858 3300005841 Bacteria 1379
56 Ga0068860_100004561 3300005843 Bacteria 14136
57 Ga0068860_100022334 3300005843 Bacteria 6121
58 Ga0097621_100000076 3300006237 Bacteria 51192
59 Ga0097621_100011605 3300006237 Bacteria 6495
60 Ga0068871_100000070 3300006358 Bacteria 57286
61 Ga0068871_100014782 3300006358 Bacteria 5827
62 Ga0068871_100035619 3300006358 Bacteria 3956
63 Ga0068865_100000448 3300006881 Bacteria 22921
64 Ga0105240_10003850 3300009093 Bacteria 23179
65 Ga0105240_10183025 3300009093 Bacteria 2471
66 Ga0105247_10232183 3300009101 Bacteria 1253
67 Ga0105241_10032245 3300009174 Unclassified 3927
68 Ga0105241_10043368 3300009174 Bacteria 3407
69 Ga0105241_10053002 3300009174 Unclassified 3100
70 Ga0105242_10040347 3300009176 Unclassified 3762
71 Ga0105237_10045415 3300009545 Bacteria 4421
72 Ga0105237_10054577 3300009545 Unclassified 4004
73 Ga0105238_10002487 3300009551 Bacteria 18444
74 Ga0105238_10531553 3300009551 Bacteria 1179
75 Ga0105249_10004143 3300009553 Bacteria 12522
76 Ga0105249_10548168 3300009553 Bacteria 1207
77 Ga0105239_10000009 3300010375 Bacteria 361182
78 Ga0105239_10001186 3300010375 Bacteria 35727
79 Ga0105239_10085859 3300010375 Unclassified 3469
80 Ga0105239_10549262 3300010375 Bacteria 1315
81 Ga0105246_10016709 3300011119 Bacteria 4651
82 Ga0157373_10002234 3300013100 Bacteria 14659
83 Ga0157373_10020533 3300013100 Unclassified 4799
84 Ga0157371_10000664 3300013102 Bacteria 40881
85 Ga0157371_10141148 3300013102 Bacteria 1716
86 Ga0157369_10200879 3300013105 Bacteria 2093
87 Ga0157374_10000147 3300013296 Bacteria 63762
88 Ga0157374_10004914 3300013296 Bacteria 11219
89 Ga0157374_10005626 3300013296 Bacteria 10559
90 Ga0157374_10117917 3300013296 Bacteria 2559
91 Ga0157374_10289246 3300013296 Unclassified 1619
92 Ga0157378_10016211 3300013297 Bacteria 6526
93 Ga0157378_10045158 3300013297 Bacteria 3914
94 Ga0157378_10253021 3300013297 Bacteria 1687
95 Ga0163162_10000044 3300013306 Bacteria 128200
96 Ga0163162_10000766 3300013306 Bacteria 29884
97 Ga0163162_10031450 3300013306 Bacteria 5264
98 Ga0163162_10046802 3300013306 Bacteria 4336
99 Ga0163162_10604468 3300013306 Bacteria 1223
100 Ga0157372_10001267 3300013307 Bacteria 27321
101 Ga0157372_10016266 3300013307 Bacteria 7984
102 Ga0157372_10048540 3300013307 Unclassified 4719
103 Ga0157372_10212837 3300013307 Bacteria 2240
104 Ga0157372_10322423 3300013307 Bacteria 1799
105 Ga0157372_10619944 3300013307 Bacteria 1261
106 Ga0157375_10000735 3300013308 Bacteria 28891
107 Ga0157375_10014654 3300013308 Bacteria 7003
108 Ga0157375_10030405 3300013308 Bacteria 5092
109 Ga0157375_10066561 3300013308 Bacteria 3598
110 Ga0157375_10383269 3300013308 Bacteria 1572
111 Ga0157375_10593992 3300013308 Bacteria 1267
112 Ga0163163_10002351 3300014325 Bacteria 16008
113 Ga0163163_10118570 3300014325 Bacteria 2679
114 Ga0163163_10213518 3300014325 Bacteria 1979
115 Ga0157380_10352267 3300014326 Bacteria 1378
116 Ga0157377_10018376 3300014745 Bacteria 3631
117 Ga0157377_10048424 3300014745 Bacteria 2385
118 Ga0157379_10893706 3300014968 Bacteria 842
119 Ga0157376_10019530 3300014969 Bacteria 5225
120 Ga0157376_10603290 3300014969 Bacteria 1093
121 Ga0163161_10099295 3300017792 Unclassified 2165
122 Ga0213876_10014995 3300021384 Bacteria 4108
123 Ga0207427_101087 3300025231 Bacteria 11112
124 Ga0209437_100048 3300025233 Bacteria 405107
125 Ga0209233_1000029 3300025261 Bacteria 641642
126 Ga0209455_1001549 3300025272 Bacteria 10198
127 Ga0207680_10145390 3300025903 Bacteria 1576
128 Ga0207647_10000209 3300025904 Bacteria 47604
129 Ga0207647_10082867 3300025904 Bacteria 1920
130 Ga0207645_10001060 3300025907 Bacteria 22749
131 Ga0207705_10000102 3300025909 Bacteria 98105
132 Ga0207654_10023889 3300025911 Unclassified 3280
133 Ga0207654_10047780 3300025911 Bacteria 2446
134 Ga0207707_10074838 3300025912 Bacteria 2954
135 Ga0207707_10242310 3300025912 Bacteria 1567
136 Ga0207707_10298297 3300025912 Unclassified 1394
137 Ga0207695_10207777 3300025913 Bacteria 1870
138 Ga0207671_10002483 3300025914 Bacteria 19710
139 Ga0207671_10002992 3300025914 Bacteria 17322
140 Ga0207660_10005243 3300025917 Bacteria 8422
141 Ga0207660_10483505 3300025917 Bacteria 1004
142 Ga0207657_10025571 3300025919 Bacteria 5441
143 Ga0207657_10132887 3300025919 Bacteria 2038
144 Ga0207652_10000097 3300025921 Bacteria 95815
145 Ga0207652_10000157 3300025921 Bacteria 73896
146 Ga0207652_10016378 3300025921 Bacteria 6052
147 Ga0207681_10120329 3300025923 Bacteria 1925
148 Ga0207694_10218099 3300025924 Bacteria 1555
149 Ga0207694_10470823 3300025924 Bacteria 1050
150 Ga0207644_10005819 3300025931 Bacteria 8028
151 Ga0207644_10183285 3300025931 Bacteria 1642
152 Ga0207690_10059109 3300025932 Bacteria 2596
153 Ga0207690_10228281 3300025932 Bacteria 1428
154 Ga0207690_10305955 3300025932 Bacteria 1245
155 Ga0207690_10378691 3300025932 Unclassified 1124
156 Ga0207706_10000257 3300025933 Bacteria 57965
157 Ga0207706_10005816 3300025933 Bacteria 11471
158 Ga0207704_10000016 3300025938 Bacteria 158362
159 Ga0207691_10345885 3300025940 Bacteria 1272
160 Ga0207689_10302249 3300025942 Bacteria 1326
161 Ga0207661_10794627 3300025944 Unclassified 871
162 Ga0207667_10000136 3300025949 Bacteria 111470
163 Ga0207667_10003048 3300025949 Bacteria 20784
164 Ga0207667_10007901 3300025949 Bacteria 12701
165 Ga0207667_10062083 3300025949 Bacteria 3908
166 Ga0207667_10244487 3300025949 Bacteria 1836
167 Ga0207712_10409395 3300025961 Unclassified 1142
168 Ga0207677_10266515 3300026023 Bacteria 1399
169 Ga0207639_10048738 3300026041 Bacteria 3208
170 Ga0207702_10000402 3300026078 Bacteria 49308
171 Ga0207702_10012611 3300026078 Bacteria 7036
172 Ga0207702_10148880 3300026078 Bacteria 2127
173 Ga0207641_10330790 3300026088 Bacteria 1447
174 Ga0207648_10107809 3300026089 Bacteria 2445
175 Ga0207676_10195793 3300026095 Bacteria 1782
176 Ga0207674_10012485 3300026116 Bacteria 9491
177 Ga0207674_10079346 3300026116 Bacteria 3287
178 Ga0207683_10015199 3300026121 Bacteria 6550
179 Ga0207698_10003621 3300026142 Bacteria 9323
180 Ga0207698_10342299 3300026142 Unclassified 1409
181 Ga0207698_11015415 3300026142 Unclassified 841
182 Ga0268265_10207546 3300028380 Unclassified 1704
183 Ga0268264_10001415 3300028381 Bacteria 22431
184 Ga0268264_10008111 3300028381 Bacteria 8734
185 Ga0307517_10001005 3300028786 Bacteria 47845
186 Ga0265327_10000030 3300031251 Bacteria 333531
187 Ga0307510_10000638 3300033180 Bacteria 35529
188 Ga0373941_0142728 3300035115 Bacteria 872
189 Ga0395899_0000426 3300037312 Bacteria 48742
190 Ga0395899_0000577 3300037312 Bacteria 38891
191 Ga0395899_0004840 3300037312 Bacteria 10482
192 Ga0395899_0004934 3300037312 Bacteria 10379
193 Ga0395899_0014753 3300037312 Bacteria 5965
194 Ga0395900_0000327 3300037418 Bacteria 70365
195 Ga0395900_0000686 3300037418 Bacteria 45163
196 Ga0395900_0000701 3300037418 Bacteria 44627
197 Ga0395900_0000752 3300037418 Bacteria 43126
198 Ga0395900_0001751 3300037418 Bacteria 24946
199 Ga0395900_0012635 3300037418 Bacteria 8634
200 Ga0395900_0167316 3300037418 Bacteria 2240
201 Ga0395900_0410037 3300037418 Bacteria 1317
202 Ga0395898_0002647 3300037466 Bacteria 20826
203 Ga0395898_0003757 3300037466 Bacteria 16815
204 Ga0395898_0008234 3300037466 Bacteria 11020
205 Ga0395898_0024830 3300037466 Bacteria 6042
206 Ga0395898_0195758 3300037466 Bacteria 1931
207 Ga0395905_0000461 3300037471 Bacteria 56680
208 Ga0395905_0002247 3300037471 Bacteria 21710
209 Ga0395905_0118450 3300037471 Bacteria 2489
210 Ga0395901_0000464 3300038443 Bacteria 47061
211 Ga0395901_0011773 3300038443 Bacteria 8870
212 Ga0395901_0027047 3300038443 Bacteria 5892
213 Ga0395901_0084925 3300038443 Unclassified 3309
214 Ga0395901_0089572 3300038443 Bacteria 3220
215 Ga0395901_0137380 3300038443 Bacteria 2569
216 Ga0395901_0833491 3300038443 Bacteria 909
217 Ga0436365_1619686 3300039437 Bacteria 4152
218 Ga0439448_0007967 3300042005 Unclassified 3087
219 Ga0453684_0190850 3300044712 Unclassified 2397
220 Ga0451576_0195467 3300045051 Unclassified 2113
221 Ga0495592_0197146 3300046454 Bacteria 1361
222 Ga0495650_0053305 3300046471 Bacteria 1657
223 Ga0495631_0060611 3300046518 Bacteria 1641
224 Ga0495642_0098227 3300046528 Bacteria 1244
225 Ga0495652_0079100 3300046529 Bacteria 2720
226 Ga0495625_0186570 3300046660 Bacteria 1376
227 Ga0495625_0243428 3300046660 Bacteria 1170
228 Ga0495674_0307958 3300047319 Bacteria 1293
229 Ga0495687_000879 3300047443 Bacteria 31853
230 Ga0495686_0026850 3300047472 Bacteria 3766
231 Ga0496126_0461204 3300048929 Unclassified 1021
232 Ga0501031_0095998 3300049568 Bacteria 1934
233 Ga0501034_0131568 3300049571 Bacteria 2485
234 Ga0501034_0259058 3300049571 Bacteria 1682
235 Ga0501036_0008451 3300049572 Bacteria 8436
236 Ga0501037_0015405 3300049573 Bacteria 5625
237 Ga0501038_0049372 3300049574 Bacteria 3638
238 Ga0501038_0384168 3300049574 Bacteria 1089
239 Ga0501046_0052219 3300049580 Bacteria 3222
240 Ga0501080_0397270 3300049742 Bacteria 1241
241 Ga0501035_0090305 3300049822 Bacteria 2697
242 Ga0501044_0011934 3300049823 Bacteria 9416
243 Ga0501044_0605028 3300049823 Bacteria 989
244 Ga0500608_000855 3300053122 Bacteria 10997
245 Ga0070679_100000239
246 JGI25162J39368_1002754
247 JGI25164J39214_1000820
248 JGI25165J46597_1001976
249 rootH2_10095273
250 rootL2_10102293
251 rootH1_10004576
252 rootH1_10015499
253 rootH1_10046209
254 Ga0070658_10000075
255 Ga0070658_10036195
256 Ga0070658_10517613
257 Ga0070676_10001405
258 Ga0070676_10383439
259 Ga0070683_100674605
260 Ga0070690_100574304
261 Ga0070680_100004448
262 Ga0070680_100171373
263 Ga0070680_100447477
264 Ga0068868_100007356
265 Ga0070660_100011254
266 Ga0070687_100203912
267 Ga0070675_100081512
268 Ga0070671_100020828
269 Ga0070671_100035905
270 Ga0070659_100269314
271 Ga0070667_100016735
272 Ga0070667_100204563
273 Ga0070678_100017755
274 Ga0070662_100000167
275 Ga0070662_100000901
276 Ga0070681_10166190
277 Ga0070681_10196912
278 Ga0070681_10376523
279 Ga0070681_10514923
280 Ga0068867_100003317
281 Ga0068867_100032213
282 Ga0068867_100258030
283 Ga0070679_100004660
284 Ga0068853_100002213
285 Ga0068853_100055010
286 Ga0068853_100705576
287 Ga0070672_100285745
288 Ga0068855_100000286
289 Ga0068855_100002441
290 Ga0068855_100002947
291 Ga0068855_100009680
292 Ga0068855_100244348
293 Ga0068855_100468569
294 Ga0068856_100000976
295 Ga0068856_100018194
296 Ga0068852_100195904
297 Ga0068864_100250083
298 Ga0068863_100124265
299 Ga0068863_100379858
300 Ga0068860_100004561
301 Ga0068860_100022334
302 Ga0097621_100000076
303 Ga0097621_100011605
304 Ga0068871_100000070
305 Ga0068871_100014782
306 Ga0068871_100035619
307 Ga0068865_100000448
308 Ga0105240_10003850
309 Ga0105240_10183025
310 Ga0105247_10232183
311 Ga0105241_10032245
312 Ga0105241_10043368
313 Ga0105241_10053002
314 Ga0105242_10040347
315 Ga0105237_10045415
316 Ga0105237_10054577
317 Ga0105238_10002487
318 Ga0105238_10531553
319 Ga0105249_10004143
320 Ga0105249_10548168
321 Ga0105239_10000009
322 Ga0105239_10001186
323 Ga0105239_10085859
324 Ga0105239_10549262
325 Ga0105246_10016709
326 Ga0157373_10002234
327 Ga0157373_10020533
328 Ga0157371_10000664
329 Ga0157371_10141148
330 Ga0157369_10200879
331 Ga0157374_10000147
332 Ga0157374_10004914
333 Ga0157374_10005626
334 Ga0157374_10117917
335 Ga0157374_10289246
336 Ga0157378_10016211
337 Ga0157378_10045158
338 Ga0157378_10253021
339 Ga0163162_10000044
340 Ga0163162_10000766
341 Ga0163162_10031450
342 Ga0163162_10046802
343 Ga0163162_10604468
344 Ga0157372_10001267
345 Ga0157372_10016266
346 Ga0157372_10048540
347 Ga0157372_10212837
348 Ga0157372_10322423
349 Ga0157372_10619944
350 Ga0157375_10000735
351 Ga0157375_10014654
352 Ga0157375_10030405
353 Ga0157375_10066561
354 Ga0157375_10383269
355 Ga0157375_10593992
356 Ga0163163_10002351
357 Ga0163163_10118570
358 Ga0163163_10213518
359 Ga0157380_10352267
360 Ga0157377_10018376
361 Ga0157377_10048424
362 Ga0157379_10893706
363 Ga0157376_10019530
364 Ga0157376_10603290
365 Ga0163161_10099295
366 Ga0213876_10014995
367 Ga0207427_101087
368 Ga0209437_100048
369 Ga0209233_1000029
370 Ga0209455_1001549
371 Ga0207680_10145390
372 Ga0207647_10000209
373 Ga0207647_10082867
374 Ga0207645_10001060
375 Ga0207705_10000102
376 Ga0207654_10023889
377 Ga0207654_10047780
378 Ga0207707_10074838
379 Ga0207707_10242310
380 Ga0207707_10298297
381 Ga0207695_10207777
382 Ga0207671_10002483
383 Ga0207671_10002992
384 Ga0207660_10005243
385 Ga0207660_10483505
386 Ga0207657_10025571
387 Ga0207657_10132887
388 Ga0207652_10000097
389 Ga0207652_10000157
390 Ga0207652_10016378
391 Ga0207681_10120329
392 Ga0207694_10218099
393 Ga0207694_10470823
394 Ga0207644_10005819
395 Ga0207644_10183285
396 Ga0207690_10059109
397 Ga0207690_10228281
398 Ga0207690_10305955
399 Ga0207690_10378691
400 Ga0207706_10000257
401 Ga0207706_10005816
402 Ga0207704_10000016
403 Ga0207691_10345885
404 Ga0207689_10302249
405 Ga0207661_10794627
406 Ga0207667_10000136
407 Ga0207667_10003048
408 Ga0207667_10007901
409 Ga0207667_10062083
410 Ga0207667_10244487
411 Ga0207712_10409395
412 Ga0207677_10266515
413 Ga0207639_10048738
414 Ga0207702_10000402
415 Ga0207702_10012611
416 Ga0207702_10148880
417 Ga0207641_10330790
418 Ga0207648_10107809
419 Ga0207676_10195793
420 Ga0207674_10012485
421 Ga0207674_10079346
422 Ga0207683_10015199
423 Ga0207698_10003621
424 Ga0207698_10342299
425 Ga0207698_11015415
426 Ga0268265_10207546
427 Ga0268264_10001415
428 Ga0268264_10008111
429 Ga0307517_10001005
430 Ga0265327_10000030
431 Ga0307510_10000638
432 Ga0373941_0142728
433 Ga0395899_0000426
434 Ga0395899_0000577
435 Ga0395899_0004840
436 Ga0395899_0004934
437 Ga0395899_0014753
438 Ga0395900_0000327
439 Ga0395900_0000686
440 Ga0395900_0000701
441 Ga0395900_0000752
442 Ga0395900_0001751
443 Ga0395900_0012635
444 Ga0395900_0167316
445 Ga0395900_0410037
446 Ga0395898_0002647
447 Ga0395898_0003757
448 Ga0395898_0008234
449 Ga0395898_0024830
450 Ga0395898_0195758
451 Ga0395905_0000461
452 Ga0395905_0002247
453 Ga0395905_0118450
454 Ga0395901_0000464
455 Ga0395901_0011773
456 Ga0395901_0027047
457 Ga0395901_0084925
458 Ga0395901_0089572
459 Ga0395901_0137380
460 Ga0395901_0833491
461 Ga0436365_1619686
462 Ga0439448_0007967
463 Ga0453684_0190850
464 Ga0451576_0195467
465 Ga0495592_0197146
466 Ga0495650_0053305
467 Ga0495631_0060611
468 Ga0495642_0098227
469 Ga0495652_0079100
470 Ga0495625_0186570
471 Ga0495625_0243428
472 Ga0495674_0307958
473 Ga0495687_000879
474 Ga0495686_0026850
475 Ga0496126_0461204
476 Ga0501031_0095998
477 Ga0501034_0131568
478 Ga0501034_0259058
479 Ga0501036_0008451
480 Ga0501037_0015405
481 Ga0501038_0049372
482 Ga0501038_0384168
483 Ga0501046_0052219
484 Ga0501080_0397270
485 Ga0501035_0090305
486 Ga0501044_0011934
487 Ga0501044_0605028
488 Ga0500608_000855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

85

206

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.8669 33 237
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.8541 31 237
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.8383 32 238
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.8252 32 240
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.8234 33 238
ID Description Score Start End Superfamily
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8178 21 237 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8085 32 238 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8048 33 247 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7972 28 237 3.40.50.10320
5cgzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7885 33 246 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A662GGP9-F1-model_v4 PIG-L family deacetylase 0.9488 33 238 GO:0016811
AF-A0A1J5PM63-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9484 104 247
AF-A0A1J5PM63-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9358 104 247
AF-A0A496T5B1-F1-model_v4 PIG-L family deacetylase 0.9352 34 158 GO:0016811
AF-W7Z4B9-F1-model_v4 deleted 0.9341 28 161

Map