F356272
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 244 | 128 | 488 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100243977|Ga0070694_1002439771 |
| Length | 309 |
| Sequence | VRSEPKRVCVAGAGVIGSLFAGYLARVADVTVLTRREEHANALNEGGLRVSGRGDFTSRVTAATSPEALPEPDLVIVASKGGDVESLAARLAGHWPGATLMTVQNGIGADEIVARHGAWPLLTAVTFMSGTRHADTHVEYVLDTATWIGPSRGTTVEDARAVAALIDSSGLKAEAFDDLRPAQWSKLIFNATVNTVAAVTGLRHDPHFAALDEPSDLGFLVRNLMDEGKAVAAAAGVTLDEDPWEMNVLATQRGHRHAPSMLEDVQAGRPTEVDMITGSLVREAHRLGVPVPLHEAMYSLIKGREASWE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 21 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 25 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 26 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 27 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 46 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 47 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 48 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 49 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 50 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 51 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 52 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 53 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 54 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 55 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 56 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 57 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 58 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 59 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 60 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 62 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 63 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 64 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 65 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 66 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 67 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 68 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 69 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 70 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 71 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 72 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 73 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 74 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 101 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 102 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 103 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 104 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 105 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 107 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 108 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 109 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 110 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 111 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 112 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 113 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.36 |
| Metatranscriptomes | 1.64 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 12.3 |
| Rhizosphere | 87.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070694_100243977 | 3300005444 | Bacteria | 1356 |
| 2 | Ga0070658_10044421 | 3300005327 | Bacteria | 3591 |
| 3 | Ga0070658_10056867 | 3300005327 | Bacteria | 3181 |
| 4 | Ga0070658_10251344 | 3300005327 | Bacteria | 1500 |
| 5 | Ga0070658_10485872 | 3300005327 | Bacteria | 1066 |
| 6 | Ga0070683_100203775 | 3300005329 | Unclassified | 1879 |
| 7 | Ga0070683_100217686 | 3300005329 | Bacteria | 1815 |
| 8 | Ga0070680_100003049 | 3300005336 | Bacteria | 12438 |
| 9 | Ga0070680_100033088 | 3300005336 | Bacteria | 4164 |
| 10 | Ga0070660_100001274 | 3300005339 | Bacteria | 17185 |
| 11 | Ga0070660_100006124 | 3300005339 | Bacteria | 8321 |
| 12 | Ga0070660_100064856 | 3300005339 | Bacteria | 2842 |
| 13 | Ga0070671_100026038 | 3300005355 | Bacteria | 4804 |
| 14 | Ga0070659_100098719 | 3300005366 | Bacteria | 2348 |
| 15 | Ga0070709_10107614 | 3300005434 | Unclassified | 1869 |
| 16 | Ga0070714_100004981 | 3300005435 | Bacteria | 10094 |
| 17 | Ga0070714_100010104 | 3300005435 | Bacteria | 7449 |
| 18 | Ga0070714_100020134 | 3300005435 | Bacteria | 5445 |
| 19 | Ga0070714_100021307 | 3300005435 | Bacteria | 5303 |
| 20 | Ga0070711_100043887 | 3300005439 | Bacteria | 3031 |
| 21 | Ga0070681_10055591 | 3300005458 | Bacteria | 3940 |
| 22 | Ga0070681_10083082 | 3300005458 | Bacteria | 3157 |
| 23 | Ga0070698_100054404 | 3300005471 | Bacteria | 4063 |
| 24 | Ga0070679_100056640 | 3300005530 | Bacteria | 3906 |
| 25 | Ga0070679_100203177 | 3300005530 | Unclassified | 1946 |
| 26 | Ga0070679_100354273 | 3300005530 | Bacteria | 1415 |
| 27 | Ga0070684_100019842 | 3300005535 | Bacteria | 5569 |
| 28 | Ga0068853_100507795 | 3300005539 | Unclassified | 1139 |
| 29 | Ga0068855_100083246 | 3300005563 | Bacteria | 3707 |
| 30 | Ga0068855_100108747 | 3300005563 | Bacteria | 3184 |
| 31 | Ga0068855_100148775 | 3300005563 | Bacteria | 2663 |
| 32 | Ga0068855_100510175 | 3300005563 | Unclassified | 1306 |
| 33 | Ga0068855_100525891 | 3300005563 | Unclassified | 1283 |
| 34 | Ga0068857_100241462 | 3300005577 | Unclassified | 1654 |
| 35 | Ga0081455_10234764 | 3300005937 | Unclassified | 1351 |
| 36 | Ga0070712_100108532 | 3300006175 | Unclassified | 2067 |
| 37 | Ga0075436_100024693 | 3300006914 | Bacteria | 4132 |
| 38 | Ga0075436_100093133 | 3300006914 | Bacteria | 2095 |
| 39 | Ga0105240_10416983 | 3300009093 | Bacteria | 1509 |
| 40 | Ga0157370_10018322 | 3300013104 | Bacteria | 7043 |
| 41 | Ga0157370_10071126 | 3300013104 | Bacteria | 3283 |
| 42 | Ga0157370_10091163 | 3300013104 | Unclassified | 2862 |
| 43 | Ga0157369_10011147 | 3300013105 | Bacteria | 10221 |
| 44 | Ga0157369_10020388 | 3300013105 | Bacteria | 7411 |
| 45 | Ga0157369_10022326 | 3300013105 | Bacteria | 7064 |
| 46 | Ga0157369_10273625 | 3300013105 | Unclassified | 1759 |
| 47 | Ga0157369_10374501 | 3300013105 | Bacteria | 1478 |
| 48 | Ga0157369_10506302 | 3300013105 | Bacteria | 1249 |
| 49 | Ga0182007_10053540 | 3300015262 | Bacteria | 1328 |
| 50 | Ga0206356_11035672 | 3300020070 | Bacteria | 1645 |
| 51 | Ga0206356_11755113 | 3300020070 | Bacteria | 6781 |
| 52 | Ga0206353_10840906 | 3300020082 | Bacteria | 4345 |
| 53 | Ga0206353_11760862 | 3300020082 | Bacteria | 3591 |
| 54 | Ga0207699_10019701 | 3300025906 | Bacteria | 3603 |
| 55 | Ga0207705_10040233 | 3300025909 | Bacteria | 3352 |
| 56 | Ga0207705_10042503 | 3300025909 | Bacteria | 3263 |
| 57 | Ga0207705_10088280 | 3300025909 | Bacteria | 2268 |
| 58 | Ga0207705_10362325 | 3300025909 | Bacteria | 1118 |
| 59 | Ga0207707_10020762 | 3300025912 | Bacteria | 5737 |
| 60 | Ga0207707_10077768 | 3300025912 | Bacteria | 2896 |
| 61 | Ga0207707_10081628 | 3300025912 | Bacteria | 2822 |
| 62 | Ga0207707_10084969 | 3300025912 | Bacteria | 2765 |
| 63 | Ga0207695_10351684 | 3300025913 | Bacteria | 1361 |
| 64 | Ga0207663_10164600 | 3300025916 | Bacteria | 1569 |
| 65 | Ga0207660_10372816 | 3300025917 | Bacteria | 1146 |
| 66 | Ga0207657_10009267 | 3300025919 | Bacteria | 9917 |
| 67 | Ga0207657_10014416 | 3300025919 | Bacteria | 7720 |
| 68 | Ga0207657_10020425 | 3300025919 | Bacteria | 6259 |
| 69 | Ga0207657_10077553 | 3300025919 | Bacteria | 2800 |
| 70 | Ga0207657_10104888 | 3300025919 | Bacteria | 2341 |
| 71 | Ga0207649_10209945 | 3300025920 | Bacteria | 1381 |
| 72 | Ga0207652_10007162 | 3300025921 | Bacteria | 8995 |
| 73 | Ga0207652_10089912 | 3300025921 | Unclassified | 2697 |
| 74 | Ga0207652_10222427 | 3300025921 | Bacteria | 1701 |
| 75 | Ga0207652_10380124 | 3300025921 | Bacteria | 1275 |
| 76 | Ga0207700_10146531 | 3300025928 | Bacteria | 1946 |
| 77 | Ga0207700_10265673 | 3300025928 | Unclassified | 1471 |
| 78 | Ga0207664_10009424 | 3300025929 | Bacteria | 6851 |
| 79 | Ga0207664_10011740 | 3300025929 | Bacteria | 6243 |
| 80 | Ga0207664_10037791 | 3300025929 | Bacteria | 3739 |
| 81 | Ga0207664_10188962 | 3300025929 | Bacteria | 1772 |
| 82 | Ga0207664_10242487 | 3300025929 | Bacteria | 1570 |
| 83 | Ga0207644_10038412 | 3300025931 | Bacteria | 3372 |
| 84 | Ga0207690_10198011 | 3300025932 | Bacteria | 1524 |
| 85 | Ga0207686_10040837 | 3300025934 | Bacteria | 2824 |
| 86 | Ga0207661_10140387 | 3300025944 | Unclassified | 2079 |
| 87 | Ga0207667_10183756 | 3300025949 | Bacteria | 2147 |
| 88 | Ga0207667_10323230 | 3300025949 | Unclassified | 1576 |
| 89 | Ga0207674_10243979 | 3300026116 | Unclassified | 1743 |
| 90 | Ga0207698_10209471 | 3300026142 | Bacteria | 1753 |
| 91 | Ga0265319_1001131 | 3300028563 | Bacteria | 16576 |
| 92 | Ga0265319_1003410 | 3300028563 | Bacteria | 8300 |
| 93 | Ga0265334_10000679 | 3300028573 | Bacteria | 17043 |
| 94 | Ga0265334_10011458 | 3300028573 | Unclassified | 3733 |
| 95 | Ga0265318_10001661 | 3300028577 | Bacteria | 12786 |
| 96 | Ga0265318_10004002 | 3300028577 | Bacteria | 7243 |
| 97 | Ga0265322_10033886 | 3300028654 | Bacteria | 1456 |
| 98 | Ga0265322_10049743 | 3300028654 | Unclassified | 1190 |
| 99 | Ga0265322_10050975 | 3300028654 | Unclassified | 1175 |
| 100 | Ga0265338_10001443 | 3300028800 | Bacteria | 38590 |
| 101 | Ga0265338_10005145 | 3300028800 | Bacteria | 17221 |
| 102 | Ga0265338_10022691 | 3300028800 | Bacteria | 6482 |
| 103 | Ga0265338_10050007 | 3300028800 | Bacteria | 3783 |
| 104 | Ga0265338_10099524 | 3300028800 | Bacteria | 2374 |
| 105 | Ga0265338_10152641 | 3300028800 | Unclassified | 1793 |
| 106 | Ga0265324_10044733 | 3300029957 | Bacteria | 1526 |
| 107 | Ga0265330_10003515 | 3300031235 | Bacteria | 8164 |
| 108 | Ga0265328_10003815 | 3300031239 | Bacteria | 6624 |
| 109 | Ga0265320_10003022 | 3300031240 | Bacteria | 11460 |
| 110 | Ga0265329_10005179 | 3300031242 | Bacteria | 5303 |
| 111 | Ga0265340_10003437 | 3300031247 | Bacteria | 8940 |
| 112 | Ga0265340_10014292 | 3300031247 | Bacteria | 4152 |
| 113 | Ga0265339_10004787 | 3300031249 | Bacteria | 9165 |
| 114 | Ga0265331_10003344 | 3300031250 | Bacteria | 10405 |
| 115 | Ga0265327_10006570 | 3300031251 | Bacteria | 9246 |
| 116 | Ga0265327_10039339 | 3300031251 | Bacteria | 2569 |
| 117 | Ga0265327_10066625 | 3300031251 | Bacteria | 1816 |
| 118 | Ga0265327_10119645 | 3300031251 | Bacteria | 1249 |
| 119 | Ga0265316_10027796 | 3300031344 | Bacteria | 4676 |
| 120 | Ga0265313_10029730 | 3300031595 | Bacteria | 2822 |
| 121 | Ga0265314_10009587 | 3300031711 | Bacteria | 8157 |
| 122 | Ga0265314_10022143 | 3300031711 | Bacteria | 4871 |
| 123 | Ga0265314_10023325 | 3300031711 | Bacteria | 4719 |
| 124 | Ga0265342_10004174 | 3300031712 | Bacteria | 11498 |
| 125 | Ga0265342_10006365 | 3300031712 | Bacteria | 8803 |
| 126 | Ga0265342_10091957 | 3300031712 | Bacteria | 1738 |
| 127 | Ga0307412_10180262 | 3300031911 | Unclassified | 1588 |
| 128 | Ga0395900_0179517 | 3300037418 | Bacteria | 2152 |
| 129 | Ga0395900_0341245 | 3300037418 | Bacteria | 1473 |
| 130 | Ga0395898_0072759 | 3300037466 | Bacteria | 3320 |
| 131 | Ga0395898_0074233 | 3300037466 | Bacteria | 3285 |
| 132 | Ga0395898_0207622 | 3300037466 | Unclassified | 1869 |
| 133 | Ga0395898_0243636 | 3300037466 | Unclassified | 1715 |
| 134 | Ga0395901_0016341 | 3300038443 | Bacteria | 7558 |
| 135 | Ga0466963_0003176 | 3300044694 | Bacteria | 9336 |
| 136 | Ga0466963_0014512 | 3300044694 | Bacteria | 4859 |
| 137 | Ga0466963_0085426 | 3300044694 | Bacteria | 2142 |
| 138 | Ga0466963_0089308 | 3300044694 | Bacteria | 2096 |
| 139 | Ga0466964_0117264 | 3300044706 | Bacteria | 1195 |
| 140 | Ga0466957_0010377 | 3300044842 | Bacteria | 5344 |
| 141 | Ga0466959_0018321 | 3300045049 | Bacteria | 5141 |
| 142 | Ga0451576_0348573 | 3300045051 | Unclassified | 1550 |
| 143 | Ga0466958_0003504 | 3300045836 | Bacteria | 8151 |
| 144 | Ga0466958_0010935 | 3300045836 | Bacteria | 5098 |
| 145 | Ga0466967_0000209 | 3300045976 | Bacteria | 24700 |
| 146 | Ga0466967_0002179 | 3300045976 | Bacteria | 12048 |
| 147 | Ga0466967_0023852 | 3300045976 | Bacteria | 5020 |
| 148 | Ga0466967_0121234 | 3300045976 | Bacteria | 2416 |
| 149 | Ga0466967_0128388 | 3300045976 | Bacteria | 2350 |
| 150 | Ga0466967_0150975 | 3300045976 | Bacteria | 2171 |
| 151 | Ga0466967_0184147 | 3300045976 | Bacteria | 1971 |
| 152 | Ga0466967_0206047 | 3300045976 | Bacteria | 1864 |
| 153 | Ga0466967_0232717 | 3300045976 | Bacteria | 1755 |
| 154 | Ga0466967_0307488 | 3300045976 | Bacteria | 1526 |
| 155 | Ga0495629_0046364 | 3300046459 | Bacteria | 3049 |
| 156 | Ga0495641_0078132 | 3300046461 | Bacteria | 1483 |
| 157 | Ga0495641_0134050 | 3300046461 | Bacteria | 1106 |
| 158 | Ga0495651_0348685 | 3300046462 | Bacteria | 979 |
| 159 | Ga0495653_0108674 | 3300046463 | Unclassified | 1997 |
| 160 | Ga0495582_0215830 | 3300046473 | Unclassified | 1097 |
| 161 | Ga0495664_0138837 | 3300046477 | Bacteria | 1473 |
| 162 | Ga0495608_0055570 | 3300046511 | Bacteria | 2616 |
| 163 | Ga0495608_0087743 | 3300046511 | Bacteria | 2014 |
| 164 | Ga0495618_0009767 | 3300046514 | Bacteria | 5798 |
| 165 | Ga0495628_0033165 | 3300046516 | Bacteria | 4164 |
| 166 | Ga0495652_0035940 | 3300046529 | Bacteria | 4309 |
| 167 | Ga0495652_0154016 | 3300046529 | Bacteria | 1792 |
| 168 | Ga0495587_0013305 | 3300046536 | Bacteria | 5172 |
| 169 | Ga0495645_0050570 | 3300046543 | Bacteria | 3026 |
| 170 | Ga0495645_0148925 | 3300046543 | Bacteria | 1628 |
| 171 | Ga0495667_0024061 | 3300046559 | Bacteria | 4102 |
| 172 | Ga0495667_0100437 | 3300046559 | Bacteria | 1872 |
| 173 | Ga0495634_0112346 | 3300046642 | Bacteria | 1751 |
| 174 | Ga0495634_0141250 | 3300046642 | Bacteria | 1528 |
| 175 | Ga0495635_0066024 | 3300046663 | Bacteria | 2482 |
| 176 | Ga0495635_0114344 | 3300046663 | Unclassified | 1842 |
| 177 | Ga0495635_0232682 | 3300046663 | Unclassified | 1245 |
| 178 | Ga0495657_0025782 | 3300046675 | Bacteria | 4172 |
| 179 | Ga0495657_0035143 | 3300046675 | Bacteria | 3475 |
| 180 | Ga0495623_0033513 | 3300046679 | Bacteria | 3295 |
| 181 | Ga0495613_0021563 | 3300046689 | Bacteria | 4799 |
| 182 | Ga0495613_0081962 | 3300046689 | Bacteria | 2343 |
| 183 | Ga0495613_0217495 | 3300046689 | Unclassified | 1342 |
| 184 | Ga0495600_0031118 | 3300046809 | Bacteria | 3456 |
| 185 | Ga0495604_0063806 | 3300047317 | Bacteria | 2809 |
| 186 | Ga0495604_0241838 | 3300047317 | Bacteria | 1234 |
| 187 | Ga0495674_0000162 | 3300047319 | Bacteria | 51804 |
| 188 | Ga0495674_0109583 | 3300047319 | Bacteria | 2342 |
| 189 | Ga0495674_0196528 | 3300047319 | Unclassified | 1675 |
| 190 | Ga0495680_0000826 | 3300047322 | Bacteria | 34470 |
| 191 | Ga0495680_0017408 | 3300047322 | Bacteria | 6138 |
| 192 | Ga0495680_0102303 | 3300047322 | Unclassified | 2133 |
| 193 | Ga0495684_0056129 | 3300047471 | Bacteria | 3003 |
| 194 | Ga0495602_0276167 | 3300048088 | Unclassified | 1240 |
| 195 | Ga0496100_0005507 | 3300048903 | Bacteria | 6829 |
| 196 | Ga0496100_0082698 | 3300048903 | Unclassified | 2172 |
| 197 | Ga0496101_0001562 | 3300048904 | Bacteria | 13723 |
| 198 | Ga0496101_0033475 | 3300048904 | Bacteria | 3624 |
| 199 | Ga0496102_0022596 | 3300048905 | Bacteria | 5573 |
| 200 | Ga0496102_0039505 | 3300048905 | Bacteria | 4264 |
| 201 | Ga0496102_0061827 | 3300048905 | Bacteria | 3429 |
| 202 | Ga0496104_0077632 | 3300048907 | Unclassified | 3164 |
| 203 | Ga0496105_0257517 | 3300048908 | Unclassified | 1412 |
| 204 | Ga0496106_0328758 | 3300048909 | Unclassified | 1227 |
| 205 | Ga0496107_0018843 | 3300048910 | Bacteria | 4865 |
| 206 | Ga0496107_0035608 | 3300048910 | Bacteria | 3568 |
| 207 | Ga0496108_0077399 | 3300048911 | Unclassified | 2813 |
| 208 | Ga0496109_0078851 | 3300048912 | Unclassified | 3033 |
| 209 | Ga0496110_0008761 | 3300048913 | Bacteria | 8151 |
| 210 | Ga0496111_0057752 | 3300048914 | Bacteria | 2809 |
| 211 | Ga0496112_0004991 | 3300048915 | Bacteria | 11379 |
| 212 | Ga0496112_0039050 | 3300048915 | Bacteria | 4636 |
| 213 | Ga0496112_0042568 | 3300048915 | Bacteria | 4443 |
| 214 | Ga0496112_0188834 | 3300048915 | Unclassified | 2023 |
| 215 | Ga0496112_0312946 | 3300048915 | Bacteria | 1515 |
| 216 | Ga0496112_0330966 | 3300048915 | Unclassified | 1467 |
| 217 | Ga0496113_0052560 | 3300048916 | Bacteria | 3044 |
| 218 | Ga0496113_0258565 | 3300048916 | Bacteria | 1391 |
| 219 | Ga0496114_0011934 | 3300048917 | Bacteria | 6952 |
| 220 | Ga0496114_0016676 | 3300048917 | Bacteria | 5924 |
| 221 | Ga0496114_0241999 | 3300048917 | Bacteria | 1587 |
| 222 | Ga0496115_0004526 | 3300048918 | Bacteria | 10052 |
| 223 | Ga0496115_0005272 | 3300048918 | Bacteria | 9398 |
| 224 | Ga0496115_0050825 | 3300048918 | Bacteria | 3323 |
| 225 | Ga0501034_0023982 | 3300049571 | Bacteria | 6209 |
| 226 | Ga0501067_0025059 | 3300049583 | Archaea | 3308 |
| 227 | Ga0501069_0023520 | 3300049585 | Unclassified | 3361 |
| 228 | Ga0501070_0002361 | 3300049586 | Bacteria | 16549 |
| 229 | Ga0501070_0002523 | 3300049586 | Bacteria | 16046 |
| 230 | Ga0501072_0004748 | 3300049588 | Bacteria | 10343 |
| 231 | Ga0501073_0014045 | 3300049589 | Bacteria | 5818 |
| 232 | Ga0501074_0017539 | 3300049590 | Bacteria | 5197 |
| 233 | Ga0501079_0016409 | 3300049741 | Bacteria | 5655 |
| 234 | Ga0501080_0001169 | 3300049742 | Bacteria | 21714 |
| 235 | Ga0501080_0199702 | 3300049742 | Bacteria | 1836 |
| 236 | Ga0501083_0001948 | 3300049744 | Bacteria | 14197 |
| 237 | Ga0495601_0036168 | 3300053077 | Bacteria | 3083 |
| 238 | Ga0495655_0004007 | 3300053083 | Unclassified | 2483 |
| 239 | Ga0495595_0025295 | 3300053084 | Bacteria | 2630 |
| 240 | Ga0495619_0060309 | 3300053085 | Bacteria | 2521 |
| 241 | Ga0495619_0060840 | 3300053085 | Bacteria | 2511 |
| 242 | Ga0495619_0131637 | 3300053085 | Bacteria | 1719 |
| 243 | Ga0501084_0041784 | 3300054114 | Bacteria | 3836 |
| 244 | Ga0501082_0175916 | 3300060353 | Bacteria | 1861 |
| 245 | Ga0070694_100243977 | |||
| 246 | Ga0070658_10044421 | |||
| 247 | Ga0070658_10056867 | |||
| 248 | Ga0070658_10251344 | |||
| 249 | Ga0070658_10485872 | |||
| 250 | Ga0070683_100203775 | |||
| 251 | Ga0070683_100217686 | |||
| 252 | Ga0070680_100003049 | |||
| 253 | Ga0070680_100033088 | |||
| 254 | Ga0070660_100001274 | |||
| 255 | Ga0070660_100006124 | |||
| 256 | Ga0070660_100064856 | |||
| 257 | Ga0070671_100026038 | |||
| 258 | Ga0070659_100098719 | |||
| 259 | Ga0070709_10107614 | |||
| 260 | Ga0070714_100004981 | |||
| 261 | Ga0070714_100010104 | |||
| 262 | Ga0070714_100020134 | |||
| 263 | Ga0070714_100021307 | |||
| 264 | Ga0070711_100043887 | |||
| 265 | Ga0070681_10055591 | |||
| 266 | Ga0070681_10083082 | |||
| 267 | Ga0070698_100054404 | |||
| 268 | Ga0070679_100056640 | |||
| 269 | Ga0070679_100203177 | |||
| 270 | Ga0070679_100354273 | |||
| 271 | Ga0070684_100019842 | |||
| 272 | Ga0068853_100507795 | |||
| 273 | Ga0068855_100083246 | |||
| 274 | Ga0068855_100108747 | |||
| 275 | Ga0068855_100148775 | |||
| 276 | Ga0068855_100510175 | |||
| 277 | Ga0068855_100525891 | |||
| 278 | Ga0068857_100241462 | |||
| 279 | Ga0081455_10234764 | |||
| 280 | Ga0070712_100108532 | |||
| 281 | Ga0075436_100024693 | |||
| 282 | Ga0075436_100093133 | |||
| 283 | Ga0105240_10416983 | |||
| 284 | Ga0157370_10018322 | |||
| 285 | Ga0157370_10071126 | |||
| 286 | Ga0157370_10091163 | |||
| 287 | Ga0157369_10011147 | |||
| 288 | Ga0157369_10020388 | |||
| 289 | Ga0157369_10022326 | |||
| 290 | Ga0157369_10273625 | |||
| 291 | Ga0157369_10374501 | |||
| 292 | Ga0157369_10506302 | |||
| 293 | Ga0182007_10053540 | |||
| 294 | Ga0206356_11035672 | |||
| 295 | Ga0206356_11755113 | |||
| 296 | Ga0206353_10840906 | |||
| 297 | Ga0206353_11760862 | |||
| 298 | Ga0207699_10019701 | |||
| 299 | Ga0207705_10040233 | |||
| 300 | Ga0207705_10042503 | |||
| 301 | Ga0207705_10088280 | |||
| 302 | Ga0207705_10362325 | |||
| 303 | Ga0207707_10020762 | |||
| 304 | Ga0207707_10077768 | |||
| 305 | Ga0207707_10081628 | |||
| 306 | Ga0207707_10084969 | |||
| 307 | Ga0207695_10351684 | |||
| 308 | Ga0207663_10164600 | |||
| 309 | Ga0207660_10372816 | |||
| 310 | Ga0207657_10009267 | |||
| 311 | Ga0207657_10014416 | |||
| 312 | Ga0207657_10020425 | |||
| 313 | Ga0207657_10077553 | |||
| 314 | Ga0207657_10104888 | |||
| 315 | Ga0207649_10209945 | |||
| 316 | Ga0207652_10007162 | |||
| 317 | Ga0207652_10089912 | |||
| 318 | Ga0207652_10222427 | |||
| 319 | Ga0207652_10380124 | |||
| 320 | Ga0207700_10146531 | |||
| 321 | Ga0207700_10265673 | |||
| 322 | Ga0207664_10009424 | |||
| 323 | Ga0207664_10011740 | |||
| 324 | Ga0207664_10037791 | |||
| 325 | Ga0207664_10188962 | |||
| 326 | Ga0207664_10242487 | |||
| 327 | Ga0207644_10038412 | |||
| 328 | Ga0207690_10198011 | |||
| 329 | Ga0207686_10040837 | |||
| 330 | Ga0207661_10140387 | |||
| 331 | Ga0207667_10183756 | |||
| 332 | Ga0207667_10323230 | |||
| 333 | Ga0207674_10243979 | |||
| 334 | Ga0207698_10209471 | |||
| 335 | Ga0265319_1001131 | |||
| 336 | Ga0265319_1003410 | |||
| 337 | Ga0265334_10000679 | |||
| 338 | Ga0265334_10011458 | |||
| 339 | Ga0265318_10001661 | |||
| 340 | Ga0265318_10004002 | |||
| 341 | Ga0265322_10033886 | |||
| 342 | Ga0265322_10049743 | |||
| 343 | Ga0265322_10050975 | |||
| 344 | Ga0265338_10001443 | |||
| 345 | Ga0265338_10005145 | |||
| 346 | Ga0265338_10022691 | |||
| 347 | Ga0265338_10050007 | |||
| 348 | Ga0265338_10099524 | |||
| 349 | Ga0265338_10152641 | |||
| 350 | Ga0265324_10044733 | |||
| 351 | Ga0265330_10003515 | |||
| 352 | Ga0265328_10003815 | |||
| 353 | Ga0265320_10003022 | |||
| 354 | Ga0265329_10005179 | |||
| 355 | Ga0265340_10003437 | |||
| 356 | Ga0265340_10014292 | |||
| 357 | Ga0265339_10004787 | |||
| 358 | Ga0265331_10003344 | |||
| 359 | Ga0265327_10006570 | |||
| 360 | Ga0265327_10039339 | |||
| 361 | Ga0265327_10066625 | |||
| 362 | Ga0265327_10119645 | |||
| 363 | Ga0265316_10027796 | |||
| 364 | Ga0265313_10029730 | |||
| 365 | Ga0265314_10009587 | |||
| 366 | Ga0265314_10022143 | |||
| 367 | Ga0265314_10023325 | |||
| 368 | Ga0265342_10004174 | |||
| 369 | Ga0265342_10006365 | |||
| 370 | Ga0265342_10091957 | |||
| 371 | Ga0307412_10180262 | |||
| 372 | Ga0395900_0179517 | |||
| 373 | Ga0395900_0341245 | |||
| 374 | Ga0395898_0072759 | |||
| 375 | Ga0395898_0074233 | |||
| 376 | Ga0395898_0207622 | |||
| 377 | Ga0395898_0243636 | |||
| 378 | Ga0395901_0016341 | |||
| 379 | Ga0466963_0003176 | |||
| 380 | Ga0466963_0014512 | |||
| 381 | Ga0466963_0085426 | |||
| 382 | Ga0466963_0089308 | |||
| 383 | Ga0466964_0117264 | |||
| 384 | Ga0466957_0010377 | |||
| 385 | Ga0466959_0018321 | |||
| 386 | Ga0451576_0348573 | |||
| 387 | Ga0466958_0003504 | |||
| 388 | Ga0466958_0010935 | |||
| 389 | Ga0466967_0000209 | |||
| 390 | Ga0466967_0002179 | |||
| 391 | Ga0466967_0023852 | |||
| 392 | Ga0466967_0121234 | |||
| 393 | Ga0466967_0128388 | |||
| 394 | Ga0466967_0150975 | |||
| 395 | Ga0466967_0184147 | |||
| 396 | Ga0466967_0206047 | |||
| 397 | Ga0466967_0232717 | |||
| 398 | Ga0466967_0307488 | |||
| 399 | Ga0495629_0046364 | |||
| 400 | Ga0495641_0078132 | |||
| 401 | Ga0495641_0134050 | |||
| 402 | Ga0495651_0348685 | |||
| 403 | Ga0495653_0108674 | |||
| 404 | Ga0495582_0215830 | |||
| 405 | Ga0495664_0138837 | |||
| 406 | Ga0495608_0055570 | |||
| 407 | Ga0495608_0087743 | |||
| 408 | Ga0495618_0009767 | |||
| 409 | Ga0495628_0033165 | |||
| 410 | Ga0495652_0035940 | |||
| 411 | Ga0495652_0154016 | |||
| 412 | Ga0495587_0013305 | |||
| 413 | Ga0495645_0050570 | |||
| 414 | Ga0495645_0148925 | |||
| 415 | Ga0495667_0024061 | |||
| 416 | Ga0495667_0100437 | |||
| 417 | Ga0495634_0112346 | |||
| 418 | Ga0495634_0141250 | |||
| 419 | Ga0495635_0066024 | |||
| 420 | Ga0495635_0114344 | |||
| 421 | Ga0495635_0232682 | |||
| 422 | Ga0495657_0025782 | |||
| 423 | Ga0495657_0035143 | |||
| 424 | Ga0495623_0033513 | |||
| 425 | Ga0495613_0021563 | |||
| 426 | Ga0495613_0081962 | |||
| 427 | Ga0495613_0217495 | |||
| 428 | Ga0495600_0031118 | |||
| 429 | Ga0495604_0063806 | |||
| 430 | Ga0495604_0241838 | |||
| 431 | Ga0495674_0000162 | |||
| 432 | Ga0495674_0109583 | |||
| 433 | Ga0495674_0196528 | |||
| 434 | Ga0495680_0000826 | |||
| 435 | Ga0495680_0017408 | |||
| 436 | Ga0495680_0102303 | |||
| 437 | Ga0495684_0056129 | |||
| 438 | Ga0495602_0276167 | |||
| 439 | Ga0496100_0005507 | |||
| 440 | Ga0496100_0082698 | |||
| 441 | Ga0496101_0001562 | |||
| 442 | Ga0496101_0033475 | |||
| 443 | Ga0496102_0022596 | |||
| 444 | Ga0496102_0039505 | |||
| 445 | Ga0496102_0061827 | |||
| 446 | Ga0496104_0077632 | |||
| 447 | Ga0496105_0257517 | |||
| 448 | Ga0496106_0328758 | |||
| 449 | Ga0496107_0018843 | |||
| 450 | Ga0496107_0035608 | |||
| 451 | Ga0496108_0077399 | |||
| 452 | Ga0496109_0078851 | |||
| 453 | Ga0496110_0008761 | |||
| 454 | Ga0496111_0057752 | |||
| 455 | Ga0496112_0004991 | |||
| 456 | Ga0496112_0039050 | |||
| 457 | Ga0496112_0042568 | |||
| 458 | Ga0496112_0188834 | |||
| 459 | Ga0496112_0312946 | |||
| 460 | Ga0496112_0330966 | |||
| 461 | Ga0496113_0052560 | |||
| 462 | Ga0496113_0258565 | |||
| 463 | Ga0496114_0011934 | |||
| 464 | Ga0496114_0016676 | |||
| 465 | Ga0496114_0241999 | |||
| 466 | Ga0496115_0004526 | |||
| 467 | Ga0496115_0005272 | |||
| 468 | Ga0496115_0050825 | |||
| 469 | Ga0501034_0023982 | |||
| 470 | Ga0501067_0025059 | |||
| 471 | Ga0501069_0023520 | |||
| 472 | Ga0501070_0002361 | |||
| 473 | Ga0501070_0002523 | |||
| 474 | Ga0501072_0004748 | |||
| 475 | Ga0501073_0014045 | |||
| 476 | Ga0501074_0017539 | |||
| 477 | Ga0501079_0016409 | |||
| 478 | Ga0501080_0001169 | |||
| 479 | Ga0501080_0199702 | |||
| 480 | Ga0501083_0001948 | |||
| 481 | Ga0495601_0036168 | |||
| 482 | Ga0495655_0004007 | |||
| 483 | Ga0495595_0025295 | |||
| 484 | Ga0495619_0060309 | |||
| 485 | Ga0495619_0060840 | |||
| 486 | Ga0495619_0131637 | |||
| 487 | Ga0501084_0041784 | |||
| 488 | Ga0501082_0175916 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6f7l-assembly1.cif.gz_A | crystal structure of lkce r326q mutant in complex with its substrate | 0.9162 | 3 | 35 |
| 3hwr-assembly1.cif.gz_B | crystal structure of pane/apba family ketopantoate reductase (yp_299159.1) from ralstonia eutropha jmp134 at 2.15 a resolution | 0.9119 | 5 | 302 |
| 5ayv-assembly1.cif.gz_A | crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate | 0.9092 | 6 | 302 |
| 5hws-assembly1.cif.gz_D | crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ | 0.9039 | 6 | 300 |
| 5x20-assembly1.cif.gz_B | the ternary structure of d-mandelate dehydrogenase with nadh and anilino(oxo)acetate | 0.9015 | 5 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54LH3_697_827_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.912 | 179 | 300 | 1.10.1040.10 |
| 2ofpB02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9033 | 176 | 299 | 1.10.1040.10 |
| 3egoB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8994 | 4 | 162 | 3.40.50.720 |
| 5hwsD02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.8971 | 176 | 299 | 1.10.1040.10 |
| 5hwsD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8953 | 6 | 173 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1KVW0-F1-model_v4 | 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) | 0.9773 | 46 | 302 |
GO:0005737
GO:0008677 GO:0015940 |
| AF-A0A1Q3VXL7-F1-model_v4 | 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) | 0.9767 | 59 | 302 |
GO:0005737
GO:0008677 GO:0015940 |
| AF-A0A538F1V7-F1-model_v4 | 2-dehydropantoate 2-reductase | 0.9741 | 3 | 303 |
GO:0005737
GO:0008677 GO:0015940 |
| AF-A0A2V9WCW6-F1-model_v4 | 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) | 0.9657 | 4 | 295 |
GO:0005737
GO:0008677 GO:0015940 |
| AF-A0A538F1V7-F1-model_v4 | 2-dehydropantoate 2-reductase | 0.9646 | 3 | 303 |
GO:0005737
GO:0008677 GO:0015940 |