F355987

General Info

Members Datasets Scaffolds Average Seq Length
243 157 486 189

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0122963|Ga0501042_0122963_724_1404
Length 226
Sequence MLGLPIGIRGVVSATCCHFVVRRRQDGVTGNKLRPHRKAVVATLAIVVLAVAILFAMDRPPICTCGYVELWHGTVQSNGNSQHITDWYSPSHFTHGLIMYFFAWLLWRKWKLFDGKPARWALPIAVLVEAAWEVTENTPLVIDRYRAVTVSWGYSGDSIVNSAADIGWMIVGFLVASRVPTRVSVALAIGLELLTLWTIRDNLTLNVIMLLHPFESIKQWQSAIPK

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
111 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
112 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
113 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
114 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
115 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
137 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
138 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
139 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
140 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
141 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
142 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
143 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
144 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
145 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
146 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
147 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
148 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
149 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
150 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
151 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
152 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
153 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
154 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
155 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
156 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
157 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.95
Metatranscriptomes 0
Isolates 9.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.7
Nodule 7.41
Rhizoplane 0.41
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 0.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0122963 3300049578 Bacteria 1869
2 MBSR1b_contig_6592834 2162886012 Bacteria 1924
3 JGI24749J21850_1001404 3300002076 Bacteria 3419
4 JGI24034J26672_10003477 3300002239 Bacteria 2199
5 JGI24742J22300_10014280 3300002244 Bacteria 1334
6 JGI25159J45721_1010482 3300002987 Bacteria 2356
7 JGI25151J46595_10000404 3300003187 Bacteria 44709
8 JGI25160J50197_1008327 3300003354 Bacteria 3958
9 Ga0065715_10002392 3300005293 Bacteria 4828
10 Ga0065715_10149097 3300005293 Bacteria 1751
11 Ga0070658_10002325 3300005327 Bacteria 15950
12 Ga0070658_10653859 3300005327 Bacteria 912
13 Ga0070676_10029907 3300005328 Bacteria 3101
14 Ga0070670_100003781 3300005331 Bacteria 12600
15 Ga0070670_100005739 3300005331 Bacteria 10484
16 Ga0070670_100012112 3300005331 Bacteria 7376
17 Ga0070677_10008289 3300005333 Bacteria 3492
18 Ga0068869_100390028 3300005334 Bacteria 1143
19 Ga0070660_100001300 3300005339 Bacteria 17017
20 Ga0070689_100194757 3300005340 Bacteria 1652
21 Ga0070668_100018366 3300005347 Bacteria 5250
22 Ga0070668_100176107 3300005347 Bacteria 1744
23 Ga0070669_100067131 3300005353 Bacteria 2645
24 Ga0070675_100006372 3300005354 Bacteria 9061
25 Ga0070675_100267651 3300005354 Bacteria 1499
26 Ga0070675_100964040 3300005354 Bacteria 783
27 Ga0070671_100084885 3300005355 Bacteria 2648
28 Ga0070674_100006055 3300005356 Bacteria 7036
29 Ga0070673_100007516 3300005364 Bacteria 7198
30 Ga0070659_100197668 3300005366 Bacteria 1654
31 Ga0070667_100067723 3300005367 Bacteria 3036
32 Ga0070700_100068833 3300005441 Bacteria 2252
33 Ga0070663_100001641 3300005455 Bacteria 12354
34 Ga0070663_100194234 3300005455 Bacteria 1581
35 Ga0070678_100029607 3300005456 Bacteria 3752
36 Ga0070662_100027529 3300005457 Bacteria 3946
37 Ga0070662_100072106 3300005457 Bacteria 2549
38 Ga0070681_10249419 3300005458 Bacteria 1688
39 Ga0068867_100043300 3300005459 Bacteria 3296
40 Ga0070679_100245099 3300005530 Bacteria 1749
41 Ga0068853_100275594 3300005539 Bacteria 1550
42 Ga0070672_100061238 3300005543 Bacteria 2966
43 Ga0070704_100225496 3300005549 Bacteria 1526
44 Ga0070664_100023577 3300005564 Bacteria 5084
45 Ga0068857_100282104 3300005577 Bacteria 1528
46 Ga0068857_100688113 3300005577 Bacteria 971
47 Ga0068859_100038833 3300005617 Bacteria 4775
48 Ga0068864_100017939 3300005618 Bacteria 5905
49 Ga0068866_10569640 3300005718 Bacteria 760
50 Ga0068870_10132638 3300005840 Bacteria 1449
51 Ga0068862_100013147 3300005844 Bacteria 6846
52 Ga0068862_100251486 3300005844 Bacteria 1611
53 Ga0075365_10329207 3300006038 Bacteria 1076
54 Ga0075431_100073768 3300006847 Bacteria 3521
55 Ga0068865_100031845 3300006881 Bacteria 3519
56 Ga0097620_100038836 3300006931 Bacteria 4775
57 Ga0111539_10411513 3300009094 Bacteria 1575
58 Ga0105243_10073266 3300009148 Bacteria 2775
59 Ga0105239_10486232 3300010375 Bacteria 1403
60 Ga0157316_1006940 3300012510 Bacteria 945
61 Ga0157371_10077940 3300013102 Bacteria 2347
62 Ga0163163_11193958 3300014325 Bacteria 823
63 Ga0157380_10007346 3300014326 Bacteria 7824
64 Ga0157380_10008061 3300014326 Bacteria 7504
65 Ga0157380_10067751 3300014326 Bacteria 2875
66 Ga0157380_10105740 3300014326 Bacteria 2353
67 Ga0157380_10213749 3300014326 Unclassified 1720
68 Ga0157380_10393605 3300014326 Bacteria 1312
69 Ga0157380_10711512 3300014326 Bacteria 1011
70 Ga0163161_10035822 3300017792 Bacteria 3553
71 Ga0209130_1001695 3300025284 Bacteria 13327
72 Ga0209025_1000681 3300025294 Bacteria 58289
73 Ga0209758_1016093 3300025297 Bacteria 3820
74 Ga0207426_1000046 3300025302 Bacteria 422271
75 Ga0207697_10000628 3300025315 Bacteria 20080
76 Ga0207682_10001847 3300025893 Bacteria 9645
77 Ga0207642_10475659 3300025899 Bacteria 761
78 Ga0207688_10030714 3300025901 Bacteria 2963
79 Ga0207647_10321334 3300025904 Bacteria 879
80 Ga0207645_10013072 3300025907 Bacteria 5608
81 Ga0207643_10099485 3300025908 Bacteria 1704
82 Ga0207705_10011618 3300025909 Bacteria 6364
83 Ga0207707_10211099 3300025912 Bacteria 1691
84 Ga0207657_10000267 3300025919 Bacteria 55426
85 Ga0207652_10143220 3300025921 Bacteria 2138
86 Ga0207681_10022174 3300025923 Bacteria 4046
87 Ga0207681_10828506 3300025923 Bacteria 773
88 Ga0207650_10003293 3300025925 Bacteria 11114
89 Ga0207650_10026269 3300025925 Bacteria 4151
90 Ga0207659_10055344 3300025926 Bacteria 2837
91 Ga0207700_10463619 3300025928 Bacteria 1118
92 Ga0207644_10015053 3300025931 Bacteria 5189
93 Ga0207690_10138541 3300025932 Bacteria 1790
94 Ga0207706_10010474 3300025933 Bacteria 8472
95 Ga0207706_10072199 3300025933 Bacteria 3036
96 Ga0207691_10015579 3300025940 Bacteria 7228
97 Ga0207691_10428756 3300025940 Bacteria 1126
98 Ga0207689_10300763 3300025942 Bacteria 1330
99 Ga0207661_10021605 3300025944 Bacteria 4825
100 Ga0207679_10106472 3300025945 Bacteria 2204
101 Ga0207712_10641207 3300025961 Bacteria 922
102 Ga0207668_10027026 3300025972 Bacteria 3734
103 Ga0207668_10097493 3300025972 Bacteria 2176
104 Ga0207658_10076088 3300025986 Bacteria 2556
105 Ga0207639_10285741 3300026041 Bacteria 1452
106 Ga0207678_10000740 3300026067 Bacteria 29953
107 Ga0207678_10226094 3300026067 Bacteria 1602
108 Ga0207708_10098190 3300026075 Bacteria 2264
109 Ga0207648_10045953 3300026089 Bacteria 3828
110 Ga0207676_10135660 3300026095 Bacteria 2099
111 Ga0207674_10452658 3300026116 Bacteria 1241
112 Ga0207675_100065285 3300026118 Bacteria 3401
113 Ga0207683_10025801 3300026121 Bacteria 5070
114 Ga0268265_10103610 3300028380 Bacteria 2304
115 Ga0307408_100205888 3300031548 Bacteria 1596
116 Ga0307408_100464025 3300031548 Bacteria 1101
117 Ga0307405_10001888 3300031731 Bacteria 8999
118 Ga0307405_10030049 3300031731 Bacteria 3183
119 Ga0307405_10076893 3300031731 Bacteria 2167
120 Ga0307413_10013920 3300031824 Bacteria 4067
121 Ga0307413_10023727 3300031824 Bacteria 3329
122 Ga0307413_10096114 3300031824 Bacteria 1944
123 Ga0307413_10101328 3300031824 Bacteria 1904
124 Ga0307413_10140892 3300031824 Bacteria 1666
125 Ga0307413_10557304 3300031824 Bacteria 931
126 Ga0307413_10582983 3300031824 Bacteria 913
127 Ga0307413_10628902 3300031824 Bacteria 882
128 Ga0307410_10033137 3300031852 Bacteria 3333
129 Ga0307410_10149614 3300031852 Bacteria 1737
130 Ga0307410_10174961 3300031852 Bacteria 1621
131 Ga0307406_10043288 3300031901 Bacteria 2815
132 Ga0307406_10195080 3300031901 Bacteria 1486
133 Ga0307406_10212929 3300031901 Bacteria 1431
134 Ga0307406_10666904 3300031901 Bacteria 865
135 Ga0307407_10490166 3300031903 Bacteria 899
136 Ga0307407_10962755 3300031903 Bacteria 658
137 Ga0307412_10021065 3300031911 Bacteria 3978
138 Ga0307412_10097625 3300031911 Bacteria 2070
139 Ga0307412_10288745 3300031911 Bacteria 1291
140 Ga0307412_10293233 3300031911 Unclassified 1282
141 Ga0307412_10299562 3300031911 Bacteria 1270
142 Ga0307412_10341898 3300031911 Bacteria 1198
143 Ga0307412_10483646 3300031911 Bacteria 1027
144 Ga0307409_100090414 3300031995 Bacteria 2506
145 Ga0307409_100402290 3300031995 Bacteria 1308
146 Ga0307409_100451069 3300031995 Bacteria 1241
147 Ga0307409_101169368 3300031995 Bacteria 792
148 Ga0307414_10003577 3300032004 Bacteria 8316
149 Ga0307414_10021121 3300032004 Bacteria 4076
150 Ga0307414_10047392 3300032004 Bacteria 2957
151 Ga0307414_10138561 3300032004 Bacteria 1901
152 Ga0307414_10216169 3300032004 Bacteria 1570
153 Ga0307414_10237482 3300032004 Bacteria 1507
154 Ga0307414_10329364 3300032004 Bacteria 1303
155 Ga0307414_10354998 3300032004 Bacteria 1259
156 Ga0307414_10393029 3300032004 Bacteria 1202
157 Ga0307414_10836395 3300032004 Bacteria 841
158 Ga0307414_11137056 3300032004 Bacteria 722
159 Ga0307411_10025555 3300032005 Bacteria 3540
160 Ga0307411_10035547 3300032005 Bacteria 3113
161 Ga0307411_10104940 3300032005 Bacteria 2008
162 Ga0307411_10226938 3300032005 Bacteria 1453
163 Ga0307411_10258204 3300032005 Bacteria 1374
164 Ga0307411_10538181 3300032005 Bacteria 994
165 Ga0307411_10704207 3300032005 Bacteria 880
166 Ga0307411_10796880 3300032005 Bacteria 832
167 Ga0307415_100101195 3300032126 Bacteria 2114
168 Ga0307415_100383384 3300032126 Bacteria 1194
169 Ga0373931_0029060 3300035691 Bacteria 2835
170 Ga0395899_0001291 3300037312 Bacteria 21622
171 Ga0395899_0063145 3300037312 Bacteria 2725
172 Ga0395900_0000447 3300037418 Bacteria 59069
173 Ga0395900_0018225 3300037418 Bacteria 7162
174 Ga0395898_0003866 3300037466 Bacteria 16551
175 Ga0395898_0027441 3300037466 Bacteria 5715
176 Ga0395905_0000083 3300037471 Bacteria 158407
177 Ga0395905_0019795 3300037471 Bacteria 6380
178 Ga0395905_0072709 3300037471 Bacteria 3224
179 Ga0395905_0074178 3300037471 Bacteria 3188
180 Ga0395901_0000324 3300038443 Bacteria 59134
181 Ga0395901_0014876 3300038443 Bacteria 7905
182 Ga0395901_0074310 3300038443 Bacteria 3546
183 Ga0395901_0126752 3300038443 Bacteria 2682
184 Ga0436365_0953486 3300039437 Bacteria 879
185 Ga0439439_0045936 3300041406 Bacteria 1140
186 Ga0439465_0077239 3300041413 Bacteria 1124
187 Ga0451791_0286164 3300041451 Bacteria 718
188 Ga0439431_0026464 3300041997 Bacteria 1421
189 Ga0439445_0000309 3300042004 Bacteria 9467
190 Ga0439445_0076061 3300042004 Bacteria 934
191 Ga0439460_0212660 3300042461 Bacteria 661
192 Ga0495638_0262404 3300046460 Bacteria 947
193 Ga0495585_0063964 3300046492 Bacteria 2018
194 Ga0495610_0004131 3300046512 Bacteria 10862
195 Ga0495663_0000681 3300046525 Bacteria 11718
196 Ga0495663_0120718 3300046525 Bacteria 877
197 Ga0495642_0016819 3300046528 Bacteria 2853
198 Ga0495598_0012513 3300046537 Bacteria 2085
199 Ga0495598_0018741 3300046537 Bacteria 1803
200 Ga0495621_0000022 3300046539 Bacteria 28970
201 Ga0495621_0000400 3300046539 Bacteria 10696
202 Ga0495621_0028342 3300046539 Bacteria 1903
203 Ga0495621_0064941 3300046539 Bacteria 1332
204 Ga0495633_0025616 3300046558 Bacteria 2903
205 Ga0495659_0005971 3300046664 Bacteria 3851
206 Ga0495669_0008131 3300046684 Bacteria 4402
207 Ga0495670_0011284 3300046691 Bacteria 4392
208 Ga0495670_0051972 3300046691 Bacteria 2051
209 Ga0495670_0062148 3300046691 Bacteria 1878
210 Ga0495670_0065936 3300046691 Bacteria 1826
211 Ga0495683_0280163 3300047323 Bacteria 722
212 Ga0495677_0034896 3300047445 Bacteria 1835
213 Ga0495677_0119722 3300047445 Bacteria 1003
214 Ga0495685_135130 3300047447 Bacteria 805
215 Ga0495615_0001159 3300048090 Bacteria 3810
216 Ga0496121_0482510 3300048924 Bacteria 791
217 Ga0501044_0196327 3300049823 Bacteria 1978
218 nmdc:mga0yw44_208150_c1 3300050492 Bacteria 1293
219 nmdc:mga06r32_67126_c1 3300050510 Bacteria 3462
220 nmdc:mga08y16_526926_c1 3300050511 Bacteria 1198
221 nmdc:mga08y16_986509_c1 3300050511 Bacteria 823
222 2643951941 2643221588 Bacteria 3692460
223 2821450701 2821443989 Bacteria 7658172
224 2844536601 2844533157 Bacteria 7517899
225 2856369963 2856364286 Bacteria 6939991
226 2869165331 2869162929 Bacteria 6399702
227 2869290770 2869285874 Bacteria 6901219
228 2871433052 2871429161 Bacteria 6547891
229 2874153787 2874146452 Bacteria 7533118
230 2874161052 2874155637 Bacteria 6724144
231 2876419092 2876413966 Bacteria 6831344
232 2878750665 2878745973 Bacteria 6867388
233 2896432071 2896429255 Bacteria 2557483
234 2903496272 2903492973 Bacteria 13473544
235 2906313590 2906308376 Bacteria 6841989
236 2906326299 2906321335 Bacteria 6579571
237 2937820105 2937813078 Bacteria 7783518
238 2958135170 2958130278 Bacteria 6897202
239 2958184199 2958179912 Bacteria 6874908
240 2961082254 2961077736 Bacteria 7079850
241 2977850351 2977843712 Bacteria 6753583
242 8004393059 8004387939 Bacteria 7049250
243 8004719846 8004714634 Bacteria 6776161
244 Ga0501042_0122963
245 MBSR1b_contig_6592834
246 JGI24749J21850_1001404
247 JGI24034J26672_10003477
248 JGI24742J22300_10014280
249 JGI25159J45721_1010482
250 JGI25151J46595_10000404
251 JGI25160J50197_1008327
252 Ga0065715_10002392
253 Ga0065715_10149097
254 Ga0070658_10002325
255 Ga0070658_10653859
256 Ga0070676_10029907
257 Ga0070670_100003781
258 Ga0070670_100005739
259 Ga0070670_100012112
260 Ga0070677_10008289
261 Ga0068869_100390028
262 Ga0070660_100001300
263 Ga0070689_100194757
264 Ga0070668_100018366
265 Ga0070668_100176107
266 Ga0070669_100067131
267 Ga0070675_100006372
268 Ga0070675_100267651
269 Ga0070675_100964040
270 Ga0070671_100084885
271 Ga0070674_100006055
272 Ga0070673_100007516
273 Ga0070659_100197668
274 Ga0070667_100067723
275 Ga0070700_100068833
276 Ga0070663_100001641
277 Ga0070663_100194234
278 Ga0070678_100029607
279 Ga0070662_100027529
280 Ga0070662_100072106
281 Ga0070681_10249419
282 Ga0068867_100043300
283 Ga0070679_100245099
284 Ga0068853_100275594
285 Ga0070672_100061238
286 Ga0070704_100225496
287 Ga0070664_100023577
288 Ga0068857_100282104
289 Ga0068857_100688113
290 Ga0068859_100038833
291 Ga0068864_100017939
292 Ga0068866_10569640
293 Ga0068870_10132638
294 Ga0068862_100013147
295 Ga0068862_100251486
296 Ga0075365_10329207
297 Ga0075431_100073768
298 Ga0068865_100031845
299 Ga0097620_100038836
300 Ga0111539_10411513
301 Ga0105243_10073266
302 Ga0105239_10486232
303 Ga0157316_1006940
304 Ga0157371_10077940
305 Ga0163163_11193958
306 Ga0157380_10007346
307 Ga0157380_10008061
308 Ga0157380_10067751
309 Ga0157380_10105740
310 Ga0157380_10213749
311 Ga0157380_10393605
312 Ga0157380_10711512
313 Ga0163161_10035822
314 Ga0209130_1001695
315 Ga0209025_1000681
316 Ga0209758_1016093
317 Ga0207426_1000046
318 Ga0207697_10000628
319 Ga0207682_10001847
320 Ga0207642_10475659
321 Ga0207688_10030714
322 Ga0207647_10321334
323 Ga0207645_10013072
324 Ga0207643_10099485
325 Ga0207705_10011618
326 Ga0207707_10211099
327 Ga0207657_10000267
328 Ga0207652_10143220
329 Ga0207681_10022174
330 Ga0207681_10828506
331 Ga0207650_10003293
332 Ga0207650_10026269
333 Ga0207659_10055344
334 Ga0207700_10463619
335 Ga0207644_10015053
336 Ga0207690_10138541
337 Ga0207706_10010474
338 Ga0207706_10072199
339 Ga0207691_10015579
340 Ga0207691_10428756
341 Ga0207689_10300763
342 Ga0207661_10021605
343 Ga0207679_10106472
344 Ga0207712_10641207
345 Ga0207668_10027026
346 Ga0207668_10097493
347 Ga0207658_10076088
348 Ga0207639_10285741
349 Ga0207678_10000740
350 Ga0207678_10226094
351 Ga0207708_10098190
352 Ga0207648_10045953
353 Ga0207676_10135660
354 Ga0207674_10452658
355 Ga0207675_100065285
356 Ga0207683_10025801
357 Ga0268265_10103610
358 Ga0307408_100205888
359 Ga0307408_100464025
360 Ga0307405_10001888
361 Ga0307405_10030049
362 Ga0307405_10076893
363 Ga0307413_10013920
364 Ga0307413_10023727
365 Ga0307413_10096114
366 Ga0307413_10101328
367 Ga0307413_10140892
368 Ga0307413_10557304
369 Ga0307413_10582983
370 Ga0307413_10628902
371 Ga0307410_10033137
372 Ga0307410_10149614
373 Ga0307410_10174961
374 Ga0307406_10043288
375 Ga0307406_10195080
376 Ga0307406_10212929
377 Ga0307406_10666904
378 Ga0307407_10490166
379 Ga0307407_10962755
380 Ga0307412_10021065
381 Ga0307412_10097625
382 Ga0307412_10288745
383 Ga0307412_10293233
384 Ga0307412_10299562
385 Ga0307412_10341898
386 Ga0307412_10483646
387 Ga0307409_100090414
388 Ga0307409_100402290
389 Ga0307409_100451069
390 Ga0307409_101169368
391 Ga0307414_10003577
392 Ga0307414_10021121
393 Ga0307414_10047392
394 Ga0307414_10138561
395 Ga0307414_10216169
396 Ga0307414_10237482
397 Ga0307414_10329364
398 Ga0307414_10354998
399 Ga0307414_10393029
400 Ga0307414_10836395
401 Ga0307414_11137056
402 Ga0307411_10025555
403 Ga0307411_10035547
404 Ga0307411_10104940
405 Ga0307411_10226938
406 Ga0307411_10258204
407 Ga0307411_10538181
408 Ga0307411_10704207
409 Ga0307411_10796880
410 Ga0307415_100101195
411 Ga0307415_100383384
412 Ga0373931_0029060
413 Ga0395899_0001291
414 Ga0395899_0063145
415 Ga0395900_0000447
416 Ga0395900_0018225
417 Ga0395898_0003866
418 Ga0395898_0027441
419 Ga0395905_0000083
420 Ga0395905_0019795
421 Ga0395905_0072709
422 Ga0395905_0074178
423 Ga0395901_0000324
424 Ga0395901_0014876
425 Ga0395901_0074310
426 Ga0395901_0126752
427 Ga0436365_0953486
428 Ga0439439_0045936
429 Ga0439465_0077239
430 Ga0451791_0286164
431 Ga0439431_0026464
432 Ga0439445_0000309
433 Ga0439445_0076061
434 Ga0439460_0212660
435 Ga0495638_0262404
436 Ga0495585_0063964
437 Ga0495610_0004131
438 Ga0495663_0000681
439 Ga0495663_0120718
440 Ga0495642_0016819
441 Ga0495598_0012513
442 Ga0495598_0018741
443 Ga0495621_0000022
444 Ga0495621_0000400
445 Ga0495621_0028342
446 Ga0495621_0064941
447 Ga0495633_0025616
448 Ga0495659_0005971
449 Ga0495669_0008131
450 Ga0495670_0011284
451 Ga0495670_0051972
452 Ga0495670_0062148
453 Ga0495670_0065936
454 Ga0495683_0280163
455 Ga0495677_0034896
456 Ga0495677_0119722
457 Ga0495685_135130
458 Ga0495615_0001159
459 Ga0496121_0482510
460 Ga0501044_0196327
461 nmdc:mga0yw44_208150_c1
462 nmdc:mga06r32_67126_c1
463 nmdc:mga08y16_526926_c1
464 nmdc:mga08y16_986509_c1
465 2643951941
466 2821450701
467 2844536601
468 2856369963
469 2869165331
470 2869290770
471 2871433052
472 2874153787
473 2874161052
474 2876419092
475 2878750665
476 2896432071
477 2903496272
478 2906313590
479 2906326299
480 2937820105
481 2958135170
482 2958184199
483 2961082254
484 2977850351
485 8004393059
486 8004719846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10755

DUF2585

Protein of unknown function (DUF2585)

54

223

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m76-assembly1.cif.gz_L room temperature xfel crystallography reveals asymmetry in the vicinity of the two phylloquinones in photosystem i 0.3632 59 161
3o2r-assembly2.cif.gz_D structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.3535 39 153
6jeo-assembly1.cif.gz_bL structure of psi tetramer from anabaena 0.3058 62 164
8dnv-assembly1.cif.gz_A cryo-em structure of the human sec61 complex in a partially-open apo state (class 1) 0.304 16 140
3o2r-assembly2.cif.gz_D structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.2998 39 153
ID Description Score Start End Superfamily
2v50E05 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.5697 66 143 1.20.1640.10
af_Q10LS9_586_804_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.4382 66 143 3.30.830.10
af_Q2G074_3_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.4363 10 141 1.10.3470.10
5mr3E00 Mainly Alpha;Up-down Bundle;Lysin;Fertilization protein 0.3955 43 137 1.20.150.10
af_Q69KJ0_37_207_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.3781 57 155 1.10.1520.10
ID Description Score Start End GO Terms
AF-A0A7W1BZL7-F1-model_v4 DUF2585 family protein 0.9582 50 187 GO:0005886
AF-A0A357CF60-F1-model_v4 DUF2585 domain-containing protein 0.9526 50 187 GO:0005886
AF-A0A502CE46-F1-model_v4 UPF0314 protein EAH84_11790 0.9462 10 187 GO:0005886
AF-A0A4T1ZX65-F1-model_v4 deleted 0.9458 15 187
AF-A0A1M3PCA9-F1-model_v4 UPF0314 protein BGP12_16935 0.9433 11 187 GO:0005886

Map