F356060

General Info

Members Datasets Scaffolds Average Seq Length
243 169 486 170

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675902999|2676201970
Length 205
Sequence DLRCGSARDDGRPDTCLIEGRSVHTRGVYETAEEIKGLQRLLDESANAAGPHLRSIITPERRIDAAELCRRMRGMRLLALATVTADGRPLVGPVDGYLIRGSWYFSSGRDLVRMRHLAARPAVSATHLPGEELAVTVHGRAELFDVLDPARPELRRAMLDHYLPSQGTAFEEWLDDVNPLGARIEAAKVFTFQEAGGDQTGQHHM

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
94 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
95 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
96 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
168 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
169 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0.82
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0.82
Rhizoplane 13.58
Rhizosphere 79.01
Stem 0
Stem Tuber 0
Unclassified 16.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10191352 3300003323 Bacteria 1107
2 Ga0070683_100018176 3300005329 Bacteria 6222
3 Ga0068869_100612781 3300005334 Bacteria 921
4 Ga0070680_100001595 3300005336 Bacteria 16568
5 Ga0070682_100062715 3300005337 Bacteria 2355
6 Ga0068868_100311521 3300005338 Bacteria 1339
7 Ga0070660_100034121 3300005339 Bacteria 3842
8 Ga0070660_101099705 3300005339 Bacteria 673
9 Ga0070661_100042995 3300005344 Bacteria 3300
10 Ga0070692_10048531 3300005345 Bacteria 2200
11 Ga0070692_10639144 3300005345 Bacteria 709
12 Ga0070674_100617681 3300005356 Bacteria 918
13 Ga0070659_100001987 3300005366 Bacteria 14605
14 Ga0070667_100074383 3300005367 Bacteria 2898
15 Ga0070714_100040499 3300005435 Bacteria 3927
16 Ga0070714_100193887 3300005435 Bacteria 1855
17 Ga0070713_100373681 3300005436 Bacteria 1327
18 Ga0070708_100344706 3300005445 Unclassified 1404
19 Ga0070681_10024904 3300005458 Bacteria 6021
20 Ga0070706_100281583 3300005467 Bacteria 1552
21 Ga0070706_101030119 3300005467 Unclassified 759
22 Ga0070684_100188460 3300005535 Bacteria 1876
23 Ga0070697_100386312 3300005536 Bacteria 1213
24 Ga0068853_100121835 3300005539 Bacteria 2327
25 Ga0070686_100089938 3300005544 Bacteria 2052
26 Ga0070695_100233012 3300005545 Unclassified 1332
27 Ga0070696_101193752 3300005546 Unclassified 643
28 Ga0068857_100051051 3300005577 Bacteria 3667
29 Ga0068857_100265664 3300005577 Bacteria 1576
30 Ga0068856_100028649 3300005614 Bacteria 5440
31 Ga0068856_100349898 3300005614 Bacteria 1496
32 Ga0068856_101105450 3300005614 Bacteria 810
33 Ga0070702_100411108 3300005615 Bacteria 971
34 Ga0068852_100033842 3300005616 Bacteria 4248
35 Ga0068859_100299908 3300005617 Unclassified 1700
36 Ga0068866_10363164 3300005718 Bacteria 923
37 Ga0068870_10774051 3300005840 Unclassified 668
38 Ga0068863_100135250 3300005841 Bacteria 2355
39 Ga0068860_100977881 3300005843 Bacteria 864
40 Ga0081455_10005387 3300005937 Bacteria 14047
41 Ga0070717_10012255 3300006028 Bacteria 6538
42 Ga0070717_10192534 3300006028 Unclassified 1782
43 Ga0070717_10315651 3300006028 Bacteria 1392
44 Ga0070712_100566763 3300006175 Unclassified 958
45 Ga0097621_100823475 3300006237 Bacteria 861
46 Ga0068871_100229784 3300006358 Bacteria 1610
47 Ga0075430_100003813 3300006846 Bacteria 12690
48 Ga0075430_100020074 3300006846 Bacteria 5687
49 Ga0075433_10100502 3300006852 Bacteria 2561
50 Ga0075434_100028655 3300006871 Bacteria 5474
51 Ga0075434_102224309 3300006871 Unclassified 552
52 Ga0075436_100118395 3300006914 Bacteria 1852
53 Ga0075436_100588600 3300006914 Unclassified 819
54 Ga0097620_100299926 3300006931 Unclassified 1700
55 Ga0075435_100533544 3300007076 Bacteria 1015
56 Ga0105240_10208370 3300009093 Bacteria 2286
57 Ga0111539_11137911 3300009094 Unclassified 907
58 Ga0105245_10983263 3300009098 Bacteria 888
59 Ga0105245_11146591 3300009098 Unclassified 824
60 Ga0105245_11578332 3300009098 Bacteria 708
61 Ga0105247_10006073 3300009101 Bacteria 7506
62 Ga0105243_10201939 3300009148 Bacteria 1744
63 Ga0105241_10070800 3300009174 Bacteria 2707
64 Ga0105242_10183104 3300009176 Bacteria 1849
65 Ga0105237_10282056 3300009545 Bacteria 1664
66 Ga0105238_10077964 3300009551 Bacteria 3304
67 Ga0105246_11076464 3300011119 Unclassified 733
68 Ga0157370_10005324 3300013104 Bacteria 14451
69 Ga0157369_10003714 3300013105 Bacteria 18150
70 Ga0157369_10029368 3300013105 Bacteria 6076
71 Ga0157372_10023405 3300013307 Bacteria 6695
72 Ga0157372_11040656 3300013307 Bacteria 948
73 Ga0157375_10382798 3300013308 Unclassified 1573
74 Ga0163163_10067824 3300014325 Bacteria 3548
75 Ga0157376_10684431 3300014969 Bacteria 1029
76 Ga0206356_10230371 3300020070 Bacteria 895
77 Ga0206353_10010417 3300020082 Bacteria 1214
78 Ga0213876_10081283 3300021384 Bacteria 1714
79 Ga0213875_10014738 3300021388 Bacteria 3812
80 Ga0213875_10038376 3300021388 Bacteria 2257
81 Ga0207692_10034531 3300025898 Bacteria 2449
82 Ga0207710_10000195 3300025900 Bacteria 57216
83 Ga0207685_10002557 3300025905 Bacteria 4197
84 Ga0207699_10075105 3300025906 Bacteria 2078
85 Ga0207707_10080383 3300025912 Bacteria 2846
86 Ga0207695_10137437 3300025913 Bacteria 2396
87 Ga0207671_10025669 3300025914 Bacteria 4423
88 Ga0207693_10519981 3300025915 Unclassified 928
89 Ga0207660_10055817 3300025917 Bacteria 2824
90 Ga0207657_10008519 3300025919 Bacteria 10397
91 Ga0207652_10009435 3300025921 Bacteria 7848
92 Ga0207700_10001332 3300025928 Bacteria 14001
93 Ga0207700_10419708 3300025928 Bacteria 1175
94 Ga0207664_10281783 3300025929 Bacteria 1458
95 Ga0207664_10452956 3300025929 Bacteria 1145
96 Ga0207690_10090218 3300025932 Bacteria 2163
97 Ga0207686_10198940 3300025934 Bacteria 1434
98 Ga0207711_10727046 3300025941 Bacteria 926
99 Ga0207661_10003960 3300025944 Bacteria 10343
100 Ga0207661_10322401 3300025944 Bacteria 1389
101 Ga0207679_10037432 3300025945 Bacteria 3449
102 Ga0207679_10112296 3300025945 Bacteria 2153
103 Ga0207679_11165099 3300025945 Bacteria 707
104 Ga0207667_10438772 3300025949 Bacteria 1328
105 Ga0207667_11141324 3300025949 Bacteria 761
106 Ga0207712_11656248 3300025961 Bacteria 573
107 Ga0207677_10276687 3300026023 Bacteria 1376
108 Ga0207703_10857572 3300026035 Bacteria 869
109 Ga0207639_10139471 3300026041 Bacteria 2018
110 Ga0207678_10095612 3300026067 Bacteria 2539
111 Ga0207702_10039183 3300026078 Bacteria 3970
112 Ga0207702_10236914 3300026078 Bacteria 1708
113 Ga0207674_10058321 3300026116 Bacteria 3912
114 Ga0207698_10064958 3300026142 Bacteria 2863
115 Ga0207428_10217072 3300027907 Bacteria 1435
116 Ga0307508_10324698 3300031616 Unclassified 1131
117 Ga0316576_10191993 3300031727 Bacteria 1539
118 Ga0316580_10067967 3300032139 Bacteria 1092
119 Ga0373930_0011586 3300034816 Unclassified 1594
120 Ga0373948_0004793 3300034817 Unclassified 2159
121 Ga0373939_0015664 3300035114 Unclassified 1988
122 Ga0373941_0001896 3300035115 Bacteria 4530
123 Ga0373960_0014546 3300035121 Bacteria 1996
124 Ga0373955_0761255 3300035172 Bacteria 595
125 Ga0373942_0024610 3300035207 Unclassified 1545
126 Ga0373962_0008405 3300035242 Bacteria 2540
127 Ga0316574_0040851 3300035398 Bacteria 2857
128 Ga0373931_0038622 3300035691 Bacteria 2498
129 Ga0395899_0129972 3300037312 Bacteria 1799
130 Ga0395899_0169010 3300037312 Bacteria 1541
131 Ga0395899_0415212 3300037312 Bacteria 888
132 Ga0395900_0058465 3300037418 Bacteria 3969
133 Ga0395900_0313201 3300037418 Bacteria 1552
134 Ga0395898_0022859 3300037466 Bacteria 6324
135 Ga0395898_0033859 3300037466 Bacteria 5095
136 Ga0395898_0844896 3300037466 Bacteria 855
137 Ga0395898_1596843 3300037466 Bacteria 576
138 Ga0395905_0024832 3300037471 Bacteria 5656
139 Ga0395905_0574503 3300037471 Bacteria 1029
140 Ga0395905_0855849 3300037471 Bacteria 812
141 Ga0436364_0398421 3300037853 Bacteria 8164
142 Ga0436364_0558340 3300037853 Unclassified 665
143 Ga0436364_0657428 3300037853 Unclassified 2346
144 Ga0436364_1555547 3300037853 Bacteria 5901
145 Ga0395901_0007902 3300038443 Bacteria 10730
146 Ga0395901_0120798 3300038443 Bacteria 2753
147 Ga0436365_0457088 3300039437 Bacteria 793
148 Ga0436365_0595710 3300039437 Unclassified 1095
149 Ga0436365_1088381 3300039437 Bacteria 1190
150 Ga0436363_0623813 3300039450 Bacteria 727
151 Ga0466969_0062754 3300044656 Bacteria 1802
152 Ga0466965_0214095 3300044683 Unclassified 1025
153 Ga0466966_0173154 3300044684 Bacteria 1311
154 Ga0466961_0044851 3300044693 Bacteria 2829
155 Ga0466961_0098659 3300044693 Bacteria 1841
156 Ga0466963_0225600 3300044694 Bacteria 1312
157 Ga0466963_0275591 3300044694 Bacteria 1182
158 Ga0466963_0435688 3300044694 Bacteria 925
159 Ga0466963_0479619 3300044694 Unclassified 878
160 Ga0466964_0303504 3300044706 Bacteria 805
161 Ga0466971_0157153 3300044719 Bacteria 1063
162 Ga0466970_0103874 3300044765 Bacteria 1549
163 Ga0466957_0442687 3300044842 Bacteria 894
164 Ga0466959_0016037 3300045049 Bacteria 5468
165 Ga0466959_0295033 3300045049 Bacteria 1111
166 Ga0466959_0433649 3300045049 Bacteria 891
167 Ga0466959_0526013 3300045049 Bacteria 798
168 Ga0466958_0360803 3300045836 Unclassified 936
169 Ga0466967_0043710 3300045976 Bacteria 3881
170 Ga0466967_0098130 3300045976 Bacteria 2675
171 Ga0466967_0131328 3300045976 Bacteria 2325
172 Ga0466967_0162193 3300045976 Bacteria 2099
173 Ga0466967_0219210 3300045976 Bacteria 1807
174 Ga0466967_0309542 3300045976 Unclassified 1521
175 Ga0466967_1428504 3300045976 Bacteria 689
176 Ga0466967_1524999 3300045976 Unclassified 666
177 Ga0495638_0013351 3300046460 Bacteria 5598
178 Ga0495582_0053166 3300046473 Unclassified 2234
179 Ga0495664_0457971 3300046477 Unclassified 764
180 Ga0495618_0125069 3300046514 Bacteria 1647
181 Ga0495620_0152432 3300046515 Bacteria 900
182 Ga0495628_0030330 3300046516 Bacteria 4379
183 Ga0495645_0406220 3300046543 Unclassified 867
184 Ga0495625_0000587 3300046660 Bacteria 52838
185 Ga0495602_0591387 3300048088 Bacteria 764
186 Ga0496100_0678702 3300048903 Bacteria 803
187 Ga0496100_0877803 3300048903 Unclassified 704
188 Ga0496100_0928838 3300048903 Bacteria 684
189 Ga0496101_0067300 3300048904 Bacteria 2615
190 Ga0496102_0145028 3300048905 Unclassified 2228
191 Ga0496102_0505542 3300048905 Bacteria 1131
192 Ga0496103_0095078 3300048906 Unclassified 1883
193 Ga0496104_0022093 3300048907 Bacteria 5846
194 Ga0496104_1437327 3300048907 Bacteria 593
195 Ga0496105_0021349 3300048908 Bacteria 5239
196 Ga0496105_0046160 3300048908 Bacteria 3596
197 Ga0496105_0291039 3300048908 Bacteria 1315
198 Ga0496106_0018262 3300048909 Bacteria 5186
199 Ga0496108_0076498 3300048911 Bacteria 2829
200 Ga0496109_0163594 3300048912 Bacteria 2085
201 Ga0496109_0192003 3300048912 Bacteria 1919
202 Ga0496109_0211393 3300048912 Bacteria 1824
203 Ga0496109_0220696 3300048912 Bacteria 1783
204 Ga0496109_0778517 3300048912 Unclassified 895
205 Ga0496109_1048541 3300048912 Unclassified 753
206 Ga0496112_0021937 3300048915 Bacteria 6077
207 Ga0496112_0058732 3300048915 Bacteria 3789
208 Ga0496112_0376039 3300048915 Bacteria 1362
209 Ga0496112_0636236 3300048915 Unclassified 997
210 Ga0496113_0078647 3300048916 Bacteria 2523
211 Ga0496113_0082420 3300048916 Bacteria 2467
212 Ga0496114_0036469 3300048917 Bacteria 4065
213 Ga0496114_0150964 3300048917 Bacteria 2016
214 Ga0496115_0012060 3300048918 Bacteria 6498
215 Ga0496115_0079640 3300048918 Bacteria 2666
216 Ga0496115_0314323 3300048918 Bacteria 1282
217 Ga0496115_0412641 3300048918 Bacteria 1095
218 Ga0496115_0536202 3300048918 Bacteria 937
219 Ga0496126_0053142 3300048929 Bacteria 3677
220 Ga0501036_0349475 3300049572 Bacteria 1235
221 Ga0501039_0194933 3300049575 Bacteria 1593
222 Ga0501041_0219105 3300049577 Bacteria 1194
223 Ga0501042_0052938 3300049578 Bacteria 2896
224 Ga0501042_0223713 3300049578 Bacteria 1357
225 Ga0501046_0293940 3300049580 Bacteria 1188
226 Ga0501075_0079395 3300049591 Bacteria 2484
227 Ga0501076_0238639 3300049592 Bacteria 1487
228 Ga0501083_0720509 3300049744 Bacteria 649
229 Ga0501035_0373083 3300049822 Bacteria 1191
230 Ga0501045_0209044 3300049824 Bacteria 1454
231 nmdc:mga0yw44_352952_c1 3300050492 Unclassified 990
232 nmdc:mga0qj67_235966_c1 3300050509 Bacteria 1484
233 nmdc:mga0qj67_77772_c1 3300050509 Bacteria 2655
234 nmdc:mga0n895_39179_c1 3300050512 Bacteria 4596
235 nmdc:mga08x19_565248_c1 3300050514 Bacteria 805
236 nmdc:mga0a205_451045_c1 3300050515 Bacteria 1146
237 Ga0500616_0018760 3300053153 Bacteria 3908
238 Ga0501084_0560739 3300054114 Unclassified 965
239 Ga0501082_0197517 3300060353 Bacteria 1750
240 Ga0466962_0077631 3300061719 Bacteria 1588
241 Ga0530510_0649248 3300061734 Bacteria 803
242 2676201970 2675902999 Bacteria 9438463
243 2774846546 2773857921 Bacteria 9435764
244 rootH1_10191352
245 Ga0070683_100018176
246 Ga0068869_100612781
247 Ga0070680_100001595
248 Ga0070682_100062715
249 Ga0068868_100311521
250 Ga0070660_100034121
251 Ga0070660_101099705
252 Ga0070661_100042995
253 Ga0070692_10048531
254 Ga0070692_10639144
255 Ga0070674_100617681
256 Ga0070659_100001987
257 Ga0070667_100074383
258 Ga0070714_100040499
259 Ga0070714_100193887
260 Ga0070713_100373681
261 Ga0070708_100344706
262 Ga0070681_10024904
263 Ga0070706_100281583
264 Ga0070706_101030119
265 Ga0070684_100188460
266 Ga0070697_100386312
267 Ga0068853_100121835
268 Ga0070686_100089938
269 Ga0070695_100233012
270 Ga0070696_101193752
271 Ga0068857_100051051
272 Ga0068857_100265664
273 Ga0068856_100028649
274 Ga0068856_100349898
275 Ga0068856_101105450
276 Ga0070702_100411108
277 Ga0068852_100033842
278 Ga0068859_100299908
279 Ga0068866_10363164
280 Ga0068870_10774051
281 Ga0068863_100135250
282 Ga0068860_100977881
283 Ga0081455_10005387
284 Ga0070717_10012255
285 Ga0070717_10192534
286 Ga0070717_10315651
287 Ga0070712_100566763
288 Ga0097621_100823475
289 Ga0068871_100229784
290 Ga0075430_100003813
291 Ga0075430_100020074
292 Ga0075433_10100502
293 Ga0075434_100028655
294 Ga0075434_102224309
295 Ga0075436_100118395
296 Ga0075436_100588600
297 Ga0097620_100299926
298 Ga0075435_100533544
299 Ga0105240_10208370
300 Ga0111539_11137911
301 Ga0105245_10983263
302 Ga0105245_11146591
303 Ga0105245_11578332
304 Ga0105247_10006073
305 Ga0105243_10201939
306 Ga0105241_10070800
307 Ga0105242_10183104
308 Ga0105237_10282056
309 Ga0105238_10077964
310 Ga0105246_11076464
311 Ga0157370_10005324
312 Ga0157369_10003714
313 Ga0157369_10029368
314 Ga0157372_10023405
315 Ga0157372_11040656
316 Ga0157375_10382798
317 Ga0163163_10067824
318 Ga0157376_10684431
319 Ga0206356_10230371
320 Ga0206353_10010417
321 Ga0213876_10081283
322 Ga0213875_10014738
323 Ga0213875_10038376
324 Ga0207692_10034531
325 Ga0207710_10000195
326 Ga0207685_10002557
327 Ga0207699_10075105
328 Ga0207707_10080383
329 Ga0207695_10137437
330 Ga0207671_10025669
331 Ga0207693_10519981
332 Ga0207660_10055817
333 Ga0207657_10008519
334 Ga0207652_10009435
335 Ga0207700_10001332
336 Ga0207700_10419708
337 Ga0207664_10281783
338 Ga0207664_10452956
339 Ga0207690_10090218
340 Ga0207686_10198940
341 Ga0207711_10727046
342 Ga0207661_10003960
343 Ga0207661_10322401
344 Ga0207679_10037432
345 Ga0207679_10112296
346 Ga0207679_11165099
347 Ga0207667_10438772
348 Ga0207667_11141324
349 Ga0207712_11656248
350 Ga0207677_10276687
351 Ga0207703_10857572
352 Ga0207639_10139471
353 Ga0207678_10095612
354 Ga0207702_10039183
355 Ga0207702_10236914
356 Ga0207674_10058321
357 Ga0207698_10064958
358 Ga0207428_10217072
359 Ga0307508_10324698
360 Ga0316576_10191993
361 Ga0316580_10067967
362 Ga0373930_0011586
363 Ga0373948_0004793
364 Ga0373939_0015664
365 Ga0373941_0001896
366 Ga0373960_0014546
367 Ga0373955_0761255
368 Ga0373942_0024610
369 Ga0373962_0008405
370 Ga0316574_0040851
371 Ga0373931_0038622
372 Ga0395899_0129972
373 Ga0395899_0169010
374 Ga0395899_0415212
375 Ga0395900_0058465
376 Ga0395900_0313201
377 Ga0395898_0022859
378 Ga0395898_0033859
379 Ga0395898_0844896
380 Ga0395898_1596843
381 Ga0395905_0024832
382 Ga0395905_0574503
383 Ga0395905_0855849
384 Ga0436364_0398421
385 Ga0436364_0558340
386 Ga0436364_0657428
387 Ga0436364_1555547
388 Ga0395901_0007902
389 Ga0395901_0120798
390 Ga0436365_0457088
391 Ga0436365_0595710
392 Ga0436365_1088381
393 Ga0436363_0623813
394 Ga0466969_0062754
395 Ga0466965_0214095
396 Ga0466966_0173154
397 Ga0466961_0044851
398 Ga0466961_0098659
399 Ga0466963_0225600
400 Ga0466963_0275591
401 Ga0466963_0435688
402 Ga0466963_0479619
403 Ga0466964_0303504
404 Ga0466971_0157153
405 Ga0466970_0103874
406 Ga0466957_0442687
407 Ga0466959_0016037
408 Ga0466959_0295033
409 Ga0466959_0433649
410 Ga0466959_0526013
411 Ga0466958_0360803
412 Ga0466967_0043710
413 Ga0466967_0098130
414 Ga0466967_0131328
415 Ga0466967_0162193
416 Ga0466967_0219210
417 Ga0466967_0309542
418 Ga0466967_1428504
419 Ga0466967_1524999
420 Ga0495638_0013351
421 Ga0495582_0053166
422 Ga0495664_0457971
423 Ga0495618_0125069
424 Ga0495620_0152432
425 Ga0495628_0030330
426 Ga0495645_0406220
427 Ga0495625_0000587
428 Ga0495602_0591387
429 Ga0496100_0678702
430 Ga0496100_0877803
431 Ga0496100_0928838
432 Ga0496101_0067300
433 Ga0496102_0145028
434 Ga0496102_0505542
435 Ga0496103_0095078
436 Ga0496104_0022093
437 Ga0496104_1437327
438 Ga0496105_0021349
439 Ga0496105_0046160
440 Ga0496105_0291039
441 Ga0496106_0018262
442 Ga0496108_0076498
443 Ga0496109_0163594
444 Ga0496109_0192003
445 Ga0496109_0211393
446 Ga0496109_0220696
447 Ga0496109_0778517
448 Ga0496109_1048541
449 Ga0496112_0021937
450 Ga0496112_0058732
451 Ga0496112_0376039
452 Ga0496112_0636236
453 Ga0496113_0078647
454 Ga0496113_0082420
455 Ga0496114_0036469
456 Ga0496114_0150964
457 Ga0496115_0012060
458 Ga0496115_0079640
459 Ga0496115_0314323
460 Ga0496115_0412641
461 Ga0496115_0536202
462 Ga0496126_0053142
463 Ga0501036_0349475
464 Ga0501039_0194933
465 Ga0501041_0219105
466 Ga0501042_0052938
467 Ga0501042_0223713
468 Ga0501046_0293940
469 Ga0501075_0079395
470 Ga0501076_0238639
471 Ga0501083_0720509
472 Ga0501035_0373083
473 Ga0501045_0209044
474 nmdc:mga0yw44_352952_c1
475 nmdc:mga0qj67_235966_c1
476 nmdc:mga0qj67_77772_c1
477 nmdc:mga0n895_39179_c1
478 nmdc:mga08x19_565248_c1
479 nmdc:mga0a205_451045_c1
480 Ga0500616_0018760
481 Ga0501084_0560739
482 Ga0501082_0197517
483 Ga0466962_0077631
484 Ga0530510_0649248
485 2676201970
486 2774846546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

66

146

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wv4-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.8325 49 163
3db0-assembly1.cif.gz_B crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution 0.8086 39 160
6ymh-assembly1.cif.gz_AAA x-ray structure of the k72i, y129f, r133l, h199a quadruple mutant of pnp-oxidase from e. coli in complex with plp 0.7969 38 162
2hti-assembly1.cif.gz_A-2 crystal structure of a flavin-nucleotide-binding protein (bh_0577) from bacillus halodurans at 2.50 a resolution 0.7943 36 164
1vl7-assembly1.cif.gz_B crystal structure of a putative heme oxygenase (alr5027) from nostoc sp. pcc 7120 at 1.50 a resolution 0.7857 50 164
ID Description Score Start End Superfamily
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8029 36 164 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7973 36 162 2.30.110.10
af_I1KGP8_130_285_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7861 41 162 2.30.110.10
1vl7B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7857 50 164 2.30.110.10
2htiA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7797 36 164 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7Y3L8L5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9852 2 164
AF-A0A2W6BTA3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9795 1 103
AF-A0A2W6DR64-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9758 1 163 GO:0005829
GO:0016627
GO:0070967
AF-A0A4R7I621-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9734 1 164
AF-A0A7Y3L8L5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9733 2 164

Map