F356245

General Info

Members Datasets Scaffolds Average Seq Length
244 160 245 268

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100000001|Ga0070667_100000001769
Length 298
Sequence MYSGTTLVPLKRFDAWFGAHQKIDRIARRNLATLLKASSSAVPQTGDILKFEGLNGPDGIKRKTPAKDEPWHYYDPSDPYDSKILRLIDDQYQELVAAMRAGDQVRAAFEMAWLAHALVDGLTPAHHYPYEEELTKLRGGAGKETRTSVKEKVLMPGGTLGERVSNNWKMWGDKGLLATHFAFEWGIAVMISPLRLRQSMPTSEEVESAVGKPITQLFHEHATAVADLKMYDYFYRYGWTLHLAKVARRQLVPGIINAVTLAWYKAAVEAGVIDDPKRMQKPHAGPTKARQAKRSSKR

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
48 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
86 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
87 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
88 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
91 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
101 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
102 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
103 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
104 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
105 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
106 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
107 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
139 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
145 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
149 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
150 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
151 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
152 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
153 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
154 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
155 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
159 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
160 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.82
Nodule 0
Rhizoplane 1.23
Rhizosphere 70.08
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10000395 3300002244 Bacteria 6490
2 rootH2_10006847 3300003320 Bacteria 155484
3 rootH1_10014171 3300003316 Bacteria 5942
4 rootH1_10014171 3300003323 Bacteria 48844
5 rootH1_10251479 3300003323 Unclassified 1378
6 rootH1_10287665 3300003323 Bacteria 1424
7 JGI25405J52794_10000521 3300003911 Bacteria 5564
8 Ga0070658_10000012 3300005327 Bacteria 277871
9 Ga0070676_10015889 3300005328 Bacteria 4153
10 Ga0070676_10038828 3300005328 Bacteria 2751
11 Ga0070690_100000942 3300005330 Bacteria 14855
12 Ga0070670_100230017 3300005331 Unclassified 1614
13 Ga0070660_100001370 3300005339 Bacteria 16550
14 Ga0070660_100130005 3300005339 Bacteria 2014
15 Ga0070674_100005957 3300005356 Bacteria 7087
16 Ga0070673_100000224 3300005364 Bacteria 28378
17 Ga0070667_100000001 3300005367 Bacteria 1108638
18 Ga0070667_100023554 3300005367 Bacteria 5110
19 Ga0070678_100009843 3300005456 Bacteria 5812
20 Ga0070681_10010536 3300005458 Bacteria 9128
21 Ga0068867_100009996 3300005459 Bacteria 6687
22 Ga0070685_10000215 3300005466 Bacteria 38049
23 Ga0070685_10001953 3300005466 Bacteria 10699
24 Ga0070679_100002235 3300005530 Bacteria 17482
25 Ga0070679_100120997 3300005530 Bacteria 2602
26 Ga0068853_100050418 3300005539 Bacteria 3581
27 Ga0070672_100003068 3300005543 Bacteria 10769
28 Ga0070686_100016974 3300005544 Bacteria 4244
29 Ga0070665_100085697 3300005548 Bacteria 3156
30 Ga0070665_100141336 3300005548 Bacteria 2410
31 Ga0068855_100000011 3300005563 Bacteria 244140
32 Ga0068855_100002823 3300005563 Bacteria 21389
33 Ga0068855_100019950 3300005563 Bacteria 8051
34 Ga0068854_100049305 3300005578 Unclassified 3007
35 Ga0068856_100000001 3300005614 Bacteria 565602
36 Ga0068856_100007844 3300005614 Bacteria 10425
37 Ga0068856_100075177 3300005614 Bacteria 3346
38 Ga0068852_100015756 3300005616 Bacteria 5877
39 Ga0068859_100876053 3300005617 Bacteria 983
40 Ga0068863_100245607 3300005841 Bacteria 1728
41 Ga0068860_100004028 3300005843 Bacteria 15089
42 Ga0081455_10000001 3300005937 Bacteria 603871
43 Ga0075365_10000001 3300006038 Bacteria 371589
44 Ga0075365_10000027 3300006038 Bacteria 58640
45 Ga0075365_10015555 3300006038 Bacteria 4605
46 Ga0075365_10056605 3300006038 Bacteria 2607
47 Ga0075365_10077286 3300006038 Bacteria 2249
48 Ga0075365_10131230 3300006038 Bacteria 1734
49 Ga0075368_10000159 3300006042 Bacteria 18278
50 Ga0075363_100017939 3300006048 Bacteria 3518
51 Ga0075364_10015522 3300006051 Bacteria 4726
52 Ga0075364_10016312 3300006051 Bacteria 4619
53 Ga0075364_10017104 3300006051 Bacteria 4525
54 Ga0075362_10021832 3300006177 Bacteria 2692
55 Ga0075369_10000229 3300006186 Bacteria 16498
56 Ga0075366_10000347 3300006195 Bacteria 21166
57 Ga0075366_10037452 3300006195 Bacteria 2864
58 Ga0075366_10052005 3300006195 Bacteria 2434
59 Ga0097620_100876035 3300006931 Bacteria 983
60 Ga0105240_10000003 3300009093 Bacteria 1183681
61 Ga0105240_10000004 3300009093 Bacteria 708156
62 Ga0105240_10001464 3300009093 Bacteria 40351
63 Ga0105240_10471179 3300009093 Bacteria 1401
64 Ga0105245_10001120 3300009098 Bacteria 24232
65 Ga0105243_10000001 3300009148 Bacteria 1156578
66 Ga0105241_10001167 3300009174 Bacteria 19988
67 Ga0105242_10000135 3300009176 Bacteria 53544
68 Ga0105248_10226694 3300009177 Unclassified 2103
69 Ga0105237_10000001 3300009545 Bacteria 1009213
70 Ga0105237_10016883 3300009545 Bacteria 7575
71 Ga0105238_10023152 3300009551 Bacteria 6334
72 Ga0105249_10092304 3300009553 Bacteria 2834
73 Ga0105032_100001 3300009979 Bacteria 472394
74 Ga0105032_100005 3300009979 Bacteria 119893
75 Ga0105028_100305 3300009993 Bacteria 5301
76 Ga0105239_10041980 3300010375 Bacteria 5011
77 Ga0105239_10077883 3300010375 Bacteria 3648
78 Ga0105239_10360809 3300010375 Bacteria 1641
79 Ga0157370_10001934 3300013104 Bacteria 25503
80 Ga0157370_10152424 3300013104 Bacteria 2151
81 Ga0157369_10000009 3300013105 Bacteria 303674
82 Ga0157369_10004669 3300013105 Bacteria 16101
83 Ga0157369_10019746 3300013105 Bacteria 7541
84 Ga0157374_10000195 3300013296 Bacteria 56142
85 Ga0157374_10006505 3300013296 Bacteria 9922
86 Ga0157374_10178824 3300013296 Bacteria 2071
87 Ga0157378_10133940 3300013297 Bacteria 2296
88 Ga0157378_10378624 3300013297 Bacteria 1389
89 Ga0163162_10748528 3300013306 Bacteria 1097
90 Ga0157372_10000002 3300013307 Bacteria 687862
91 Ga0157372_10185367 3300013307 Bacteria 2410
92 Ga0157372_10969121 3300013307 Unclassified 985
93 Ga0163163_10073063 3300014325 Bacteria 3420
94 Ga0157377_10002876 3300014745 Bacteria 7692
95 Ga0157376_10000001 3300014969 Bacteria 842910
96 Ga0207647_10000506 3300025904 Bacteria 31217
97 Ga0207645_10001659 3300025907 Bacteria 18129
98 Ga0207645_10039305 3300025907 Bacteria 3032
99 Ga0207705_10000056 3300025909 Bacteria 157554
100 Ga0207705_10060136 3300025909 Bacteria 2743
101 Ga0207654_10000623 3300025911 Bacteria 20022
102 Ga0207707_10002145 3300025912 Bacteria 17855
103 Ga0207707_10049305 3300025912 Bacteria 3668
104 Ga0207695_10000005 3300025913 Bacteria 1196715
105 Ga0207695_10000009 3300025913 Bacteria 1034276
106 Ga0207695_10003030 3300025913 Bacteria 24119
107 Ga0207671_10000003 3300025914 Bacteria 1065461
108 Ga0207671_10018687 3300025914 Bacteria 5311
109 Ga0207657_10082583 3300025919 Bacteria 2697
110 Ga0207694_10340856 3300025924 Bacteria 1239
111 Ga0207687_10007560 3300025927 Bacteria 7146
112 Ga0207687_10014067 3300025927 Bacteria 5232
113 Ga0207686_10000001 3300025934 Bacteria 1169580
114 Ga0207709_10000002 3300025935 Bacteria 1171536
115 Ga0207667_10000042 3300025949 Bacteria 263461
116 Ga0207667_10008949 3300025949 Bacteria 11840
117 Ga0207651_10000167 3300025960 Bacteria 28415
118 Ga0207640_10136245 3300025981 Bacteria 1783
119 Ga0207658_10000003 3300025986 Bacteria 1151934
120 Ga0207658_10139418 3300025986 Bacteria 1960
121 Ga0207639_10032041 3300026041 Bacteria 3867
122 Ga0207702_10000001 3300026078 Bacteria 895738
123 Ga0207702_10006082 3300026078 Bacteria 10466
124 Ga0207641_10123675 3300026088 Bacteria 2313
125 Ga0207698_10710693 3300026142 Bacteria 1001
126 Ga0209968_1015604 3300027526 Bacteria 1203
127 Ga0209813_10000919 3300027866 Bacteria 6631
128 Ga0268266_10010164 3300028379 Bacteria 8246
129 Ga0268264_10011549 3300028381 Bacteria 7296
130 Ga0265334_10000184 3300028573 Bacteria 36597
131 Ga0265338_10000052 3300028800 Bacteria 209239
132 Ga0265338_10000192 3300028800 Bacteria 115195
133 Ga0265338_10000601 3300028800 Bacteria 63282
134 Ga0265338_10170168 3300028800 Bacteria 1672
135 Ga0314311_1045309 3300030733 Bacteria 5466
136 Ga0316179_1062152 3300030734 Bacteria 5891
137 Ga0316179_1063613 3300030734 Bacteria 1420
138 Ga0316178_1056808 3300030735 Bacteria 2192
139 Ga0316183_1122191 3300030742 Bacteria 1176
140 Ga0316183_1129097 3300030742 Bacteria 17337
141 Ga0316183_1209681 3300030742 Bacteria 11993
142 Ga0316181_1005749 3300030744 Bacteria 60322
143 Ga0316182_1037919 3300030745 Bacteria 12378
144 Ga0316182_1062064 3300030745 Bacteria 4797
145 Ga0316182_1100663 3300030745 Bacteria 2663
146 Ga0316182_1104433 3300030745 Bacteria 15309
147 Ga0316182_1133447 3300030745 Bacteria 2254
148 Ga0265340_10001568 3300031247 Bacteria 13122
149 Ga0265327_10000017 3300031251 Bacteria 445264
150 Ga0307516_10003356 3300031730 Bacteria 20712
151 Ga0373959_0000062 3300034820 Bacteria 24666
152 Ga0395899_0003092 3300037312 Bacteria 13251
153 Ga0395899_0457952 3300037312 Unclassified 834
154 Ga0395900_0231109 3300037418 Bacteria 1860
155 Ga0395898_0024777 3300037466 Bacteria 6049
156 Ga0395905_0000238 3300037471 Bacteria 83164
157 Ga0395905_0003963 3300037471 Bacteria 15579
158 Ga0395901_0004611 3300038443 Bacteria 13907
159 Ga0395901_0027196 3300038443 Bacteria 5876
160 Ga0395901_0053393 3300038443 Bacteria 4199
161 Ga0439438_009683 3300041405 Bacteria 3103
162 Ga0439461_0000340 3300041410 Bacteria 6656
163 Ga0439461_0001953 3300041410 Bacteria 3252
164 Ga0451807_0302457 3300041486 Unclassified 878
165 Ga0439445_0000290 3300042004 Bacteria 9733
166 Ga0439432_004047 3300042006 Bacteria 5376
167 Ga0439463_016686 3300042016 Bacteria 1816
168 Ga0450920_001733 3300042122 Bacteria 3657
169 Ga0450906_003147 3300042145 Bacteria 3566
170 Ga0439446_0000001 3300042156 Bacteria 275840
171 Ga0439446_0000374 3300042156 Bacteria 8605
172 Ga0439434_0000740 3300042435 Bacteria 9369
173 Ga0439434_0030017 3300042435 Bacteria 1649
174 Ga0466965_0002916 3300044683 Bacteria 7393
175 Ga0495638_0000070 3300046460 Bacteria 166954
176 Ga0495638_0000883 3300046460 Bacteria 30865
177 Ga0495597_0022702 3300046542 Bacteria 2909
178 Ga0495588_0059982 3300046674 Bacteria 1969
179 Ga0495660_0000005 3300046810 Bacteria 574567
180 Ga0496100_0116138 3300048903 Bacteria 1867
181 Ga0496112_0020640 3300048915 Bacteria 6247
182 Ga0496124_0133062 3300048927 Bacteria 1973
183 Ga0496125_0165768 3300048928 Bacteria 1493
184 Ga0501032_0022101 3300049569 Bacteria 4415
185 Ga0501033_0067427 3300049570 Bacteria 2631
186 Ga0501034_0000241 3300049571 Bacteria 101160
187 Ga0501034_0005296 3300049571 Bacteria 14147
188 Ga0501036_0062688 3300049572 Bacteria 3149
189 Ga0501037_0000001 3300049573 Bacteria 753276
190 Ga0501037_0173650 3300049573 Bacteria 1531
191 Ga0501037_0395050 3300049573 Bacteria 949
192 Ga0501038_0099769 3300049574 Bacteria 2420
193 Ga0501043_0156713 3300049579 Bacteria 1781
194 Ga0501047_0000229 3300049581 Bacteria 66412
195 Ga0501080_0002131 3300049742 Bacteria 17194
196 Ga0501083_0032584 3300049744 Bacteria 3573
197 Ga0501083_0061706 3300049744 Bacteria 2503
198 Ga0501035_0000033 3300049822 Bacteria 175087
199 Ga0501044_0175327 3300049823 Bacteria 2113
200 nmdc:mga03683_14445_c1 3300050489 Bacteria 2922
201 nmdc:mga00v17_2342_c1 3300050491 Bacteria 9699
202 nmdc:mga00v17_67662_c1 3300050491 Bacteria 2207
203 nmdc:mga0yw44_103374_c1 3300050492 Unclassified 1817
204 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
205 nmdc:mga0yw44_49782_c1 3300050492 Bacteria 2530
206 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
207 nmdc:mga0yw44_99533_c1 3300050492 Bacteria 1850
208 nmdc:mga0yw44_9_c1 3300050492 Bacteria 178503
209 nmdc:mga0k408_39820_c1 3300050493 Bacteria 2702
210 nmdc:mga0k408_48145_c1 3300050493 Bacteria 2465
211 nmdc:mga06z11_459_c1 3300050494 Bacteria 15189
212 nmdc:mga04h51_6146_c1 3300050495 Bacteria 3098
213 nmdc:mga07m45_79419_c1 3300050496 Bacteria 1873
214 nmdc:mga0sz30_798_c1 3300050516 Bacteria 11425
215 Ga0500643_000010 3300053087 Bacteria 408084
216 Ga0500643_000011 3300053087 Bacteria 385630
217 Ga0500644_0002138 3300053088 Bacteria 5002
218 Ga0500646_0000011 3300053090 Bacteria 87823
219 Ga0500646_0000261 3300053090 Bacteria 16106
220 Ga0500646_0010043 3300053090 Bacteria 2426
221 Ga0500583_0000510 3300053092 Bacteria 11926
222 Ga0500583_0027757 3300053092 Bacteria 2447
223 Ga0500651_0000001 3300053093 Bacteria 529808
224 Ga0500651_0000240 3300053093 Bacteria 33761
225 Ga0500651_0000452 3300053093 Bacteria 21958
226 Ga0500641_0000001 3300053096 Bacteria 1115973
227 Ga0500650_0000001 3300053098 Bacteria 818797
228 Ga0500555_000006 3300053103 Bacteria 304416
229 Ga0500562_015122 3300053108 Unclassified 1979
230 Ga0500569_000030 3300053109 Bacteria 30416
231 Ga0500593_032501 3300053117 Bacteria 2336
232 Ga0500594_0000001 3300053118 Bacteria 1178472
233 Ga0500594_0000042 3300053118 Bacteria 40531
234 Ga0500614_000280 3300053123 Bacteria 13247
235 Ga0500652_000001 3300053131 Bacteria 946868
236 Ga0500655_000553 3300053133 Bacteria 7513
237 Ga0500577_0001896 3300053142 Bacteria 5358
238 Ga0500579_001549 3300053143 Bacteria 13507
239 Ga0500588_0000063 3300053146 Bacteria 16701
240 Ga0500616_0000012 3300053153 Bacteria 681798
241 Ga0500633_0000659 3300053160 Bacteria 5767
242 Ga0500570_003446 3300053724 Bacteria 8134
243 Ga0500570_078895 3300053724 Unclassified 1494
244 Ga0500570_108952 3300053724 Bacteria 1132
245 Ga0500656_000451 3300053732 Bacteria 3016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_0302457 Ga0451807_0302457_133_861 221
2 3300037312 Ga0395899_0457952 Ga0395899_0457952_71_799 241
3 3300006042 Ga0075368_10000159 Ga0075368_1000015915 252
4 3300006048 Ga0075363_100017939 Ga0075363_1000179392 252
5 3300006051 Ga0075364_10016312 Ga0075364_100163122 252
6 3300006177 Ga0075362_10021832 Ga0075362_100218324 252
7 3300006186 Ga0075369_10000229 Ga0075369_100002299 252
8 3300006195 Ga0075366_10037452 Ga0075366_100374524 252
9 3300027866 Ga0209813_10000919 Ga0209813_100009192 252
10 3300050489 nmdc:mga03683_14445_c1 nmdc:mga03683_14445_c1_733_1494 252
11 3300050491 nmdc:mga00v17_2342_c1 nmdc:mga00v17_2342_c1_3651_4412 252
12 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_414962_415723 252
13 3300050493 nmdc:mga0k408_39820_c1 nmdc:mga0k408_39820_c1_1371_2132 252
14 3300050494 nmdc:mga06z11_459_c1 nmdc:mga06z11_459_c1_2335_3096 252
15 3300050495 nmdc:mga04h51_6146_c1 nmdc:mga04h51_6146_c1_1088_1849 252
16 3300050496 nmdc:mga07m45_79419_c1 nmdc:mga07m45_79419_c1_521_1282 252
17 3300050516 nmdc:mga0sz30_798_c1 nmdc:mga0sz30_798_c1_6682_7443 252
18 3300006051 Ga0075364_10015522 Ga0075364_100155222 253
19 3300041410 Ga0439461_0001953 Ga0439461_0001953_649_1413 253
20 3300042016 Ga0439463_016686 Ga0439463_016686_1033_1797 253
21 3300053732 Ga0500656_000451 Ga0500656_000451_2017_2784 254
22 3300006038 Ga0075365_10000027 Ga0075365_100000275 255
23 3300006038 Ga0075365_10015555 Ga0075365_100155554 255
24 3300030745 Ga0316182_1037919 Ga0316182_10379192 255
25 3300053153 Ga0500616_0000012 Ga0500616_0000012_486368_487138 255
26 3300053724 Ga0500570_108952 Ga0500570_108952_224_994 255
27 3300005367 Ga0070667_100023554 Ga0070667_1000235543 256
28 3300005617 Ga0068859_100876053 Ga0068859_1008760531 256
29 3300006931 Ga0097620_100876035 Ga0097620_1008760352 256
30 3300009979 Ga0105032_100001 Ga0105032_100001193 256
31 3300025986 Ga0207658_10139418 Ga0207658_101394183 256
32 3300041405 Ga0439438_009683 Ga0439438_009683_753_1526 256
33 3300041410 Ga0439461_0000340 Ga0439461_0000340_2427_3200 256
34 3300042004 Ga0439445_0000290 Ga0439445_0000290_759_1535 256
35 3300042006 Ga0439432_004047 Ga0439432_004047_461_1237 256
36 3300042122 Ga0450920_001733 Ga0450920_001733_2308_3081 256
37 3300042145 Ga0450906_003147 Ga0450906_003147_1721_2494 256
38 3300042156 Ga0439446_0000001 Ga0439446_0000001_102892_103665 256
39 3300042156 Ga0439446_0000374 Ga0439446_0000374_4771_5544 256
40 3300042435 Ga0439434_0000740 Ga0439434_0000740_4513_5286 256
41 3300046674 Ga0495588_0059982 Ga0495588_0059982_38_811 256
42 3300053092 Ga0500583_0000510 Ga0500583_0000510_5788_6561 256
43 3300053096 Ga0500641_0000001 Ga0500641_0000001_186779_187552 256
44 3300053131 Ga0500652_000001 Ga0500652_000001_174920_175693 256
45 3300053724 Ga0500570_078895 Ga0500570_078895_119_892 256
46 3300049742 Ga0501080_0002131 Ga0501080_0002131_10348_11124 257
47 3300050492 nmdc:mga0yw44_49782_c1 nmdc:mga0yw44_49782_c1_1646_2422 257
48 3300048927 Ga0496124_0133062 Ga0496124_0133062_709_1494 259
49 3300049573 Ga0501037_0173650 Ga0501037_0173650_221_1024 259
50 3300009093 Ga0105240_10000003 Ga0105240_10000003810 260
51 3300009098 Ga0105245_10001120 Ga0105245_1000112022 260
52 3300009148 Ga0105243_10000001 Ga0105243_10000001481 260
53 3300009176 Ga0105242_10000135 Ga0105242_1000013531 260
54 3300009545 Ga0105237_10016883 Ga0105237_100168836 260
55 3300010375 Ga0105239_10077883 Ga0105239_100778832 260
56 3300013306 Ga0163162_10748528 Ga0163162_107485282 260
57 3300025912 Ga0207707_10049305 Ga0207707_100493053 260
58 3300053088 Ga0500644_0002138 Ga0500644_0002138_2704_3495 260
59 3300053090 Ga0500646_0000261 Ga0500646_0000261_4462_5253 260
60 3300053092 Ga0500583_0027757 Ga0500583_0027757_1160_1951 260
61 3300053098 Ga0500650_0000001 Ga0500650_0000001_456169_456960 260
62 3300053108 Ga0500562_015122 Ga0500562_015122_997_1788 260
63 3300053118 Ga0500594_0000001 Ga0500594_0000001_1117246_1118037 260
64 3300053133 Ga0500655_000553 Ga0500655_000553_5440_6231 260
65 3300053142 Ga0500577_0001896 Ga0500577_0001896_1182_1973 260
66 3300053143 Ga0500579_001549 Ga0500579_001549_8555_9346 260
67 3300053160 Ga0500633_0000659 Ga0500633_0000659_3117_3908 260
68 3300005339 Ga0070660_100130005 Ga0070660_1001300052 261
69 3300005530 Ga0070679_100120997 Ga0070679_1001209972 261
70 3300009177 Ga0105248_10226694 Ga0105248_102266943 261
71 3300009551 Ga0105238_10023152 Ga0105238_100231527 261
72 3300009553 Ga0105249_10092304 Ga0105249_100923042 261
73 3300013296 Ga0157374_10006505 Ga0157374_1000650510 261
74 3300014969 Ga0157376_10000001 Ga0157376_10000001131 261
75 3300025919 Ga0207657_10082583 Ga0207657_100825832 261
76 3300031251 Ga0265327_10000017 Ga0265327_10000017143 262
77 3300037312 Ga0395899_0003092 Ga0395899_0003092_1809_2597 262
78 3300037466 Ga0395898_0024777 Ga0395898_0024777_1888_2676 262
79 3300037471 Ga0395905_0003963 Ga0395905_0003963_2759_3547 262
80 3300038443 Ga0395901_0027196 Ga0395901_0027196_4244_5032 262
81 3300049569 Ga0501032_0022101 Ga0501032_0022101_1788_2600 262
82 3300049570 Ga0501033_0067427 Ga0501033_0067427_397_1209 262
83 3300049571 Ga0501034_0005296 Ga0501034_0005296_8115_8927 262
84 3300049572 Ga0501036_0062688 Ga0501036_0062688_2083_2895 262
85 3300049581 Ga0501047_0000229 Ga0501047_0000229_37276_38088 262
86 3300049744 Ga0501083_0061706 Ga0501083_0061706_255_1064 262
87 3300049822 Ga0501035_0000033 Ga0501035_0000033_135320_136132 262
88 3300049823 Ga0501044_0175327 Ga0501044_0175327_29_841 262
89 3300010375 Ga0105239_10041980 Ga0105239_100419802 263
90 3300049744 Ga0501083_0032584 Ga0501083_0032584_1068_1919 263
91 3300025909 Ga0207705_10060136 Ga0207705_100601363 264
92 3300028800 Ga0265338_10000052 Ga0265338_10000052106 264
93 3300030734 Ga0316179_1063613 Ga0316179_10636131 264
94 3300028800 Ga0265338_10000601 Ga0265338_1000060155 266
95 3300053090 Ga0500646_0010043 Ga0500646_0010043_13_816 266
96 3300053117 Ga0500593_032501 Ga0500593_032501_146_949 266
97 3300005339 Ga0070660_100001370 Ga0070660_1000013704 267
98 3300005614 Ga0068856_100007844 Ga0068856_1000078442 267
99 3300009093 Ga0105240_10000004 Ga0105240_10000004295 267
100 3300009545 Ga0105237_10000001 Ga0105237_10000001727 267
101 3300010375 Ga0105239_10360809 Ga0105239_103608092 267
102 3300013104 Ga0157370_10001934 Ga0157370_1000193414 267
103 3300013307 Ga0157372_10000002 Ga0157372_10000002272 267
104 3300025913 Ga0207695_10000009 Ga0207695_10000009674 267
105 3300025914 Ga0207671_10000003 Ga0207671_10000003730 267
106 3300025924 Ga0207694_10340856 Ga0207694_103408562 267
107 3300026078 Ga0207702_10006082 Ga0207702_100060827 267
108 3300030745 Ga0316182_1100663 Ga0316182_11006632 267
109 3300037471 Ga0395905_0000238 Ga0395905_0000238_36822_37634 267
110 3300050491 nmdc:mga00v17_67662_c1 nmdc:mga00v17_67662_c1_1384_2190 267
111 3300053093 Ga0500651_0000240 Ga0500651_0000240_7679_8491 267
112 3300053093 Ga0500651_0000452 Ga0500651_0000452_3052_3864 267
113 3300053123 Ga0500614_000280 Ga0500614_000280_1076_1888 267
114 3300003320 rootH2_10006847 rootH2_10006847158 268
115 3300009979 Ga0105032_100005 Ga0105032_10000599 268
116 3300030742 Ga0316183_1129097 Ga0316183_112909715 268
117 3300030744 Ga0316181_1005749 Ga0316181_100574958 268
118 3300030745 Ga0316182_1104433 Ga0316182_11044336 268
119 3300030745 Ga0316182_1133447 Ga0316182_11334472 268
120 3300053093 Ga0500651_0000001 Ga0500651_0000001_243043_243852 268
121 3300053118 Ga0500594_0000042 Ga0500594_0000042_23251_24060 268
122 3300003911 JGI25405J52794_10000521 JGI25405J52794_100005217 269
123 3300005458 Ga0070681_10010536 Ga0070681_100105363 269
124 3300005459 Ga0068867_100009996 Ga0068867_1000099964 269
125 3300005563 Ga0068855_100002823 Ga0068855_10000282316 269
126 3300005578 Ga0068854_100049305 Ga0068854_1000493052 269
127 3300005937 Ga0081455_10000001 Ga0081455_10000001187 269
128 3300013104 Ga0157370_10152424 Ga0157370_101524243 269
129 3300013105 Ga0157369_10000009 Ga0157369_10000009323 269
130 3300013105 Ga0157369_10004669 Ga0157369_1000466916 269
131 3300013105 Ga0157369_10019746 Ga0157369_100197464 269
132 3300013307 Ga0157372_10185367 Ga0157372_101853672 269
133 3300025912 Ga0207707_10002145 Ga0207707_100021457 269
134 3300025913 Ga0207695_10000005 Ga0207695_10000005820 269
135 3300025914 Ga0207671_10018687 Ga0207671_100186877 269
136 3300025927 Ga0207687_10014067 Ga0207687_100140674 269
137 3300025934 Ga0207686_10000001 Ga0207686_10000001661 269
138 3300025935 Ga0207709_10000002 Ga0207709_10000002779 269
139 3300025949 Ga0207667_10008949 Ga0207667_100089498 269
140 3300025981 Ga0207640_10136245 Ga0207640_101362452 269
141 3300028800 Ga0265338_10170168 Ga0265338_101701682 269
142 3300030733 Ga0314311_1045309 Ga0314311_10453096 269
143 3300030734 Ga0316179_1062152 Ga0316179_10621522 269
144 3300030742 Ga0316183_1122191 Ga0316183_11221912 269
145 3300030742 Ga0316183_1209681 Ga0316183_120968112 269
146 3300030745 Ga0316182_1062064 Ga0316182_10620643 269
147 3300034820 Ga0373959_0000062 Ga0373959_0000062_4208_5026 269
148 3300037418 Ga0395900_0231109 Ga0395900_0231109_357_1175 269
149 3300038443 Ga0395901_0004611 Ga0395901_0004611_1182_2000 269
150 3300038443 Ga0395901_0053393 Ga0395901_0053393_901_1719 269
151 3300048903 Ga0496100_0116138 Ga0496100_0116138_227_1045 269
152 3300049571 Ga0501034_0000241 Ga0501034_0000241_12955_13767 269
153 3300049573 Ga0501037_0000001 Ga0501037_0000001_283617_284429 269
154 3300049574 Ga0501038_0099769 Ga0501038_0099769_1351_2163 269
155 3300049579 Ga0501043_0156713 Ga0501043_0156713_45_857 269
156 3300050492 nmdc:mga0yw44_99533_c1 nmdc:mga0yw44_99533_c1_592_1404 269
157 3300050492 nmdc:mga0yw44_9_c1 nmdc:mga0yw44_9_c1_125413_126222 269
158 3300053724 Ga0500570_003446 Ga0500570_003446_4745_5557 269
159 3300003323 rootH1_10014171 rootH1_1001417147 270
160 3300003323 rootH1_10287665 rootH1_102876652 270
161 3300005327 Ga0070658_10000012 Ga0070658_10000012287 270
162 3300005328 Ga0070676_10038828 Ga0070676_100388282 270
163 3300005356 Ga0070674_100005957 Ga0070674_1000059573 270
164 3300005364 Ga0070673_100000224 Ga0070673_10000022415 270
165 3300005456 Ga0070678_100009843 Ga0070678_1000098434 270
166 3300005466 Ga0070685_10000215 Ga0070685_100002156 270
167 3300005466 Ga0070685_10001953 Ga0070685_100019533 270
168 3300005543 Ga0070672_100003068 Ga0070672_1000030682 270
169 3300005548 Ga0070665_100085697 Ga0070665_1000856972 270
170 3300005548 Ga0070665_100141336 Ga0070665_1001413363 270
171 3300005563 Ga0068855_100000011 Ga0068855_100000011131 270
172 3300005616 Ga0068852_100015756 Ga0068852_1000157562 270
173 3300006038 Ga0075365_10000001 Ga0075365_10000001258 270
174 3300006038 Ga0075365_10056605 Ga0075365_100566052 270
175 3300006195 Ga0075366_10052005 Ga0075366_100520052 270
176 3300009093 Ga0105240_10001464 Ga0105240_1000146422 270
177 3300009993 Ga0105028_100305 Ga0105028_1003053 270
178 3300013296 Ga0157374_10000195 Ga0157374_1000019520 270
179 3300013297 Ga0157378_10133940 Ga0157378_101339402 270
180 3300014325 Ga0163163_10073063 Ga0163163_100730632 270
181 3300014745 Ga0157377_10002876 Ga0157377_100028766 270
182 3300025907 Ga0207645_10039305 Ga0207645_100393051 270
183 3300025909 Ga0207705_10000056 Ga0207705_10000056137 270
184 3300025913 Ga0207695_10003030 Ga0207695_100030304 270
185 3300025927 Ga0207687_10007560 Ga0207687_100075602 270
186 3300025949 Ga0207667_10000042 Ga0207667_10000042158 270
187 3300025960 Ga0207651_10000167 Ga0207651_1000016715 270
188 3300026142 Ga0207698_10710693 Ga0207698_107106932 270
189 3300027526 Ga0209968_1015604 Ga0209968_10156041 270
190 3300028379 Ga0268266_10010164 Ga0268266_100101649 270
191 3300028573 Ga0265334_10000184 Ga0265334_1000018423 270
192 3300028800 Ga0265338_10000192 Ga0265338_10000192108 270
193 3300030735 Ga0316178_1056808 Ga0316178_10568082 270
194 3300031247 Ga0265340_10001568 Ga0265340_100015688 270
195 3300031730 Ga0307516_10003356 Ga0307516_1000335611 270
196 3300042435 Ga0439434_0030017 Ga0439434_0030017_341_1156 270
197 3300046460 Ga0495638_0000883 Ga0495638_0000883_22210_23025 270
198 3300046542 Ga0495597_0022702 Ga0495597_0022702_272_1087 270
199 3300046810 Ga0495660_0000005 Ga0495660_0000005_22448_23263 270
200 3300048915 Ga0496112_0020640 Ga0496112_0020640_342_1160 270
201 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_329366_330178 270
202 3300050493 nmdc:mga0k408_48145_c1 nmdc:mga0k408_48145_c1_1081_1893 270
203 3300053087 Ga0500643_000011 Ga0500643_000011_26324_27139 270
204 3300053090 Ga0500646_0000011 Ga0500646_0000011_10842_11657 270
205 3300053103 Ga0500555_000006 Ga0500555_000006_134514_135326 270
206 3300053109 Ga0500569_000030 Ga0500569_000030_7392_8207 270
207 3300053146 Ga0500588_0000063 Ga0500588_0000063_8498_9313 270
208 3300003323 rootH1_10251479 rootH1_102514792 271
209 3300005331 Ga0070670_100230017 Ga0070670_1002300172 271
210 3300005530 Ga0070679_100002235 Ga0070679_10000223512 272
211 3300005539 Ga0068853_100050418 Ga0068853_1000504182 272
212 3300005614 Ga0068856_100000001 Ga0068856_100000001248 272
213 3300009093 Ga0105240_10471179 Ga0105240_104711792 272
214 3300009174 Ga0105241_10001167 Ga0105241_100011676 272
215 3300025904 Ga0207647_10000506 Ga0207647_1000050612 272
216 3300025911 Ga0207654_10000623 Ga0207654_100006236 272
217 3300026041 Ga0207639_10032041 Ga0207639_100320412 272
218 3300026078 Ga0207702_10000001 Ga0207702_10000001797 272
219 3300049573 Ga0501037_0395050 Ga0501037_0395050_106_927 272
220 3300053087 Ga0500643_000010 Ga0500643_000010_368194_369027 272
221 3300002244 JGI24742J22300_10000395 JGI24742J22300_100003955 273
222 3300005328 Ga0070676_10015889 Ga0070676_100158892 273
223 3300005330 Ga0070690_100000942 Ga0070690_10000094211 273
224 3300005367 Ga0070667_100000001 Ga0070667_100000001769 273
225 3300005544 Ga0070686_100016974 Ga0070686_1000169745 273
226 3300005563 Ga0068855_100019950 Ga0068855_1000199505 273
227 3300005614 Ga0068856_100075177 Ga0068856_1000751773 273
228 3300005841 Ga0068863_100245607 Ga0068863_1002456072 273
229 3300005843 Ga0068860_100004028 Ga0068860_10000402811 273
230 3300006038 Ga0075365_10077286 Ga0075365_100772864 273
231 3300006038 Ga0075365_10131230 Ga0075365_101312302 273
232 3300006051 Ga0075364_10017104 Ga0075364_100171048 273
233 3300006195 Ga0075366_10000347 Ga0075366_1000034710 273
234 3300013296 Ga0157374_10178824 Ga0157374_101788244 273
235 3300013297 Ga0157378_10378624 Ga0157378_103786242 273
236 3300013307 Ga0157372_10969121 Ga0157372_109691211 273
237 3300025907 Ga0207645_10001659 Ga0207645_1000165911 273
238 3300025986 Ga0207658_10000003 Ga0207658_10000003610 273
239 3300026088 Ga0207641_10123675 Ga0207641_101236752 273
240 3300028381 Ga0268264_10011549 Ga0268264_100115492 273
241 3300044683 Ga0466965_0002916 Ga0466965_0002916_3945_4775 273
242 3300046460 Ga0495638_0000070 Ga0495638_0000070_140198_141028 273
243 3300048928 Ga0496125_0165768 Ga0496125_0165768_303_1142 273
244 3300050492 nmdc:mga0yw44_103374_c1 nmdc:mga0yw44_103374_c1_38_868 273

Structural Annotation

Top 5 Hits

ID Description Score Start End
1olp-assembly4.cif.gz_D alpha toxin from clostridium absonum 0.6502 16 273
1ca1-assembly1.cif.gz_A alpha-toxin from clostridium perfringens 0.639 11 267
1kho-assembly2.cif.gz_B crystal structure analysis of clostridium perfringens alpha-toxin isolated from avian strain swcp 0.6299 16 273
1olp-assembly3.cif.gz_C alpha toxin from clostridium absonum 0.6297 16 272
2wxu-assembly1.cif.gz_A clostridium perfringens alpha-toxin strain nctc8237 mutant t74i 0.6224 12 272
ID Description Score Start End Superfamily
af_C0P438_131_227_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7187 81 136 1.20.1280.290
1khoA01 Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease 0.6382 16 273 1.10.575.10
1khoA01 Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease 0.6182 16 273 1.10.575.10
af_Q57750_1_90_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.5783 16 119 1.10.287.1080
af_A0A0G2KZ87_1_238_1.10.575.10 Mainly Alpha;Orthogonal Bundle;P1 Nuclease;P1 Nuclease 0.5751 21 120 1.10.575.10
ID Description Score Start End GO Terms
AF-A0A7T9K7J3-F1-model_v4 deleted 0.9799 38 273
AF-A0A7T9IPQ7-F1-model_v4 deleted 0.9748 16 267
AF-A0A0G4AWK8-F1-model_v4 Phospholipase C/D domain-containing protein 0.9685 16 267 GO:0016788
AF-A0A563C4W1-F1-model_v4 Phospholipase C/D domain-containing protein 0.9665 16 273 GO:0016788
AF-A0A7W4EU10-F1-model_v4 Phospholipase C/D domain-containing protein 0.9637 68 266

Feature Viewer

pLDDT pTM Quality
84.54 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map