F356206

General Info

Members Datasets Scaffolds Average Seq Length
244 137 488 240

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100272458|Ga0070680_1002724582
Length 272
Sequence LSAEGRGRYDAAIRAPDRGALPIPESILDPMSIDLLVFGPHPDDAEIGAGATLLKVKTMGHRTGIVDMTTGDMGWGTPEARLEECAQAARILKLDVRENLDLGDGRIEDTFENRCKVAAVIRNHQPQIVMAPYYNLPIGRGLGHNDHYKTGQVVANAYNLAHLRKAPIPGEPHQAKAIFFYFLPPGTPPTFVVDVTDHVEDWLAALDCHQTQFYNPDRPRPASLPNVREVFETYARYWGWQIGVKYGQAFLSVAPLRVGDPLGLVRDVIPRP

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
89 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
90 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
129 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.41
Rhizosphere 99.59
Stem 0
Stem Tuber 0
Unclassified 17.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100272458 3300005336 Bacteria 1433
2 Ga0070690_100055915 3300005330 Bacteria 2528
3 Ga0070670_100011880 3300005331 Bacteria 7446
4 Ga0068869_100154107 3300005334 Unclassified 1784
5 Ga0068868_100504100 3300005338 Bacteria 1061
6 Ga0070689_100006641 3300005340 Bacteria 8036
7 Ga0070689_100229484 3300005340 Bacteria 1525
8 Ga0070689_100687060 3300005340 Bacteria 893
9 Ga0070687_100001232 3300005343 Bacteria 8876
10 Ga0070687_100060269 3300005343 Unclassified 2001
11 Ga0070669_100035357 3300005353 Bacteria 3619
12 Ga0070675_100006362 3300005354 Bacteria 9070
13 Ga0070675_100065827 3300005354 Bacteria 2997
14 Ga0070671_100002770 3300005355 Bacteria 13618
15 Ga0070671_100717367 3300005355 Bacteria 868
16 Ga0070673_100095807 3300005364 Bacteria 2435
17 Ga0070673_100158811 3300005364 Bacteria 1921
18 Ga0070688_100000643 3300005365 Bacteria 17360
19 Ga0070688_100001084 3300005365 Bacteria 13611
20 Ga0070688_100019190 3300005365 Bacteria 3960
21 Ga0070688_100024707 3300005365 Bacteria 3550
22 Ga0070688_100648840 3300005365 Bacteria 813
23 Ga0070667_100014061 3300005367 Bacteria 6614
24 Ga0070701_10006382 3300005438 Bacteria 4959
25 Ga0070705_100730428 3300005440 Unclassified 781
26 Ga0070700_100205644 3300005441 Bacteria 1386
27 Ga0070700_100503655 3300005441 Unclassified 932
28 Ga0070694_100018053 3300005444 Bacteria 4470
29 Ga0070708_100010731 3300005445 Bacteria 7435
30 Ga0070685_10012716 3300005466 Bacteria 4427
31 Ga0070685_10076208 3300005466 Bacteria 2000
32 Ga0070685_10182387 3300005466 Unclassified 1352
33 Ga0070707_100115651 3300005468 Bacteria 2603
34 Ga0070707_100912386 3300005468 Bacteria 843
35 Ga0070698_100551674 3300005471 Bacteria 1092
36 Ga0070698_100701826 3300005471 Bacteria 954
37 Ga0070699_100006660 3300005518 Bacteria 10043
38 Ga0070699_100502231 3300005518 Unclassified 1102
39 Ga0070697_100163386 3300005536 Bacteria 1882
40 Ga0070697_100457496 3300005536 Bacteria 1112
41 Ga0070672_100009347 3300005543 Bacteria 6753
42 Ga0070686_100008775 3300005544 Bacteria 5664
43 Ga0070686_100059172 3300005544 Bacteria 2468
44 Ga0070686_100123909 3300005544 Bacteria 1778
45 Ga0070695_100004453 3300005545 Bacteria 8226
46 Ga0070695_100005616 3300005545 Bacteria 7388
47 Ga0070696_100160455 3300005546 Unclassified 1656
48 Ga0070704_100020237 3300005549 Unclassified 4288
49 Ga0070704_100027582 3300005549 Bacteria 3769
50 Ga0068857_100183902 3300005577 Bacteria 1902
51 Ga0068859_100012189 3300005617 Bacteria 8642
52 Ga0068859_100107174 3300005617 Bacteria 2854
53 Ga0068859_100154617 3300005617 Bacteria 2371
54 Ga0068859_100282606 3300005617 Bacteria 1752
55 Ga0068859_100956248 3300005617 Unclassified 940
56 Ga0068864_100106635 3300005618 Bacteria 2491
57 Ga0068864_100153838 3300005618 Bacteria 2086
58 Ga0068866_10258982 3300005718 Unclassified 1068
59 Ga0068861_100170824 3300005719 Bacteria 1802
60 Ga0068863_100035044 3300005841 Bacteria 4781
61 Ga0068863_100194626 3300005841 Bacteria 1949
62 Ga0068863_100218501 3300005841 Bacteria 1836
63 Ga0068858_100095125 3300005842 Bacteria 2775
64 Ga0068858_100553970 3300005842 Bacteria 1113
65 Ga0068860_100024214 3300005843 Bacteria 5870
66 Ga0068860_100053287 3300005843 Bacteria 3847
67 Ga0068862_100014749 3300005844 Bacteria 6489
68 Ga0070715_10128454 3300006163 Bacteria 1217
69 Ga0070712_100297251 3300006175 Unclassified 1306
70 Ga0097621_100191975 3300006237 Bacteria 1769
71 Ga0075428_100018372 3300006844 Bacteria 7731
72 Ga0075428_100148058 3300006844 Bacteria 2551
73 Ga0075428_100228118 3300006844 Unclassified 2010
74 Ga0075430_100085480 3300006846 Bacteria 2641
75 Ga0075430_100452332 3300006846 Unclassified 1060
76 Ga0075431_100244438 3300006847 Bacteria 1824
77 Ga0075433_10004625 3300006852 Bacteria 10738
78 Ga0075433_10124154 3300006852 Bacteria 2293
79 Ga0075433_10214214 3300006852 Bacteria 1711
80 Ga0075433_10547857 3300006852 Unclassified 1017
81 Ga0075433_10906438 3300006852 Bacteria 769
82 Ga0075434_100007691 3300006871 Bacteria 9976
83 Ga0075434_100014995 3300006871 Bacteria 7419
84 Ga0075434_100030144 3300006871 Bacteria 5341
85 Ga0075434_100175636 3300006871 Bacteria 2162
86 Ga0075434_100180451 3300006871 Unclassified 2131
87 Ga0075434_100444106 3300006871 Bacteria 1318
88 Ga0075429_100001835 3300006880 Bacteria 17572
89 Ga0075429_100056875 3300006880 Unclassified 3405
90 Ga0075429_100063091 3300006880 Bacteria 3228
91 Ga0068865_100097801 3300006881 Unclassified 2143
92 Ga0075436_100003468 3300006914 Bacteria 10810
93 Ga0097620_100012189 3300006931 Bacteria 8642
94 Ga0097620_100107174 3300006931 Bacteria 2854
95 Ga0097620_100154611 3300006931 Bacteria 2371
96 Ga0097620_100956221 3300006931 Unclassified 940
97 Ga0075435_100000958 3300007076 Bacteria 18214
98 Ga0075435_100119539 3300007076 Bacteria 2198
99 Ga0099794_10153806 3300007265 Unclassified 1168
100 Ga0111539_10036767 3300009094 Bacteria 5917
101 Ga0111539_10102985 3300009094 Bacteria 3350
102 Ga0111539_10408769 3300009094 Bacteria 1581
103 Ga0111539_10689737 3300009094 Unclassified 1189
104 Ga0114129_10028381 3300009147 Bacteria 7930
105 Ga0114129_10048849 3300009147 Bacteria 5947
106 Ga0114129_10069583 3300009147 Bacteria 4906
107 Ga0114129_10084842 3300009147 Bacteria 4396
108 Ga0114129_10907625 3300009147 Unclassified 1116
109 Ga0114129_10935535 3300009147 Unclassified 1096
110 Ga0105248_10090829 3300009177 Bacteria 3439
111 Ga0105248_10213362 3300009177 Bacteria 2175
112 Ga0105248_10302907 3300009177 Bacteria 1800
113 Ga0105246_10684477 3300011119 Unclassified 897
114 Ga0157378_10019413 3300013297 Bacteria 5975
115 Ga0157378_10177618 3300013297 Unclassified 2001
116 Ga0163162_10331152 3300013306 Bacteria 1655
117 Ga0157375_10079362 3300013308 Bacteria 3317
118 Ga0157380_10105609 3300014326 Bacteria 2355
119 Ga0157379_10772901 3300014968 Bacteria 905
120 Ga0157379_10987441 3300014968 Bacteria 802
121 Ga0207688_10271512 3300025901 Bacteria 1032
122 Ga0207693_10144287 3300025915 Unclassified 1872
123 Ga0207662_10000708 3300025918 Bacteria 15251
124 Ga0207646_10085254 3300025922 Unclassified 2826
125 Ga0207646_10371714 3300025922 Unclassified 1292
126 Ga0207681_10011895 3300025923 Bacteria 5357
127 Ga0207650_10012755 3300025925 Bacteria 5805
128 Ga0207659_10013935 3300025926 Bacteria 5170
129 Ga0207659_10204043 3300025926 Bacteria 1581
130 Ga0207670_10003699 3300025936 Bacteria 8116
131 Ga0207670_10059231 3300025936 Bacteria 2604
132 Ga0207670_10122430 3300025936 Bacteria 1893
133 Ga0207670_10167495 3300025936 Bacteria 1645
134 Ga0207670_10493072 3300025936 Bacteria 994
135 Ga0207704_10089610 3300025938 Unclassified 2016
136 Ga0207665_10218748 3300025939 Bacteria 1395
137 Ga0207691_10009081 3300025940 Bacteria 9542
138 Ga0207691_10146045 3300025940 Bacteria 2082
139 Ga0207711_10192475 3300025941 Bacteria 1859
140 Ga0207711_10273494 3300025941 Bacteria 1554
141 Ga0207711_10283093 3300025941 Unclassified 1527
142 Ga0207689_10135349 3300025942 Bacteria 2029
143 Ga0207679_10027830 3300025945 Bacteria 3915
144 Ga0207651_10033664 3300025960 Bacteria 3308
145 Ga0207708_10012421 3300026075 Bacteria 6349
146 Ga0207641_10003404 3300026088 Bacteria 14098
147 Ga0207641_10016433 3300026088 Bacteria 6060
148 Ga0207648_10846802 3300026089 Unclassified 853
149 Ga0207676_10187232 3300026095 Bacteria 1818
150 Ga0207674_10198400 3300026116 Bacteria 1956
151 Ga0207675_100194437 3300026118 Bacteria 1947
152 Ga0207675_100419477 3300026118 Unclassified 1321
153 Ga0207428_10003575 3300027907 Bacteria 15012
154 Ga0207428_10103881 3300027907 Bacteria 2193
155 Ga0268265_10054249 3300028380 Bacteria 3040
156 Ga0268264_10019137 3300028381 Bacteria 5598
157 Ga0268264_10022127 3300028381 Bacteria 5189
158 Ga0268264_10410952 3300028381 Bacteria 1303
159 Ga0265338_10035590 3300028800 Bacteria 4782
160 Ga0307413_10094950 3300031824 Bacteria 1954
161 Ga0307410_10061256 3300031852 Bacteria 2575
162 Ga0373934_0039041 3300035086 Bacteria 1870
163 Ga0373949_0017630 3300035090 Bacteria 1612
164 Ga0373952_0054194 3300035092 Bacteria 964
165 Ga0373923_0031647 3300035111 Bacteria 2134
166 Ga0373936_0033016 3300035113 Bacteria 2050
167 Ga0373945_0034233 3300035116 Bacteria 1809
168 Ga0373953_0022907 3300035117 Bacteria 2360
169 Ga0373954_0049063 3300035118 Bacteria 1979
170 Ga0373956_0009364 3300035119 Bacteria 3984
171 Ga0373960_0035235 3300035121 Bacteria 1420
172 Ga0373946_0086511 3300035171 Bacteria 1382
173 Ga0373955_0020638 3300035172 Bacteria 3315
174 Ga0373931_0092059 3300035691 Unclassified 1691
175 Ga0373933_0044631 3300035724 Bacteria 2626
176 Ga0373933_0370169 3300035724 Bacteria 932
177 Ga0373947_0055253 3300035725 Bacteria 2398
178 Ga0373937_0219527 3300036401 Bacteria 1789
179 Ga0373937_0412677 3300036401 Unclassified 1281
180 Ga0373937_0711120 3300036401 Bacteria 951
181 Ga0450920_032263 3300042122 Bacteria 1034
182 Ga0453684_0084766 3300044712 Bacteria 3940
183 Ga0451576_0003463 3300045051 Bacteria 21628
184 Ga0451576_0055591 3300045051 Bacteria 4140
185 Ga0451576_0305698 3300045051 Bacteria 1664
186 Ga0451576_0426785 3300045051 Bacteria 1391
187 Ga0495592_0010525 3300046454 Bacteria 6976
188 Ga0495592_0104206 3300046454 Bacteria 2017
189 Ga0495653_0040697 3300046463 Bacteria 3631
190 Ga0495582_0256487 3300046473 Bacteria 1003
191 Ga0495639_0064771 3300046475 Bacteria 1681
192 Ga0495608_0009319 3300046511 Bacteria 6864
193 Ga0495618_0002137 3300046514 Bacteria 12957
194 Ga0495628_0043917 3300046516 Bacteria 3558
195 Ga0495586_0045976 3300046535 Bacteria 2353
196 Ga0495586_0152924 3300046535 Unclassified 1299
197 Ga0495667_0019803 3300046559 Bacteria 4540
198 Ga0495634_0042039 3300046642 Bacteria 3102
199 Ga0495634_0111917 3300046642 Bacteria 1755
200 Ga0495635_0046614 3300046663 Bacteria 2990
201 Ga0495657_0004930 3300046675 Bacteria 10618
202 Ga0495599_0052928 3300046678 Bacteria 2543
203 Ga0495658_0046134 3300046683 Bacteria 2449
204 Ga0495658_0208912 3300046683 Bacteria 1219
205 Ga0495670_0105538 3300046691 Bacteria 1455
206 Ga0495600_0328123 3300046809 Unclassified 961
207 Ga0495604_0162184 3300047317 Bacteria 1579
208 Ga0495680_0082535 3300047322 Bacteria 2425
209 Ga0495680_0120283 3300047322 Bacteria 1939
210 Ga0495675_0041604 3300047444 Bacteria 2928
211 Ga0496106_0083975 3300048909 Bacteria 2450
212 nmdc:mga05p37_267067_c1 3300050507 Unclassified 2046
213 nmdc:mga05p37_282088_c1 3300050507 Bacteria 1981
214 nmdc:mga05p37_36167_c1 3300050507 Bacteria 6059
215 nmdc:mga05p37_36778_c1 3300050507 Bacteria 6004
216 nmdc:mga09592_105940_c1 3300050508 Unclassified 2411
217 nmdc:mga09592_247_c2 3300050508 Bacteria 27735
218 nmdc:mga09592_251230_c1 3300050508 Bacteria 1533
219 nmdc:mga09592_8659_c1 3300050508 Bacteria 8279
220 nmdc:mga0qj67_20747_c1 3300050509 Bacteria 5032
221 nmdc:mga0qj67_325399_c1 3300050509 Bacteria 1244
222 nmdc:mga06r32_423255_c1 3300050510 Bacteria 1313
223 nmdc:mga06r32_546083_c1 3300050510 Unclassified 1133
224 nmdc:mga08y16_157924_c1 3300050511 Bacteria 2357
225 nmdc:mga08y16_176074_c1 3300050511 Unclassified 2221
226 nmdc:mga08y16_837460_c1 3300050511 Bacteria 910
227 nmdc:mga0n895_119_c1 3300050512 Bacteria 46790
228 nmdc:mga0n895_151898_c1 3300050512 Bacteria 2346
229 nmdc:mga0n895_190642_c1 3300050512 Bacteria 2081
230 nmdc:mga0n895_32444_c2 3300050512 Bacteria 1833
231 nmdc:mga0n895_83572_c1 3300050512 Bacteria 3185
232 nmdc:mga0n895_921938_c1 3300050512 Bacteria 858
233 nmdc:mga0rr50_22106_c1 3300050513 Bacteria 4358
234 nmdc:mga0rr50_325_c1 3300050513 Bacteria 25926
235 nmdc:mga0rr50_68118_c1 3300050513 Bacteria 2706
236 nmdc:mga08x19_3407_c1 3300050514 Bacteria 9482
237 nmdc:mga08x19_34977_c1 3300050514 Bacteria 3178
238 nmdc:mga0a205_100719_c1 3300050515 Unclassified 2788
239 nmdc:mga0a205_1346_c1 3300050515 Bacteria 20725
240 nmdc:mga0a205_229749_c1 3300050515 Bacteria 1739
241 nmdc:mga0a205_295135_c1 3300050515 Bacteria 1495
242 nmdc:mga0a205_66063_c1 3300050515 Unclassified 3495
243 Ga0495595_0001983 3300053084 Bacteria 7955
244 Ga0495619_0248942 3300053085 Unclassified 1231
245 Ga0070680_100272458
246 Ga0070690_100055915
247 Ga0070670_100011880
248 Ga0068869_100154107
249 Ga0068868_100504100
250 Ga0070689_100006641
251 Ga0070689_100229484
252 Ga0070689_100687060
253 Ga0070687_100001232
254 Ga0070687_100060269
255 Ga0070669_100035357
256 Ga0070675_100006362
257 Ga0070675_100065827
258 Ga0070671_100002770
259 Ga0070671_100717367
260 Ga0070673_100095807
261 Ga0070673_100158811
262 Ga0070688_100000643
263 Ga0070688_100001084
264 Ga0070688_100019190
265 Ga0070688_100024707
266 Ga0070688_100648840
267 Ga0070667_100014061
268 Ga0070701_10006382
269 Ga0070705_100730428
270 Ga0070700_100205644
271 Ga0070700_100503655
272 Ga0070694_100018053
273 Ga0070708_100010731
274 Ga0070685_10012716
275 Ga0070685_10076208
276 Ga0070685_10182387
277 Ga0070707_100115651
278 Ga0070707_100912386
279 Ga0070698_100551674
280 Ga0070698_100701826
281 Ga0070699_100006660
282 Ga0070699_100502231
283 Ga0070697_100163386
284 Ga0070697_100457496
285 Ga0070672_100009347
286 Ga0070686_100008775
287 Ga0070686_100059172
288 Ga0070686_100123909
289 Ga0070695_100004453
290 Ga0070695_100005616
291 Ga0070696_100160455
292 Ga0070704_100020237
293 Ga0070704_100027582
294 Ga0068857_100183902
295 Ga0068859_100012189
296 Ga0068859_100107174
297 Ga0068859_100154617
298 Ga0068859_100282606
299 Ga0068859_100956248
300 Ga0068864_100106635
301 Ga0068864_100153838
302 Ga0068866_10258982
303 Ga0068861_100170824
304 Ga0068863_100035044
305 Ga0068863_100194626
306 Ga0068863_100218501
307 Ga0068858_100095125
308 Ga0068858_100553970
309 Ga0068860_100024214
310 Ga0068860_100053287
311 Ga0068862_100014749
312 Ga0070715_10128454
313 Ga0070712_100297251
314 Ga0097621_100191975
315 Ga0075428_100018372
316 Ga0075428_100148058
317 Ga0075428_100228118
318 Ga0075430_100085480
319 Ga0075430_100452332
320 Ga0075431_100244438
321 Ga0075433_10004625
322 Ga0075433_10124154
323 Ga0075433_10214214
324 Ga0075433_10547857
325 Ga0075433_10906438
326 Ga0075434_100007691
327 Ga0075434_100014995
328 Ga0075434_100030144
329 Ga0075434_100175636
330 Ga0075434_100180451
331 Ga0075434_100444106
332 Ga0075429_100001835
333 Ga0075429_100056875
334 Ga0075429_100063091
335 Ga0068865_100097801
336 Ga0075436_100003468
337 Ga0097620_100012189
338 Ga0097620_100107174
339 Ga0097620_100154611
340 Ga0097620_100956221
341 Ga0075435_100000958
342 Ga0075435_100119539
343 Ga0099794_10153806
344 Ga0111539_10036767
345 Ga0111539_10102985
346 Ga0111539_10408769
347 Ga0111539_10689737
348 Ga0114129_10028381
349 Ga0114129_10048849
350 Ga0114129_10069583
351 Ga0114129_10084842
352 Ga0114129_10907625
353 Ga0114129_10935535
354 Ga0105248_10090829
355 Ga0105248_10213362
356 Ga0105248_10302907
357 Ga0105246_10684477
358 Ga0157378_10019413
359 Ga0157378_10177618
360 Ga0163162_10331152
361 Ga0157375_10079362
362 Ga0157380_10105609
363 Ga0157379_10772901
364 Ga0157379_10987441
365 Ga0207688_10271512
366 Ga0207693_10144287
367 Ga0207662_10000708
368 Ga0207646_10085254
369 Ga0207646_10371714
370 Ga0207681_10011895
371 Ga0207650_10012755
372 Ga0207659_10013935
373 Ga0207659_10204043
374 Ga0207670_10003699
375 Ga0207670_10059231
376 Ga0207670_10122430
377 Ga0207670_10167495
378 Ga0207670_10493072
379 Ga0207704_10089610
380 Ga0207665_10218748
381 Ga0207691_10009081
382 Ga0207691_10146045
383 Ga0207711_10192475
384 Ga0207711_10273494
385 Ga0207711_10283093
386 Ga0207689_10135349
387 Ga0207679_10027830
388 Ga0207651_10033664
389 Ga0207708_10012421
390 Ga0207641_10003404
391 Ga0207641_10016433
392 Ga0207648_10846802
393 Ga0207676_10187232
394 Ga0207674_10198400
395 Ga0207675_100194437
396 Ga0207675_100419477
397 Ga0207428_10003575
398 Ga0207428_10103881
399 Ga0268265_10054249
400 Ga0268264_10019137
401 Ga0268264_10022127
402 Ga0268264_10410952
403 Ga0265338_10035590
404 Ga0307413_10094950
405 Ga0307410_10061256
406 Ga0373934_0039041
407 Ga0373949_0017630
408 Ga0373952_0054194
409 Ga0373923_0031647
410 Ga0373936_0033016
411 Ga0373945_0034233
412 Ga0373953_0022907
413 Ga0373954_0049063
414 Ga0373956_0009364
415 Ga0373960_0035235
416 Ga0373946_0086511
417 Ga0373955_0020638
418 Ga0373931_0092059
419 Ga0373933_0044631
420 Ga0373933_0370169
421 Ga0373947_0055253
422 Ga0373937_0219527
423 Ga0373937_0412677
424 Ga0373937_0711120
425 Ga0450920_032263
426 Ga0453684_0084766
427 Ga0451576_0003463
428 Ga0451576_0055591
429 Ga0451576_0305698
430 Ga0451576_0426785
431 Ga0495592_0010525
432 Ga0495592_0104206
433 Ga0495653_0040697
434 Ga0495582_0256487
435 Ga0495639_0064771
436 Ga0495608_0009319
437 Ga0495618_0002137
438 Ga0495628_0043917
439 Ga0495586_0045976
440 Ga0495586_0152924
441 Ga0495667_0019803
442 Ga0495634_0042039
443 Ga0495634_0111917
444 Ga0495635_0046614
445 Ga0495657_0004930
446 Ga0495599_0052928
447 Ga0495658_0046134
448 Ga0495658_0208912
449 Ga0495670_0105538
450 Ga0495600_0328123
451 Ga0495604_0162184
452 Ga0495680_0082535
453 Ga0495680_0120283
454 Ga0495675_0041604
455 Ga0496106_0083975
456 nmdc:mga05p37_267067_c1
457 nmdc:mga05p37_282088_c1
458 nmdc:mga05p37_36167_c1
459 nmdc:mga05p37_36778_c1
460 nmdc:mga09592_105940_c1
461 nmdc:mga09592_247_c2
462 nmdc:mga09592_251230_c1
463 nmdc:mga09592_8659_c1
464 nmdc:mga0qj67_20747_c1
465 nmdc:mga0qj67_325399_c1
466 nmdc:mga06r32_423255_c1
467 nmdc:mga06r32_546083_c1
468 nmdc:mga08y16_157924_c1
469 nmdc:mga08y16_176074_c1
470 nmdc:mga08y16_837460_c1
471 nmdc:mga0n895_119_c1
472 nmdc:mga0n895_151898_c1
473 nmdc:mga0n895_190642_c1
474 nmdc:mga0n895_32444_c2
475 nmdc:mga0n895_83572_c1
476 nmdc:mga0n895_921938_c1
477 nmdc:mga0rr50_22106_c1
478 nmdc:mga0rr50_325_c1
479 nmdc:mga0rr50_68118_c1
480 nmdc:mga08x19_3407_c1
481 nmdc:mga08x19_34977_c1
482 nmdc:mga0a205_100719_c1
483 nmdc:mga0a205_1346_c1
484 nmdc:mga0a205_229749_c1
485 nmdc:mga0a205_295135_c1
486 nmdc:mga0a205_66063_c1
487 Ga0495595_0001983
488 Ga0495619_0248942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

36

158

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.9657 1 225
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.9438 3 232
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.9361 3 232
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.9319 3 232
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.9278 3 232
ID Description Score Start End Superfamily
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9657 1 225 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9361 3 232 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9278 3 232 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9212 1 225 3.40.50.10320
1q74D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.887 2 177 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A846NCY6-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9971 3 104 GO:0016811
AF-A0A359M0A2-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9952 2 70
AF-A0A7J4VDL4-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9927 20 146 GO:0016811
AF-A0A7X9E0F7-F1-model_v4 Bacillithiol biosynthesis deacetylase BshB1 0.9926 1 130 GO:0016811
AF-A0A817GDZ7-F1-model_v4 N-acetylglucosaminylphosphatidylinositol deacetylase (EC 3.5.1.89) 0.9924 2 100

Map