F355852

General Info

Members Datasets Scaffolds Average Seq Length
243 143 486 248

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0032963|Ga0466959_0032963_529_1365
Length 278
Sequence VLSNACGKWGFVENGIDSLSAPVPGSTPGPSAGFHPVRIGCSGWNYAHWRNGVFYPERLPARKWLDFYARHFDTVEVNSTFYRLPRRDAVANWVVQSPPRFTFAIKASRYLTHVKRLTELGPGLERFYERIEPMLRSPKMGPVLWQLPPSFRRDDERLRNALAQLPSAQRHCVEFRHPSWFVEETYAALREHEVALVIGDRPEVNEYRTLELTTDFTFVRFHAGTRGKNGNYSETELVEWAERFAGWRPHVTIWAYFNNDWEGYAPRNALRLKELLGV

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
76 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.88
Rhizosphere 88.48
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0032963 3300045049 Bacteria 3833
2 Ga0070658_10007721 3300005327 Bacteria 8667
3 Ga0070683_100345543 3300005329 Bacteria 1417
4 Ga0068868_100010668 3300005338 Bacteria 6658
5 Ga0070691_10046241 3300005341 Bacteria 2067
6 Ga0070709_10055251 3300005434 Bacteria 2506
7 Ga0070709_10207154 3300005434 Bacteria 1392
8 Ga0070714_100006571 3300005435 Bacteria 8993
9 Ga0070713_100632979 3300005436 Bacteria 1018
10 Ga0070710_10127502 3300005437 Bacteria 1548
11 Ga0070711_100323121 3300005439 Bacteria 1233
12 Ga0070705_100011382 3300005440 Bacteria 4488
13 Ga0070705_100040227 3300005440 Bacteria 2657
14 Ga0070694_100073518 3300005444 Bacteria 2361
15 Ga0070708_100057191 3300005445 Unclassified 3471
16 Ga0070678_100440102 3300005456 Bacteria 1140
17 Ga0070685_10398176 3300005466 Bacteria 953
18 Ga0070706_100049551 3300005467 Bacteria 3876
19 Ga0070706_100363394 3300005467 Unclassified 1349
20 Ga0070707_100009422 3300005468 Bacteria 9063
21 Ga0070707_100055638 3300005468 Bacteria 3793
22 Ga0070698_100011372 3300005471 Bacteria 9446
23 Ga0070698_100677703 3300005471 Bacteria 973
24 Ga0070699_100306125 3300005518 Unclassified 1426
25 Ga0070699_100406361 3300005518 Unclassified 1232
26 Ga0070679_100045881 3300005530 Bacteria 4354
27 Ga0070684_100144216 3300005535 Archaea 2155
28 Ga0070684_100209465 3300005535 Bacteria 1777
29 Ga0070697_100067224 3300005536 Bacteria 2932
30 Ga0070695_100140701 3300005545 Unclassified 1673
31 Ga0070695_100187038 3300005545 Bacteria 1471
32 Ga0070696_100081441 3300005546 Bacteria 2293
33 Ga0070704_100038908 3300005549 Bacteria 3262
34 Ga0070704_100093880 3300005549 Bacteria 2243
35 Ga0068855_100078598 3300005563 Bacteria 3827
36 Ga0068855_100294456 3300005563 Bacteria 1798
37 Ga0070664_100194483 3300005564 Bacteria 1808
38 Ga0068856_100052582 3300005614 Bacteria 4017
39 Ga0068861_100073450 3300005719 Bacteria 2657
40 Ga0068863_100402917 3300005841 Bacteria 1338
41 Ga0070717_10007750 3300006028 Bacteria 7987
42 Ga0075432_10011519 3300006058 Bacteria 3005
43 Ga0075432_10081358 3300006058 Bacteria 1175
44 Ga0070716_100008797 3300006173 Bacteria 5015
45 Ga0070716_100259917 3300006173 Bacteria 1187
46 Ga0070712_100121951 3300006175 Bacteria 1962
47 Ga0070712_100131323 3300006175 Bacteria 1898
48 Ga0075428_100148351 3300006844 Bacteria 2548
49 Ga0075431_100003713 3300006847 Bacteria 14835
50 Ga0075433_10127246 3300006852 Unclassified 2262
51 Ga0075434_100069891 3300006871 Bacteria 3501
52 Ga0075434_100357815 3300006871 Bacteria 1481
53 Ga0075436_100123232 3300006914 Unclassified 1815
54 Ga0075436_100255214 3300006914 Bacteria 1249
55 Ga0075435_100008061 3300007076 Bacteria 7540
56 Ga0075435_100079725 3300007076 Bacteria 2687
57 Ga0111539_10014533 3300009094 Bacteria 9830
58 Ga0111539_10265793 3300009094 Bacteria 1997
59 Ga0105245_10007026 3300009098 Bacteria 9879
60 Ga0105245_10212531 3300009098 Bacteria 1862
61 Ga0114129_10029118 3300009147 Bacteria 7822
62 Ga0114129_10116038 3300009147 Bacteria 3689
63 Ga0105243_10263196 3300009148 Bacteria 1545
64 Ga0105243_10341080 3300009148 Unclassified 1372
65 Ga0105249_10438071 3300009553 Bacteria 1344
66 Ga0105239_10108040 3300010375 Bacteria 3082
67 Ga0105239_10290939 3300010375 Bacteria 1840
68 Ga0157369_10006270 3300013105 Bacteria 13803
69 Ga0157378_10208502 3300013297 Bacteria 1852
70 Ga0157372_10065590 3300013307 Bacteria 4077
71 Ga0157372_10436912 3300013307 Bacteria 1525
72 Ga0157380_10409530 3300014326 Bacteria 1289
73 Ga0157377_10113585 3300014745 Bacteria 1631
74 Ga0157377_10132525 3300014745 Bacteria 1524
75 Ga0163161_10514765 3300017792 Bacteria 976
76 Ga0206353_12044435 3300020082 Bacteria 7094
77 Ga0213876_10071330 3300021384 Bacteria 1835
78 Ga0207692_10083817 3300025898 Bacteria 1711
79 Ga0207688_10021001 3300025901 Bacteria 3565
80 Ga0207684_10187857 3300025910 Bacteria 1782
81 Ga0207693_10001814 3300025915 Bacteria 18729
82 Ga0207693_10002699 3300025915 Bacteria 15380
83 Ga0207693_10013649 3300025915 Bacteria 6547
84 Ga0207646_10093582 3300025922 Bacteria 2691
85 Ga0207646_10345996 3300025922 Unclassified 1343
86 Ga0207646_10641750 3300025922 Bacteria 951
87 Ga0207687_10252458 3300025927 Bacteria 1403
88 Ga0207664_10046653 3300025929 Bacteria 3402
89 Ga0207664_10561943 3300025929 Bacteria 1024
90 Ga0207706_10157212 3300025933 Bacteria 1999
91 Ga0207709_10172298 3300025935 Bacteria 1520
92 Ga0207665_10027074 3300025939 Bacteria 3787
93 Ga0207689_10251265 3300025942 Bacteria 1462
94 Ga0207679_10303799 3300025945 Bacteria 1376
95 Ga0207677_10606433 3300026023 Bacteria 961
96 Ga0207702_10089441 3300026078 Bacteria 2692
97 Ga0207641_10257749 3300026088 Bacteria 1632
98 Ga0207675_100009908 3300026118 Bacteria 8917
99 Ga0207428_10010030 3300027907 Bacteria 8477
100 Ga0307408_100162119 3300031548 Bacteria 1777
101 Ga0307408_100342841 3300031548 Bacteria 1265
102 Ga0307409_100449208 3300031995 Bacteria 1244
103 Ga0307409_100938442 3300031995 Bacteria 881
104 Ga0307416_100113712 3300032002 Bacteria 2393
105 Ga0307416_100344954 3300032002 Bacteria 1504
106 Ga0373940_0005405 3300035088 Bacteria 2766
107 Ga0373944_0073372 3300035089 Unclassified 1119
108 Ga0373946_0038716 3300035171 Bacteria 1944
109 Ga0373946_0094914 3300035171 Bacteria 1328
110 Ga0373962_0051636 3300035242 Bacteria 1186
111 Ga0373947_0019756 3300035725 Bacteria 3886
112 Ga0373925_0005063 3300037068 Bacteria 9868
113 Ga0373925_0017357 3300037068 Bacteria 5216
114 Ga0395899_0001963 3300037312 Bacteria 16910
115 Ga0395899_0006551 3300037312 Bacteria 9025
116 Ga0395899_0074205 3300037312 Bacteria 2485
117 Ga0395899_0336553 3300037312 Bacteria 1013
118 Ga0395900_0014144 3300037418 Bacteria 8148
119 Ga0395900_0019428 3300037418 Bacteria 6927
120 Ga0395900_0023013 3300037418 Bacteria 6377
121 Ga0395900_0042942 3300037418 Bacteria 4658
122 Ga0395900_0086734 3300037418 Bacteria 3217
123 Ga0395900_0242159 3300037418 Bacteria 1809
124 Ga0395898_0002345 3300037466 Bacteria 22578
125 Ga0395898_0008235 3300037466 Bacteria 11019
126 Ga0395898_0019085 3300037466 Bacteria 6980
127 Ga0395898_0064669 3300037466 Bacteria 3548
128 Ga0395898_0089782 3300037466 Bacteria 2957
129 Ga0395898_0139756 3300037466 Bacteria 2318
130 Ga0395905_0024654 3300037471 Bacteria 5675
131 Ga0395905_0290916 3300037471 Bacteria 1520
132 Ga0395905_0327620 3300037471 Bacteria 1422
133 Ga0395905_0399017 3300037471 Bacteria 1270
134 Ga0395901_0001749 3300038443 Bacteria 22444
135 Ga0395901_0002557 3300038443 Bacteria 18428
136 Ga0395901_0003365 3300038443 Bacteria 16107
137 Ga0395901_0012793 3300038443 Bacteria 8510
138 Ga0395901_0035441 3300038443 Bacteria 5155
139 Ga0395901_0041660 3300038443 Bacteria 4760
140 Ga0395901_0150796 3300038443 Bacteria 2443
141 Ga0395901_0285059 3300038443 Bacteria 1715
142 Ga0395901_0285113 3300038443 Bacteria 1715
143 Ga0436365_0476844 3300039437 Bacteria 1169
144 Ga0436365_1323523 3300039437 Bacteria 4032
145 Ga0436360_0321550 3300039438 Bacteria 5862
146 Ga0436363_0104295 3300039450 Bacteria 1419
147 Ga0439448_0012151 3300042005 Bacteria 2573
148 Ga0466969_0137391 3300044656 Bacteria 1131
149 Ga0466966_0019295 3300044684 Bacteria 4487
150 Ga0466961_0023921 3300044693 Bacteria 3930
151 Ga0466961_0184806 3300044693 Bacteria 1293
152 Ga0466963_0002755 3300044694 Bacteria 9916
153 Ga0466964_0018434 3300044706 Bacteria 2679
154 Ga0466964_0022804 3300044706 Bacteria 2431
155 Ga0466971_0000741 3300044719 Bacteria 13061
156 Ga0466971_0001008 3300044719 Bacteria 11637
157 Ga0466971_0044770 3300044719 Bacteria 1987
158 Ga0466968_0004113 3300044735 Bacteria 5419
159 Ga0466968_0028112 3300044735 Bacteria 2318
160 Ga0466957_0000806 3300044842 Bacteria 15982
161 Ga0466957_0050458 3300044842 Bacteria 2532
162 Ga0466957_0070029 3300044842 Bacteria 2167
163 Ga0466957_0085173 3300044842 Bacteria 1974
164 Ga0466959_0028355 3300045049 Bacteria 4152
165 Ga0466958_0026945 3300045836 Bacteria 3398
166 Ga0466958_0039422 3300045836 Bacteria 2838
167 Ga0466958_0288103 3300045836 Bacteria 1053
168 Ga0466967_0020214 3300045976 Bacteria 5375
169 Ga0466967_0020643 3300045976 Bacteria 5330
170 Ga0466967_0032784 3300045976 Bacteria 4391
171 Ga0466967_0039696 3300045976 Bacteria 4049
172 Ga0466967_0049682 3300045976 Bacteria 3669
173 Ga0466967_0152287 3300045976 Bacteria 2163
174 Ga0466967_0163106 3300045976 Bacteria 2093
175 Ga0466967_0213370 3300045976 Bacteria 1832
176 Ga0466967_0325853 3300045976 Bacteria 1482
177 Ga0495603_0246380 3300046455 Bacteria 1029
178 Ga0495582_0190550 3300046473 Bacteria 1170
179 Ga0495639_0160242 3300046475 Unclassified 1089
180 Ga0495664_0369546 3300046477 Bacteria 863
181 Ga0495630_0030254 3300046517 Bacteria 4027
182 Ga0495609_0115457 3300046538 Bacteria 1157
183 Ga0495657_0346020 3300046675 Bacteria 880
184 Ga0495658_0004856 3300046683 Bacteria 6596
185 Ga0495658_0142289 3300046683 Bacteria 1468
186 Ga0495624_0279222 3300046690 Bacteria 1009
187 Ga0495676_0020388 3300047321 Bacteria 5816
188 Ga0495676_0077822 3300047321 Bacteria 2528
189 Ga0496101_0125228 3300048904 Bacteria 1947
190 Ga0496102_0004852 3300048905 Bacteria 11377
191 Ga0496104_0007561 3300048907 Bacteria 9613
192 Ga0496105_0496480 3300048908 Bacteria 958
193 Ga0496106_0105545 3300048909 Bacteria 2189
194 Ga0496108_0016787 3300048911 Bacteria 5980
195 Ga0496108_0498008 3300048911 Bacteria 1064
196 Ga0496108_0587656 3300048911 Bacteria 971
197 Ga0496109_0005519 3300048912 Bacteria 10592
198 Ga0496109_0131104 3300048912 Bacteria 2340
199 Ga0496109_0179389 3300048912 Bacteria 1989
200 Ga0496109_0529512 3300048912 Bacteria 1112
201 Ga0496110_0001380 3300048913 Bacteria 17510
202 Ga0496110_0048461 3300048913 Bacteria 3725
203 Ga0496110_0155771 3300048913 Bacteria 2070
204 Ga0496110_0201103 3300048913 Bacteria 1810
205 Ga0496111_0071329 3300048914 Bacteria 2528
206 Ga0496111_0083095 3300048914 Bacteria 2340
207 Ga0496112_0051422 3300048915 Bacteria 4042
208 Ga0496112_0507707 3300048915 Bacteria 1141
209 Ga0496112_0732551 3300048915 Bacteria 916
210 Ga0496113_0022463 3300048916 Bacteria 4463
211 Ga0496114_0386203 3300048917 Bacteria 1240
212 Ga0496115_0071584 3300048918 Bacteria 2812
213 Ga0501034_0096033 3300049571 Bacteria 2960
214 Ga0501067_0017753 3300049583 Bacteria 3940
215 Ga0501070_0035908 3300049586 Bacteria 4139
216 Ga0501070_0182504 3300049586 Bacteria 1727
217 Ga0501072_0006763 3300049588 Bacteria 8707
218 Ga0501073_0007899 3300049589 Bacteria 7893
219 Ga0501073_0116343 3300049589 Bacteria 1853
220 Ga0501074_0066172 3300049590 Bacteria 2599
221 Ga0501074_0201689 3300049590 Bacteria 1418
222 Ga0501080_0003858 3300049742 Bacteria 13249
223 Ga0501080_0688240 3300049742 Bacteria 903
224 Ga0501081_0233681 3300049743 Unclassified 1340
225 Ga0501083_0000507 3300049744 Bacteria 24796
226 Ga0501044_0380431 3300049823 Bacteria 1327
227 nmdc:mga05p37_10940_c1 3300050507 Bacteria 10774
228 nmdc:mga06r32_5856_c1 3300050510 Bacteria 11062
229 nmdc:mga08y16_309619_c1 3300050511 Bacteria 1627
230 nmdc:mga0n895_11704_c1 3300050512 Bacteria 7841
231 nmdc:mga0n895_63632_c1 3300050512 Bacteria 3647
232 nmdc:mga0rr50_139018_c1 3300050513 Bacteria 1952
233 nmdc:mga0rr50_178482_c1 3300050513 Bacteria 1735
234 nmdc:mga0rr50_22936_c1 3300050513 Bacteria 4294
235 nmdc:mga0rr50_320433_c1 3300050513 Bacteria 1299
236 nmdc:mga08x19_149344_c1 3300050514 Bacteria 1582
237 nmdc:mga0a205_1196_c1 3300050515 Bacteria 21690
238 nmdc:mga0a205_6926_c1 3300050515 Bacteria 10250
239 Ga0501084_0139662 3300054114 Bacteria 2040
240 Ga0501082_0104550 3300060353 Bacteria 2449
241 Ga0466962_0011232 3300061719 Bacteria 4312
242 Ga0466962_0034856 3300061719 Bacteria 2410
243 Ga0530510_0108947 3300061734 Unclassified 2028
244 Ga0466959_0032963
245 Ga0070658_10007721
246 Ga0070683_100345543
247 Ga0068868_100010668
248 Ga0070691_10046241
249 Ga0070709_10055251
250 Ga0070709_10207154
251 Ga0070714_100006571
252 Ga0070713_100632979
253 Ga0070710_10127502
254 Ga0070711_100323121
255 Ga0070705_100011382
256 Ga0070705_100040227
257 Ga0070694_100073518
258 Ga0070708_100057191
259 Ga0070678_100440102
260 Ga0070685_10398176
261 Ga0070706_100049551
262 Ga0070706_100363394
263 Ga0070707_100009422
264 Ga0070707_100055638
265 Ga0070698_100011372
266 Ga0070698_100677703
267 Ga0070699_100306125
268 Ga0070699_100406361
269 Ga0070679_100045881
270 Ga0070684_100144216
271 Ga0070684_100209465
272 Ga0070697_100067224
273 Ga0070695_100140701
274 Ga0070695_100187038
275 Ga0070696_100081441
276 Ga0070704_100038908
277 Ga0070704_100093880
278 Ga0068855_100078598
279 Ga0068855_100294456
280 Ga0070664_100194483
281 Ga0068856_100052582
282 Ga0068861_100073450
283 Ga0068863_100402917
284 Ga0070717_10007750
285 Ga0075432_10011519
286 Ga0075432_10081358
287 Ga0070716_100008797
288 Ga0070716_100259917
289 Ga0070712_100121951
290 Ga0070712_100131323
291 Ga0075428_100148351
292 Ga0075431_100003713
293 Ga0075433_10127246
294 Ga0075434_100069891
295 Ga0075434_100357815
296 Ga0075436_100123232
297 Ga0075436_100255214
298 Ga0075435_100008061
299 Ga0075435_100079725
300 Ga0111539_10014533
301 Ga0111539_10265793
302 Ga0105245_10007026
303 Ga0105245_10212531
304 Ga0114129_10029118
305 Ga0114129_10116038
306 Ga0105243_10263196
307 Ga0105243_10341080
308 Ga0105249_10438071
309 Ga0105239_10108040
310 Ga0105239_10290939
311 Ga0157369_10006270
312 Ga0157378_10208502
313 Ga0157372_10065590
314 Ga0157372_10436912
315 Ga0157380_10409530
316 Ga0157377_10113585
317 Ga0157377_10132525
318 Ga0163161_10514765
319 Ga0206353_12044435
320 Ga0213876_10071330
321 Ga0207692_10083817
322 Ga0207688_10021001
323 Ga0207684_10187857
324 Ga0207693_10001814
325 Ga0207693_10002699
326 Ga0207693_10013649
327 Ga0207646_10093582
328 Ga0207646_10345996
329 Ga0207646_10641750
330 Ga0207687_10252458
331 Ga0207664_10046653
332 Ga0207664_10561943
333 Ga0207706_10157212
334 Ga0207709_10172298
335 Ga0207665_10027074
336 Ga0207689_10251265
337 Ga0207679_10303799
338 Ga0207677_10606433
339 Ga0207702_10089441
340 Ga0207641_10257749
341 Ga0207675_100009908
342 Ga0207428_10010030
343 Ga0307408_100162119
344 Ga0307408_100342841
345 Ga0307409_100449208
346 Ga0307409_100938442
347 Ga0307416_100113712
348 Ga0307416_100344954
349 Ga0373940_0005405
350 Ga0373944_0073372
351 Ga0373946_0038716
352 Ga0373946_0094914
353 Ga0373962_0051636
354 Ga0373947_0019756
355 Ga0373925_0005063
356 Ga0373925_0017357
357 Ga0395899_0001963
358 Ga0395899_0006551
359 Ga0395899_0074205
360 Ga0395899_0336553
361 Ga0395900_0014144
362 Ga0395900_0019428
363 Ga0395900_0023013
364 Ga0395900_0042942
365 Ga0395900_0086734
366 Ga0395900_0242159
367 Ga0395898_0002345
368 Ga0395898_0008235
369 Ga0395898_0019085
370 Ga0395898_0064669
371 Ga0395898_0089782
372 Ga0395898_0139756
373 Ga0395905_0024654
374 Ga0395905_0290916
375 Ga0395905_0327620
376 Ga0395905_0399017
377 Ga0395901_0001749
378 Ga0395901_0002557
379 Ga0395901_0003365
380 Ga0395901_0012793
381 Ga0395901_0035441
382 Ga0395901_0041660
383 Ga0395901_0150796
384 Ga0395901_0285059
385 Ga0395901_0285113
386 Ga0436365_0476844
387 Ga0436365_1323523
388 Ga0436360_0321550
389 Ga0436363_0104295
390 Ga0439448_0012151
391 Ga0466969_0137391
392 Ga0466966_0019295
393 Ga0466961_0023921
394 Ga0466961_0184806
395 Ga0466963_0002755
396 Ga0466964_0018434
397 Ga0466964_0022804
398 Ga0466971_0000741
399 Ga0466971_0001008
400 Ga0466971_0044770
401 Ga0466968_0004113
402 Ga0466968_0028112
403 Ga0466957_0000806
404 Ga0466957_0050458
405 Ga0466957_0070029
406 Ga0466957_0085173
407 Ga0466959_0028355
408 Ga0466958_0026945
409 Ga0466958_0039422
410 Ga0466958_0288103
411 Ga0466967_0020214
412 Ga0466967_0020643
413 Ga0466967_0032784
414 Ga0466967_0039696
415 Ga0466967_0049682
416 Ga0466967_0152287
417 Ga0466967_0163106
418 Ga0466967_0213370
419 Ga0466967_0325853
420 Ga0495603_0246380
421 Ga0495582_0190550
422 Ga0495639_0160242
423 Ga0495664_0369546
424 Ga0495630_0030254
425 Ga0495609_0115457
426 Ga0495657_0346020
427 Ga0495658_0004856
428 Ga0495658_0142289
429 Ga0495624_0279222
430 Ga0495676_0020388
431 Ga0495676_0077822
432 Ga0496101_0125228
433 Ga0496102_0004852
434 Ga0496104_0007561
435 Ga0496105_0496480
436 Ga0496106_0105545
437 Ga0496108_0016787
438 Ga0496108_0498008
439 Ga0496108_0587656
440 Ga0496109_0005519
441 Ga0496109_0131104
442 Ga0496109_0179389
443 Ga0496109_0529512
444 Ga0496110_0001380
445 Ga0496110_0048461
446 Ga0496110_0155771
447 Ga0496110_0201103
448 Ga0496111_0071329
449 Ga0496111_0083095
450 Ga0496112_0051422
451 Ga0496112_0507707
452 Ga0496112_0732551
453 Ga0496113_0022463
454 Ga0496114_0386203
455 Ga0496115_0071584
456 Ga0501034_0096033
457 Ga0501067_0017753
458 Ga0501070_0035908
459 Ga0501070_0182504
460 Ga0501072_0006763
461 Ga0501073_0007899
462 Ga0501073_0116343
463 Ga0501074_0066172
464 Ga0501074_0201689
465 Ga0501080_0003858
466 Ga0501080_0688240
467 Ga0501081_0233681
468 Ga0501083_0000507
469 Ga0501044_0380431
470 nmdc:mga05p37_10940_c1
471 nmdc:mga06r32_5856_c1
472 nmdc:mga08y16_309619_c1
473 nmdc:mga0n895_11704_c1
474 nmdc:mga0n895_63632_c1
475 nmdc:mga0rr50_139018_c1
476 nmdc:mga0rr50_178482_c1
477 nmdc:mga0rr50_22936_c1
478 nmdc:mga0rr50_320433_c1
479 nmdc:mga08x19_149344_c1
480 nmdc:mga0a205_1196_c1
481 nmdc:mga0a205_6926_c1
482 Ga0501084_0139662
483 Ga0501082_0104550
484 Ga0466962_0011232
485 Ga0466962_0034856
486 Ga0530510_0108947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

55

275

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8867 7 248
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.8636 7 248
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8512 9 248
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.8219 9 248
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.8093 7 248
ID Description Score Start End Superfamily
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8867 7 248 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8636 7 248 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8523 72 247 3.20.20.410
1ztvA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8511 7 248 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8392 9 248 3.20.20.410
ID Description Score Start End GO Terms
AF-A0A538J716-F1-model_v4 DUF72 domain-containing protein 0.9905 1 247
AF-A0A538H8X6-F1-model_v4 DUF72 domain-containing protein 0.9841 76 248
AF-A0A538J716-F1-model_v4 DUF72 domain-containing protein 0.9826 1 247
AF-A0A660L9G2-F1-model_v4 Uncharacterized protein YecE (DUF72 family) 0.9809 7 246
AF-A0A7W1QDN9-F1-model_v4 DUF72 domain-containing protein 0.9779 9 247

Map