F356272

General Info

Members Datasets Scaffolds Average Seq Length
244 128 488 303

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100243977|Ga0070694_1002439771
Length 309
Sequence VRSEPKRVCVAGAGVIGSLFAGYLARVADVTVLTRREEHANALNEGGLRVSGRGDFTSRVTAATSPEALPEPDLVIVASKGGDVESLAARLAGHWPGATLMTVQNGIGADEIVARHGAWPLLTAVTFMSGTRHADTHVEYVLDTATWIGPSRGTTVEDARAVAALIDSSGLKAEAFDDLRPAQWSKLIFNATVNTVAAVTGLRHDPHFAALDEPSDLGFLVRNLMDEGKAVAAAAGVTLDEDPWEMNVLATQRGHRHAPSMLEDVQAGRPTEVDMITGSLVREAHRLGVPVPLHEAMYSLIKGREASWE

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
125 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.3
Rhizosphere 87.7
Stem 0
Stem Tuber 0
Unclassified 17.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100243977 3300005444 Bacteria 1356
2 Ga0070658_10044421 3300005327 Bacteria 3591
3 Ga0070658_10056867 3300005327 Bacteria 3181
4 Ga0070658_10251344 3300005327 Bacteria 1500
5 Ga0070658_10485872 3300005327 Bacteria 1066
6 Ga0070683_100203775 3300005329 Unclassified 1879
7 Ga0070683_100217686 3300005329 Bacteria 1815
8 Ga0070680_100003049 3300005336 Bacteria 12438
9 Ga0070680_100033088 3300005336 Bacteria 4164
10 Ga0070660_100001274 3300005339 Bacteria 17185
11 Ga0070660_100006124 3300005339 Bacteria 8321
12 Ga0070660_100064856 3300005339 Bacteria 2842
13 Ga0070671_100026038 3300005355 Bacteria 4804
14 Ga0070659_100098719 3300005366 Bacteria 2348
15 Ga0070709_10107614 3300005434 Unclassified 1869
16 Ga0070714_100004981 3300005435 Bacteria 10094
17 Ga0070714_100010104 3300005435 Bacteria 7449
18 Ga0070714_100020134 3300005435 Bacteria 5445
19 Ga0070714_100021307 3300005435 Bacteria 5303
20 Ga0070711_100043887 3300005439 Bacteria 3031
21 Ga0070681_10055591 3300005458 Bacteria 3940
22 Ga0070681_10083082 3300005458 Bacteria 3157
23 Ga0070698_100054404 3300005471 Bacteria 4063
24 Ga0070679_100056640 3300005530 Bacteria 3906
25 Ga0070679_100203177 3300005530 Unclassified 1946
26 Ga0070679_100354273 3300005530 Bacteria 1415
27 Ga0070684_100019842 3300005535 Bacteria 5569
28 Ga0068853_100507795 3300005539 Unclassified 1139
29 Ga0068855_100083246 3300005563 Bacteria 3707
30 Ga0068855_100108747 3300005563 Bacteria 3184
31 Ga0068855_100148775 3300005563 Bacteria 2663
32 Ga0068855_100510175 3300005563 Unclassified 1306
33 Ga0068855_100525891 3300005563 Unclassified 1283
34 Ga0068857_100241462 3300005577 Unclassified 1654
35 Ga0081455_10234764 3300005937 Unclassified 1351
36 Ga0070712_100108532 3300006175 Unclassified 2067
37 Ga0075436_100024693 3300006914 Bacteria 4132
38 Ga0075436_100093133 3300006914 Bacteria 2095
39 Ga0105240_10416983 3300009093 Bacteria 1509
40 Ga0157370_10018322 3300013104 Bacteria 7043
41 Ga0157370_10071126 3300013104 Bacteria 3283
42 Ga0157370_10091163 3300013104 Unclassified 2862
43 Ga0157369_10011147 3300013105 Bacteria 10221
44 Ga0157369_10020388 3300013105 Bacteria 7411
45 Ga0157369_10022326 3300013105 Bacteria 7064
46 Ga0157369_10273625 3300013105 Unclassified 1759
47 Ga0157369_10374501 3300013105 Bacteria 1478
48 Ga0157369_10506302 3300013105 Bacteria 1249
49 Ga0182007_10053540 3300015262 Bacteria 1328
50 Ga0206356_11035672 3300020070 Bacteria 1645
51 Ga0206356_11755113 3300020070 Bacteria 6781
52 Ga0206353_10840906 3300020082 Bacteria 4345
53 Ga0206353_11760862 3300020082 Bacteria 3591
54 Ga0207699_10019701 3300025906 Bacteria 3603
55 Ga0207705_10040233 3300025909 Bacteria 3352
56 Ga0207705_10042503 3300025909 Bacteria 3263
57 Ga0207705_10088280 3300025909 Bacteria 2268
58 Ga0207705_10362325 3300025909 Bacteria 1118
59 Ga0207707_10020762 3300025912 Bacteria 5737
60 Ga0207707_10077768 3300025912 Bacteria 2896
61 Ga0207707_10081628 3300025912 Bacteria 2822
62 Ga0207707_10084969 3300025912 Bacteria 2765
63 Ga0207695_10351684 3300025913 Bacteria 1361
64 Ga0207663_10164600 3300025916 Bacteria 1569
65 Ga0207660_10372816 3300025917 Bacteria 1146
66 Ga0207657_10009267 3300025919 Bacteria 9917
67 Ga0207657_10014416 3300025919 Bacteria 7720
68 Ga0207657_10020425 3300025919 Bacteria 6259
69 Ga0207657_10077553 3300025919 Bacteria 2800
70 Ga0207657_10104888 3300025919 Bacteria 2341
71 Ga0207649_10209945 3300025920 Bacteria 1381
72 Ga0207652_10007162 3300025921 Bacteria 8995
73 Ga0207652_10089912 3300025921 Unclassified 2697
74 Ga0207652_10222427 3300025921 Bacteria 1701
75 Ga0207652_10380124 3300025921 Bacteria 1275
76 Ga0207700_10146531 3300025928 Bacteria 1946
77 Ga0207700_10265673 3300025928 Unclassified 1471
78 Ga0207664_10009424 3300025929 Bacteria 6851
79 Ga0207664_10011740 3300025929 Bacteria 6243
80 Ga0207664_10037791 3300025929 Bacteria 3739
81 Ga0207664_10188962 3300025929 Bacteria 1772
82 Ga0207664_10242487 3300025929 Bacteria 1570
83 Ga0207644_10038412 3300025931 Bacteria 3372
84 Ga0207690_10198011 3300025932 Bacteria 1524
85 Ga0207686_10040837 3300025934 Bacteria 2824
86 Ga0207661_10140387 3300025944 Unclassified 2079
87 Ga0207667_10183756 3300025949 Bacteria 2147
88 Ga0207667_10323230 3300025949 Unclassified 1576
89 Ga0207674_10243979 3300026116 Unclassified 1743
90 Ga0207698_10209471 3300026142 Bacteria 1753
91 Ga0265319_1001131 3300028563 Bacteria 16576
92 Ga0265319_1003410 3300028563 Bacteria 8300
93 Ga0265334_10000679 3300028573 Bacteria 17043
94 Ga0265334_10011458 3300028573 Unclassified 3733
95 Ga0265318_10001661 3300028577 Bacteria 12786
96 Ga0265318_10004002 3300028577 Bacteria 7243
97 Ga0265322_10033886 3300028654 Bacteria 1456
98 Ga0265322_10049743 3300028654 Unclassified 1190
99 Ga0265322_10050975 3300028654 Unclassified 1175
100 Ga0265338_10001443 3300028800 Bacteria 38590
101 Ga0265338_10005145 3300028800 Bacteria 17221
102 Ga0265338_10022691 3300028800 Bacteria 6482
103 Ga0265338_10050007 3300028800 Bacteria 3783
104 Ga0265338_10099524 3300028800 Bacteria 2374
105 Ga0265338_10152641 3300028800 Unclassified 1793
106 Ga0265324_10044733 3300029957 Bacteria 1526
107 Ga0265330_10003515 3300031235 Bacteria 8164
108 Ga0265328_10003815 3300031239 Bacteria 6624
109 Ga0265320_10003022 3300031240 Bacteria 11460
110 Ga0265329_10005179 3300031242 Bacteria 5303
111 Ga0265340_10003437 3300031247 Bacteria 8940
112 Ga0265340_10014292 3300031247 Bacteria 4152
113 Ga0265339_10004787 3300031249 Bacteria 9165
114 Ga0265331_10003344 3300031250 Bacteria 10405
115 Ga0265327_10006570 3300031251 Bacteria 9246
116 Ga0265327_10039339 3300031251 Bacteria 2569
117 Ga0265327_10066625 3300031251 Bacteria 1816
118 Ga0265327_10119645 3300031251 Bacteria 1249
119 Ga0265316_10027796 3300031344 Bacteria 4676
120 Ga0265313_10029730 3300031595 Bacteria 2822
121 Ga0265314_10009587 3300031711 Bacteria 8157
122 Ga0265314_10022143 3300031711 Bacteria 4871
123 Ga0265314_10023325 3300031711 Bacteria 4719
124 Ga0265342_10004174 3300031712 Bacteria 11498
125 Ga0265342_10006365 3300031712 Bacteria 8803
126 Ga0265342_10091957 3300031712 Bacteria 1738
127 Ga0307412_10180262 3300031911 Unclassified 1588
128 Ga0395900_0179517 3300037418 Bacteria 2152
129 Ga0395900_0341245 3300037418 Bacteria 1473
130 Ga0395898_0072759 3300037466 Bacteria 3320
131 Ga0395898_0074233 3300037466 Bacteria 3285
132 Ga0395898_0207622 3300037466 Unclassified 1869
133 Ga0395898_0243636 3300037466 Unclassified 1715
134 Ga0395901_0016341 3300038443 Bacteria 7558
135 Ga0466963_0003176 3300044694 Bacteria 9336
136 Ga0466963_0014512 3300044694 Bacteria 4859
137 Ga0466963_0085426 3300044694 Bacteria 2142
138 Ga0466963_0089308 3300044694 Bacteria 2096
139 Ga0466964_0117264 3300044706 Bacteria 1195
140 Ga0466957_0010377 3300044842 Bacteria 5344
141 Ga0466959_0018321 3300045049 Bacteria 5141
142 Ga0451576_0348573 3300045051 Unclassified 1550
143 Ga0466958_0003504 3300045836 Bacteria 8151
144 Ga0466958_0010935 3300045836 Bacteria 5098
145 Ga0466967_0000209 3300045976 Bacteria 24700
146 Ga0466967_0002179 3300045976 Bacteria 12048
147 Ga0466967_0023852 3300045976 Bacteria 5020
148 Ga0466967_0121234 3300045976 Bacteria 2416
149 Ga0466967_0128388 3300045976 Bacteria 2350
150 Ga0466967_0150975 3300045976 Bacteria 2171
151 Ga0466967_0184147 3300045976 Bacteria 1971
152 Ga0466967_0206047 3300045976 Bacteria 1864
153 Ga0466967_0232717 3300045976 Bacteria 1755
154 Ga0466967_0307488 3300045976 Bacteria 1526
155 Ga0495629_0046364 3300046459 Bacteria 3049
156 Ga0495641_0078132 3300046461 Bacteria 1483
157 Ga0495641_0134050 3300046461 Bacteria 1106
158 Ga0495651_0348685 3300046462 Bacteria 979
159 Ga0495653_0108674 3300046463 Unclassified 1997
160 Ga0495582_0215830 3300046473 Unclassified 1097
161 Ga0495664_0138837 3300046477 Bacteria 1473
162 Ga0495608_0055570 3300046511 Bacteria 2616
163 Ga0495608_0087743 3300046511 Bacteria 2014
164 Ga0495618_0009767 3300046514 Bacteria 5798
165 Ga0495628_0033165 3300046516 Bacteria 4164
166 Ga0495652_0035940 3300046529 Bacteria 4309
167 Ga0495652_0154016 3300046529 Bacteria 1792
168 Ga0495587_0013305 3300046536 Bacteria 5172
169 Ga0495645_0050570 3300046543 Bacteria 3026
170 Ga0495645_0148925 3300046543 Bacteria 1628
171 Ga0495667_0024061 3300046559 Bacteria 4102
172 Ga0495667_0100437 3300046559 Bacteria 1872
173 Ga0495634_0112346 3300046642 Bacteria 1751
174 Ga0495634_0141250 3300046642 Bacteria 1528
175 Ga0495635_0066024 3300046663 Bacteria 2482
176 Ga0495635_0114344 3300046663 Unclassified 1842
177 Ga0495635_0232682 3300046663 Unclassified 1245
178 Ga0495657_0025782 3300046675 Bacteria 4172
179 Ga0495657_0035143 3300046675 Bacteria 3475
180 Ga0495623_0033513 3300046679 Bacteria 3295
181 Ga0495613_0021563 3300046689 Bacteria 4799
182 Ga0495613_0081962 3300046689 Bacteria 2343
183 Ga0495613_0217495 3300046689 Unclassified 1342
184 Ga0495600_0031118 3300046809 Bacteria 3456
185 Ga0495604_0063806 3300047317 Bacteria 2809
186 Ga0495604_0241838 3300047317 Bacteria 1234
187 Ga0495674_0000162 3300047319 Bacteria 51804
188 Ga0495674_0109583 3300047319 Bacteria 2342
189 Ga0495674_0196528 3300047319 Unclassified 1675
190 Ga0495680_0000826 3300047322 Bacteria 34470
191 Ga0495680_0017408 3300047322 Bacteria 6138
192 Ga0495680_0102303 3300047322 Unclassified 2133
193 Ga0495684_0056129 3300047471 Bacteria 3003
194 Ga0495602_0276167 3300048088 Unclassified 1240
195 Ga0496100_0005507 3300048903 Bacteria 6829
196 Ga0496100_0082698 3300048903 Unclassified 2172
197 Ga0496101_0001562 3300048904 Bacteria 13723
198 Ga0496101_0033475 3300048904 Bacteria 3624
199 Ga0496102_0022596 3300048905 Bacteria 5573
200 Ga0496102_0039505 3300048905 Bacteria 4264
201 Ga0496102_0061827 3300048905 Bacteria 3429
202 Ga0496104_0077632 3300048907 Unclassified 3164
203 Ga0496105_0257517 3300048908 Unclassified 1412
204 Ga0496106_0328758 3300048909 Unclassified 1227
205 Ga0496107_0018843 3300048910 Bacteria 4865
206 Ga0496107_0035608 3300048910 Bacteria 3568
207 Ga0496108_0077399 3300048911 Unclassified 2813
208 Ga0496109_0078851 3300048912 Unclassified 3033
209 Ga0496110_0008761 3300048913 Bacteria 8151
210 Ga0496111_0057752 3300048914 Bacteria 2809
211 Ga0496112_0004991 3300048915 Bacteria 11379
212 Ga0496112_0039050 3300048915 Bacteria 4636
213 Ga0496112_0042568 3300048915 Bacteria 4443
214 Ga0496112_0188834 3300048915 Unclassified 2023
215 Ga0496112_0312946 3300048915 Bacteria 1515
216 Ga0496112_0330966 3300048915 Unclassified 1467
217 Ga0496113_0052560 3300048916 Bacteria 3044
218 Ga0496113_0258565 3300048916 Bacteria 1391
219 Ga0496114_0011934 3300048917 Bacteria 6952
220 Ga0496114_0016676 3300048917 Bacteria 5924
221 Ga0496114_0241999 3300048917 Bacteria 1587
222 Ga0496115_0004526 3300048918 Bacteria 10052
223 Ga0496115_0005272 3300048918 Bacteria 9398
224 Ga0496115_0050825 3300048918 Bacteria 3323
225 Ga0501034_0023982 3300049571 Bacteria 6209
226 Ga0501067_0025059 3300049583 Archaea 3308
227 Ga0501069_0023520 3300049585 Unclassified 3361
228 Ga0501070_0002361 3300049586 Bacteria 16549
229 Ga0501070_0002523 3300049586 Bacteria 16046
230 Ga0501072_0004748 3300049588 Bacteria 10343
231 Ga0501073_0014045 3300049589 Bacteria 5818
232 Ga0501074_0017539 3300049590 Bacteria 5197
233 Ga0501079_0016409 3300049741 Bacteria 5655
234 Ga0501080_0001169 3300049742 Bacteria 21714
235 Ga0501080_0199702 3300049742 Bacteria 1836
236 Ga0501083_0001948 3300049744 Bacteria 14197
237 Ga0495601_0036168 3300053077 Bacteria 3083
238 Ga0495655_0004007 3300053083 Unclassified 2483
239 Ga0495595_0025295 3300053084 Bacteria 2630
240 Ga0495619_0060309 3300053085 Bacteria 2521
241 Ga0495619_0060840 3300053085 Bacteria 2511
242 Ga0495619_0131637 3300053085 Bacteria 1719
243 Ga0501084_0041784 3300054114 Bacteria 3836
244 Ga0501082_0175916 3300060353 Bacteria 1861
245 Ga0070694_100243977
246 Ga0070658_10044421
247 Ga0070658_10056867
248 Ga0070658_10251344
249 Ga0070658_10485872
250 Ga0070683_100203775
251 Ga0070683_100217686
252 Ga0070680_100003049
253 Ga0070680_100033088
254 Ga0070660_100001274
255 Ga0070660_100006124
256 Ga0070660_100064856
257 Ga0070671_100026038
258 Ga0070659_100098719
259 Ga0070709_10107614
260 Ga0070714_100004981
261 Ga0070714_100010104
262 Ga0070714_100020134
263 Ga0070714_100021307
264 Ga0070711_100043887
265 Ga0070681_10055591
266 Ga0070681_10083082
267 Ga0070698_100054404
268 Ga0070679_100056640
269 Ga0070679_100203177
270 Ga0070679_100354273
271 Ga0070684_100019842
272 Ga0068853_100507795
273 Ga0068855_100083246
274 Ga0068855_100108747
275 Ga0068855_100148775
276 Ga0068855_100510175
277 Ga0068855_100525891
278 Ga0068857_100241462
279 Ga0081455_10234764
280 Ga0070712_100108532
281 Ga0075436_100024693
282 Ga0075436_100093133
283 Ga0105240_10416983
284 Ga0157370_10018322
285 Ga0157370_10071126
286 Ga0157370_10091163
287 Ga0157369_10011147
288 Ga0157369_10020388
289 Ga0157369_10022326
290 Ga0157369_10273625
291 Ga0157369_10374501
292 Ga0157369_10506302
293 Ga0182007_10053540
294 Ga0206356_11035672
295 Ga0206356_11755113
296 Ga0206353_10840906
297 Ga0206353_11760862
298 Ga0207699_10019701
299 Ga0207705_10040233
300 Ga0207705_10042503
301 Ga0207705_10088280
302 Ga0207705_10362325
303 Ga0207707_10020762
304 Ga0207707_10077768
305 Ga0207707_10081628
306 Ga0207707_10084969
307 Ga0207695_10351684
308 Ga0207663_10164600
309 Ga0207660_10372816
310 Ga0207657_10009267
311 Ga0207657_10014416
312 Ga0207657_10020425
313 Ga0207657_10077553
314 Ga0207657_10104888
315 Ga0207649_10209945
316 Ga0207652_10007162
317 Ga0207652_10089912
318 Ga0207652_10222427
319 Ga0207652_10380124
320 Ga0207700_10146531
321 Ga0207700_10265673
322 Ga0207664_10009424
323 Ga0207664_10011740
324 Ga0207664_10037791
325 Ga0207664_10188962
326 Ga0207664_10242487
327 Ga0207644_10038412
328 Ga0207690_10198011
329 Ga0207686_10040837
330 Ga0207661_10140387
331 Ga0207667_10183756
332 Ga0207667_10323230
333 Ga0207674_10243979
334 Ga0207698_10209471
335 Ga0265319_1001131
336 Ga0265319_1003410
337 Ga0265334_10000679
338 Ga0265334_10011458
339 Ga0265318_10001661
340 Ga0265318_10004002
341 Ga0265322_10033886
342 Ga0265322_10049743
343 Ga0265322_10050975
344 Ga0265338_10001443
345 Ga0265338_10005145
346 Ga0265338_10022691
347 Ga0265338_10050007
348 Ga0265338_10099524
349 Ga0265338_10152641
350 Ga0265324_10044733
351 Ga0265330_10003515
352 Ga0265328_10003815
353 Ga0265320_10003022
354 Ga0265329_10005179
355 Ga0265340_10003437
356 Ga0265340_10014292
357 Ga0265339_10004787
358 Ga0265331_10003344
359 Ga0265327_10006570
360 Ga0265327_10039339
361 Ga0265327_10066625
362 Ga0265327_10119645
363 Ga0265316_10027796
364 Ga0265313_10029730
365 Ga0265314_10009587
366 Ga0265314_10022143
367 Ga0265314_10023325
368 Ga0265342_10004174
369 Ga0265342_10006365
370 Ga0265342_10091957
371 Ga0307412_10180262
372 Ga0395900_0179517
373 Ga0395900_0341245
374 Ga0395898_0072759
375 Ga0395898_0074233
376 Ga0395898_0207622
377 Ga0395898_0243636
378 Ga0395901_0016341
379 Ga0466963_0003176
380 Ga0466963_0014512
381 Ga0466963_0085426
382 Ga0466963_0089308
383 Ga0466964_0117264
384 Ga0466957_0010377
385 Ga0466959_0018321
386 Ga0451576_0348573
387 Ga0466958_0003504
388 Ga0466958_0010935
389 Ga0466967_0000209
390 Ga0466967_0002179
391 Ga0466967_0023852
392 Ga0466967_0121234
393 Ga0466967_0128388
394 Ga0466967_0150975
395 Ga0466967_0184147
396 Ga0466967_0206047
397 Ga0466967_0232717
398 Ga0466967_0307488
399 Ga0495629_0046364
400 Ga0495641_0078132
401 Ga0495641_0134050
402 Ga0495651_0348685
403 Ga0495653_0108674
404 Ga0495582_0215830
405 Ga0495664_0138837
406 Ga0495608_0055570
407 Ga0495608_0087743
408 Ga0495618_0009767
409 Ga0495628_0033165
410 Ga0495652_0035940
411 Ga0495652_0154016
412 Ga0495587_0013305
413 Ga0495645_0050570
414 Ga0495645_0148925
415 Ga0495667_0024061
416 Ga0495667_0100437
417 Ga0495634_0112346
418 Ga0495634_0141250
419 Ga0495635_0066024
420 Ga0495635_0114344
421 Ga0495635_0232682
422 Ga0495657_0025782
423 Ga0495657_0035143
424 Ga0495623_0033513
425 Ga0495613_0021563
426 Ga0495613_0081962
427 Ga0495613_0217495
428 Ga0495600_0031118
429 Ga0495604_0063806
430 Ga0495604_0241838
431 Ga0495674_0000162
432 Ga0495674_0109583
433 Ga0495674_0196528
434 Ga0495680_0000826
435 Ga0495680_0017408
436 Ga0495680_0102303
437 Ga0495684_0056129
438 Ga0495602_0276167
439 Ga0496100_0005507
440 Ga0496100_0082698
441 Ga0496101_0001562
442 Ga0496101_0033475
443 Ga0496102_0022596
444 Ga0496102_0039505
445 Ga0496102_0061827
446 Ga0496104_0077632
447 Ga0496105_0257517
448 Ga0496106_0328758
449 Ga0496107_0018843
450 Ga0496107_0035608
451 Ga0496108_0077399
452 Ga0496109_0078851
453 Ga0496110_0008761
454 Ga0496111_0057752
455 Ga0496112_0004991
456 Ga0496112_0039050
457 Ga0496112_0042568
458 Ga0496112_0188834
459 Ga0496112_0312946
460 Ga0496112_0330966
461 Ga0496113_0052560
462 Ga0496113_0258565
463 Ga0496114_0011934
464 Ga0496114_0016676
465 Ga0496114_0241999
466 Ga0496115_0004526
467 Ga0496115_0005272
468 Ga0496115_0050825
469 Ga0501034_0023982
470 Ga0501067_0025059
471 Ga0501069_0023520
472 Ga0501070_0002361
473 Ga0501070_0002523
474 Ga0501072_0004748
475 Ga0501073_0014045
476 Ga0501074_0017539
477 Ga0501079_0016409
478 Ga0501080_0001169
479 Ga0501080_0199702
480 Ga0501083_0001948
481 Ga0495601_0036168
482 Ga0495655_0004007
483 Ga0495595_0025295
484 Ga0495619_0060309
485 Ga0495619_0060840
486 Ga0495619_0131637
487 Ga0501084_0041784
488 Ga0501082_0175916

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

8

153

0.95

PF08546

ApbA_C

Ketopantoate reductase PanE/ApbA C terminal

178

305

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f7l-assembly1.cif.gz_A crystal structure of lkce r326q mutant in complex with its substrate 0.9162 3 35
3hwr-assembly1.cif.gz_B crystal structure of pane/apba family ketopantoate reductase (yp_299159.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9119 5 302
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.9092 6 302
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.9039 6 300
5x20-assembly1.cif.gz_B the ternary structure of d-mandelate dehydrogenase with nadh and anilino(oxo)acetate 0.9015 5 302
ID Description Score Start End Superfamily
af_Q54LH3_697_827_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.912 179 300 1.10.1040.10
2ofpB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9033 176 299 1.10.1040.10
3egoB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8994 4 162 3.40.50.720
5hwsD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.8971 176 299 1.10.1040.10
5hwsD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8953 6 173 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W1KVW0-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9773 46 302 GO:0005737
GO:0008677
GO:0015940
AF-A0A1Q3VXL7-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9767 59 302 GO:0005737
GO:0008677
GO:0015940
AF-A0A538F1V7-F1-model_v4 2-dehydropantoate 2-reductase 0.9741 3 303 GO:0005737
GO:0008677
GO:0015940
AF-A0A2V9WCW6-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9657 4 295 GO:0005737
GO:0008677
GO:0015940
AF-A0A538F1V7-F1-model_v4 2-dehydropantoate 2-reductase 0.9646 3 303 GO:0005737
GO:0008677
GO:0015940

Map