F355499

General Info

Members Datasets Scaffolds Average Seq Length
243 147 486 221

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10010436|Ga0075433_100104368
Length 226
Sequence MTRRIEVRRLGVVPYTDALALQRSLVEQRQADRIDDVLLLLEHPHVLTLGVRGDGGRSHVLAGPDVLAARGIEVVEAGRGGDITYHGPGQLVGYPIVNLKPDRCDVHRYVRDLEEMLIRTVGDYGIDAGRVDGLTGVWAGSDRSQKIAAIGVRIARWVTSHGFALNVSTNLDYFSLIVPCGIADRGVTSLEQLSGGAITRADVEQRVVEHFARVFDREPVLTAAGV

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
122 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.35
Rhizosphere 93.42
Stem 0
Stem Tuber 0
Unclassified 7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10010436 3300006852 Bacteria 7455
2 Ga0065712_10086503 3300005290 Bacteria 2632
3 Ga0065715_10397477 3300005293 Unclassified 886
4 Ga0070683_100029374 3300005329 Bacteria 4977
5 Ga0070683_100635142 3300005329 Bacteria 1022
6 Ga0070690_100242913 3300005330 Bacteria 1270
7 Ga0070670_100649069 3300005331 Bacteria 947
8 Ga0070670_100719388 3300005331 Bacteria 898
9 Ga0070677_10007157 3300005333 Bacteria 3720
10 Ga0070680_100400915 3300005336 Bacteria 1169
11 Ga0068868_100634195 3300005338 Bacteria 950
12 Ga0070660_100164187 3300005339 Bacteria 1791
13 Ga0070689_100660751 3300005340 Bacteria 910
14 Ga0070669_100020100 3300005353 Bacteria 4768
15 Ga0070669_100058114 3300005353 Bacteria 2838
16 Ga0070674_100030524 3300005356 Bacteria 3563
17 Ga0070674_100092724 3300005356 Bacteria 2184
18 Ga0070673_100032972 3300005364 Bacteria 3905
19 Ga0070688_100350114 3300005365 Unclassified 1081
20 Ga0070659_100054519 3300005366 Bacteria 3149
21 Ga0070709_10441414 3300005434 Bacteria 979
22 Ga0070701_10084686 3300005438 Bacteria 1724
23 Ga0070705_100056297 3300005440 Bacteria 2315
24 Ga0070705_100202273 3300005440 Bacteria 1363
25 Ga0070708_100072828 3300005445 Bacteria 3096
26 Ga0070678_100041191 3300005456 Bacteria 3272
27 Ga0070678_100088408 3300005456 Bacteria 2369
28 Ga0070681_10052641 3300005458 Bacteria 4061
29 Ga0070681_10238537 3300005458 Bacteria 1732
30 Ga0070706_100238208 3300005467 Bacteria 1699
31 Ga0070707_100113996 3300005468 Bacteria 2623
32 Ga0070707_100319474 3300005468 Bacteria 1509
33 Ga0070707_100368332 3300005468 Bacteria 1396
34 Ga0070698_100422828 3300005471 Bacteria 1267
35 Ga0070699_100009912 3300005518 Bacteria 8252
36 Ga0070699_100425901 3300005518 Bacteria 1202
37 Ga0070679_100330867 3300005530 Bacteria 1472
38 Ga0070684_100062978 3300005535 Bacteria 3250
39 Ga0070697_100131564 3300005536 Bacteria 2099
40 Ga0070672_100135874 3300005543 Bacteria 2025
41 Ga0070695_100000438 3300005545 Bacteria 21655
42 Ga0070696_100033683 3300005546 Bacteria 3521
43 Ga0070696_100239073 3300005546 Bacteria 1369
44 Ga0070696_100477335 3300005546 Bacteria 988
45 Ga0070665_100611393 3300005548 Bacteria 1103
46 Ga0070665_100854617 3300005548 Bacteria 923
47 Ga0070704_100017380 3300005549 Bacteria 4573
48 Ga0068855_100013520 3300005563 Bacteria 9842
49 Ga0068857_100487921 3300005577 Bacteria 1155
50 Ga0068854_100110117 3300005578 Bacteria 2076
51 Ga0068856_100014040 3300005614 Bacteria 7744
52 Ga0068856_100349228 3300005614 Bacteria 1498
53 Ga0068859_100018181 3300005617 Bacteria 7065
54 Ga0068859_100662180 3300005617 Bacteria 1136
55 Ga0068864_100004643 3300005618 Bacteria 11264
56 Ga0068864_100144286 3300005618 Bacteria 2150
57 Ga0068864_100677898 3300005618 Bacteria 1005
58 Ga0068866_10072840 3300005718 Bacteria 1821
59 Ga0068861_100088613 3300005719 Bacteria 2437
60 Ga0068861_100112695 3300005719 Bacteria 2181
61 Ga0068861_100353835 3300005719 Bacteria 1289
62 Ga0068861_100543989 3300005719 Bacteria 1057
63 Ga0068863_100181205 3300005841 Bacteria 2022
64 Ga0068858_100074799 3300005842 Bacteria 3146
65 Ga0068858_100342089 3300005842 Bacteria 1432
66 Ga0068858_100591217 3300005842 Bacteria 1076
67 Ga0068862_100338717 3300005844 Bacteria 1392
68 Ga0081539_10024405 3300005985 Bacteria 3923
69 Ga0070712_100294628 3300006175 Bacteria 1311
70 Ga0097621_100016102 3300006237 Bacteria 5645
71 Ga0097621_100392245 3300006237 Bacteria 1242
72 Ga0068871_100167015 3300006358 Bacteria 1884
73 Ga0068871_100334182 3300006358 Bacteria 1337
74 Ga0068871_100347025 3300006358 Bacteria 1312
75 Ga0075428_100209089 3300006844 Bacteria 2109
76 Ga0075430_100283864 3300006846 Bacteria 1370
77 Ga0075431_100412207 3300006847 Unclassified 1351
78 Ga0075433_10008066 3300006852 Bacteria 8384
79 Ga0075433_10080043 3300006852 Bacteria 2879
80 Ga0075433_10153096 3300006852 Bacteria 2051
81 Ga0075434_100008420 3300006871 Bacteria 9592
82 Ga0075434_100020245 3300006871 Bacteria 6449
83 Ga0075434_100203692 3300006871 Bacteria 1999
84 Ga0075434_100297765 3300006871 Bacteria 1633
85 Ga0075429_100513857 3300006880 Bacteria 1049
86 Ga0075436_100009724 3300006914 Bacteria 6579
87 Ga0075436_100010150 3300006914 Bacteria 6449
88 Ga0075436_100111311 3300006914 Bacteria 1911
89 Ga0075436_100117371 3300006914 Bacteria 1860
90 Ga0097620_100018184 3300006931 Bacteria 7065
91 Ga0097620_100662154 3300006931 Bacteria 1136
92 Ga0075435_100011797 3300007076 Bacteria 6449
93 Ga0099795_10114390 3300007788 Bacteria 1073
94 Ga0111539_10009286 3300009094 Bacteria 12419
95 Ga0111539_10467199 3300009094 Bacteria 1469
96 Ga0105245_10161026 3300009098 Bacteria 2130
97 Ga0105247_10011625 3300009101 Bacteria 5302
98 Ga0114129_10001304 3300009147 Bacteria 33279
99 Ga0114129_10001820 3300009147 Bacteria 29050
100 Ga0114129_10007330 3300009147 Bacteria 15702
101 Ga0114129_10181143 3300009147 Bacteria 2866
102 Ga0114129_10499397 3300009147 Bacteria 1589
103 Ga0114129_10909642 3300009147 Bacteria 1114
104 Ga0105243_10034527 3300009148 Bacteria 3916
105 Ga0105243_10520592 3300009148 Bacteria 1131
106 Ga0105242_11062177 3300009176 Bacteria 821
107 Ga0105248_10009873 3300009177 Bacteria 10511
108 Ga0105248_10279607 3300009177 Bacteria 1879
109 Ga0105248_10290694 3300009177 Bacteria 1840
110 Ga0105248_10722964 3300009177 Unclassified 1123
111 Ga0105238_10646042 3300009551 Bacteria 1068
112 Ga0105249_10304630 3300009553 Bacteria 1599
113 Ga0105246_10545343 3300011119 Unclassified 993
114 Ga0157372_10408944 3300013307 Bacteria 1581
115 Ga0157375_10558969 3300013308 Bacteria 1305
116 Ga0157375_11441035 3300013308 Bacteria 812
117 Ga0163163_10021725 3300014325 Bacteria 6061
118 Ga0163163_10032337 3300014325 Bacteria 5052
119 Ga0157376_10006560 3300014969 Bacteria 8235
120 Ga0157376_10037788 3300014969 Bacteria 3924
121 Ga0157376_10040925 3300014969 Bacteria 3791
122 Ga0157376_10986854 3300014969 Bacteria 864
123 Ga0207682_10009507 3300025893 Bacteria 3836
124 Ga0207642_10101522 3300025899 Unclassified 1445
125 Ga0207705_10122623 3300025909 Bacteria 1930
126 Ga0207707_10012114 3300025912 Bacteria 7495
127 Ga0207707_10039544 3300025912 Bacteria 4122
128 Ga0207707_10593702 3300025912 Bacteria 938
129 Ga0207695_10174020 3300025913 Bacteria 2076
130 Ga0207657_10004241 3300025919 Bacteria 15196
131 Ga0207657_10025095 3300025919 Bacteria 5504
132 Ga0207652_10020777 3300025921 Bacteria 5411
133 Ga0207652_10033266 3300025921 Bacteria 4340
134 Ga0207646_10266269 3300025922 Bacteria 1549
135 Ga0207646_10389048 3300025922 Unclassified 1260
136 Ga0207681_10016129 3300025923 Bacteria 4667
137 Ga0207681_10055162 3300025923 Bacteria 2705
138 Ga0207650_10299081 3300025925 Bacteria 1314
139 Ga0207690_10217338 3300025932 Bacteria 1461
140 Ga0207709_10239083 3300025935 Bacteria 1320
141 Ga0207670_10452214 3300025936 Bacteria 1036
142 Ga0207691_10166063 3300025940 Bacteria 1934
143 Ga0207691_10167703 3300025940 Bacteria 1924
144 Ga0207711_10004786 3300025941 Bacteria 11491
145 Ga0207711_10273362 3300025941 Bacteria 1555
146 Ga0207667_10046054 3300025949 Bacteria 4618
147 Ga0207667_10789802 3300025949 Bacteria 947
148 Ga0207651_10233598 3300025960 Bacteria 1494
149 Ga0207712_10068328 3300025961 Bacteria 2546
150 Ga0207712_10266222 3300025961 Bacteria 1392
151 Ga0207640_10428574 3300025981 Bacteria 1084
152 Ga0207703_10021948 3300026035 Bacteria 5000
153 Ga0207703_10228868 3300026035 Bacteria 1666
154 Ga0207641_10163554 3300026088 Bacteria 2025
155 Ga0207648_10007047 3300026089 Bacteria 11110
156 Ga0207648_10026798 3300026089 Bacteria 5119
157 Ga0207648_10792306 3300026089 Bacteria 882
158 Ga0207675_100007173 3300026118 Bacteria 10536
159 Ga0207675_100365995 3300026118 Bacteria 1415
160 Ga0207683_10282533 3300026121 Bacteria 1517
161 Ga0207428_10010365 3300027907 Bacteria 8332
162 Ga0207428_10060982 3300027907 Bacteria 2988
163 Ga0268266_10415183 3300028379 Bacteria 1275
164 Ga0268265_10099096 3300028380 Bacteria 2349
165 Ga0268265_10387024 3300028380 Bacteria 1288
166 Ga0268264_10396559 3300028381 Bacteria 1325
167 Ga0265332_10095944 3300031238 Bacteria 1252
168 Ga0265314_10102753 3300031711 Bacteria 1833
169 Ga0265314_10134937 3300031711 Bacteria 1534
170 Ga0307406_10359868 3300031901 Bacteria 1140
171 Ga0307414_10591679 3300032004 Bacteria 994
172 Ga0373939_0043820 3300035114 Bacteria 1359
173 Ga0373956_0123713 3300035119 Bacteria 1209
174 Ga0373957_0173474 3300035120 Unclassified 892
175 Ga0373943_0337466 3300035170 Bacteria 862
176 Ga0373933_0020575 3300035724 Bacteria 3742
177 Ga0373947_0008196 3300035725 Bacteria 6026
178 Ga0373937_0025812 3300036401 Bacteria 5306
179 Ga0373937_0217965 3300036401 Bacteria 1796
180 Ga0373937_0454939 3300036401 Unclassified 1216
181 Ga0373925_0202816 3300037068 Bacteria 1578
182 Ga0373925_0696861 3300037068 Bacteria 837
183 Ga0436365_1158477 3300039437 Bacteria 1514
184 Ga0436365_1221619 3300039437 Bacteria 1924
185 Ga0451853_1582468 3300041512 Bacteria 798
186 Ga0466963_0207321 3300044694 Bacteria 1371
187 Ga0495664_0052088 3300046477 Bacteria 2431
188 Ga0495628_0072753 3300046516 Bacteria 2679
189 Ga0495586_0043020 3300046535 Bacteria 2433
190 Ga0495645_0002679 3300046543 Bacteria 12094
191 Ga0495635_0127386 3300046663 Bacteria 1736
192 Ga0495599_0310090 3300046678 Bacteria 951
193 Ga0495623_0374049 3300046679 Bacteria 772
194 Ga0495658_0024501 3300046683 Bacteria 3215
195 Ga0495658_0057272 3300046683 Bacteria 2226
196 Ga0495600_0413968 3300046809 Bacteria 837
197 Ga0496104_0054038 3300048907 Bacteria 3796
198 Ga0496105_0217276 3300048908 Unclassified 1557
199 Ga0496108_0007098 3300048911 Bacteria 9072
200 Ga0496108_0446177 3300048911 Unclassified 1130
201 Ga0496109_0149995 3300048912 Unclassified 2183
202 Ga0496109_0250703 3300048912 Bacteria 1667
203 Ga0496110_0288396 3300048913 Bacteria 1495
204 Ga0496110_0378342 3300048913 Bacteria 1290
205 Ga0496111_0161276 3300048914 Bacteria 1665
206 Ga0496112_0023415 3300048915 Bacteria 5900
207 Ga0496112_0135699 3300048915 Unclassified 2431
208 Ga0496112_0155797 3300048915 Bacteria 2251
209 Ga0496113_0081444 3300048916 Bacteria 2481
210 Ga0501038_0338426 3300049574 Bacteria 1174
211 Ga0501047_0018175 3300049581 Bacteria 6737
212 Ga0501044_0004635 3300049823 Bacteria 15392
213 nmdc:mga05p37_155899_c1 3300050507 Unclassified 2791
214 nmdc:mga05p37_160061_c1 3300050507 Bacteria 2750
215 nmdc:mga05p37_2105_c1 3300050507 Bacteria 23247
216 nmdc:mga05p37_2382_c1 3300050507 Bacteria 21864
217 nmdc:mga05p37_306263_c1 3300050507 Bacteria 1885
218 nmdc:mga05p37_34361_c1 3300050507 Bacteria 2883
219 nmdc:mga05p37_62142_c1 3300050507 Bacteria 4596
220 nmdc:mga05p37_719717_c1 3300050507 Unclassified 1106
221 nmdc:mga06r32_538184_c1 3300050510 Bacteria 1143
222 nmdc:mga08y16_13408_c1 3300050511 Bacteria 8623
223 nmdc:mga08y16_395461_c1 3300050511 Bacteria 1415
224 nmdc:mga08y16_4349_c1 3300050511 Bacteria 14799
225 nmdc:mga0n895_260290_c1 3300050512 Bacteria 1760
226 nmdc:mga0n895_40662_c1 3300050512 Bacteria 4517
227 nmdc:mga0n895_85690_c1 3300050512 Bacteria 3146
228 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
229 nmdc:mga0rr50_151792_c1 3300050513 Bacteria 1873
230 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
231 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
232 nmdc:mga08x19_95318_c1 3300050514 Bacteria 1969
233 nmdc:mga08x19_98858_c1 3300050514 Bacteria 1934
234 nmdc:mga0a205_119706_c1 3300050515 Bacteria 2532
235 nmdc:mga0a205_4483_c1 3300050515 Bacteria 12536
236 nmdc:mga0a205_48073_c1 3300050515 Unclassified 1964
237 nmdc:mga0a205_59858_c1 3300050515 Bacteria 3679
238 nmdc:mga0a205_696074_c1 3300050515 Bacteria 866
239 Ga0495601_0194640 3300053077 Bacteria 1325
240 Ga0495595_0018980 3300053084 Bacteria 2978
241 Ga0495619_0029921 3300053085 Bacteria 3522
242 Ga0501084_0379212 3300054114 Bacteria 1195
243 Ga0501082_0457155 3300060353 Unclassified 1116
244 Ga0075433_10010436
245 Ga0065712_10086503
246 Ga0065715_10397477
247 Ga0070683_100029374
248 Ga0070683_100635142
249 Ga0070690_100242913
250 Ga0070670_100649069
251 Ga0070670_100719388
252 Ga0070677_10007157
253 Ga0070680_100400915
254 Ga0068868_100634195
255 Ga0070660_100164187
256 Ga0070689_100660751
257 Ga0070669_100020100
258 Ga0070669_100058114
259 Ga0070674_100030524
260 Ga0070674_100092724
261 Ga0070673_100032972
262 Ga0070688_100350114
263 Ga0070659_100054519
264 Ga0070709_10441414
265 Ga0070701_10084686
266 Ga0070705_100056297
267 Ga0070705_100202273
268 Ga0070708_100072828
269 Ga0070678_100041191
270 Ga0070678_100088408
271 Ga0070681_10052641
272 Ga0070681_10238537
273 Ga0070706_100238208
274 Ga0070707_100113996
275 Ga0070707_100319474
276 Ga0070707_100368332
277 Ga0070698_100422828
278 Ga0070699_100009912
279 Ga0070699_100425901
280 Ga0070679_100330867
281 Ga0070684_100062978
282 Ga0070697_100131564
283 Ga0070672_100135874
284 Ga0070695_100000438
285 Ga0070696_100033683
286 Ga0070696_100239073
287 Ga0070696_100477335
288 Ga0070665_100611393
289 Ga0070665_100854617
290 Ga0070704_100017380
291 Ga0068855_100013520
292 Ga0068857_100487921
293 Ga0068854_100110117
294 Ga0068856_100014040
295 Ga0068856_100349228
296 Ga0068859_100018181
297 Ga0068859_100662180
298 Ga0068864_100004643
299 Ga0068864_100144286
300 Ga0068864_100677898
301 Ga0068866_10072840
302 Ga0068861_100088613
303 Ga0068861_100112695
304 Ga0068861_100353835
305 Ga0068861_100543989
306 Ga0068863_100181205
307 Ga0068858_100074799
308 Ga0068858_100342089
309 Ga0068858_100591217
310 Ga0068862_100338717
311 Ga0081539_10024405
312 Ga0070712_100294628
313 Ga0097621_100016102
314 Ga0097621_100392245
315 Ga0068871_100167015
316 Ga0068871_100334182
317 Ga0068871_100347025
318 Ga0075428_100209089
319 Ga0075430_100283864
320 Ga0075431_100412207
321 Ga0075433_10008066
322 Ga0075433_10080043
323 Ga0075433_10153096
324 Ga0075434_100008420
325 Ga0075434_100020245
326 Ga0075434_100203692
327 Ga0075434_100297765
328 Ga0075429_100513857
329 Ga0075436_100009724
330 Ga0075436_100010150
331 Ga0075436_100111311
332 Ga0075436_100117371
333 Ga0097620_100018184
334 Ga0097620_100662154
335 Ga0075435_100011797
336 Ga0099795_10114390
337 Ga0111539_10009286
338 Ga0111539_10467199
339 Ga0105245_10161026
340 Ga0105247_10011625
341 Ga0114129_10001304
342 Ga0114129_10001820
343 Ga0114129_10007330
344 Ga0114129_10181143
345 Ga0114129_10499397
346 Ga0114129_10909642
347 Ga0105243_10034527
348 Ga0105243_10520592
349 Ga0105242_11062177
350 Ga0105248_10009873
351 Ga0105248_10279607
352 Ga0105248_10290694
353 Ga0105248_10722964
354 Ga0105238_10646042
355 Ga0105249_10304630
356 Ga0105246_10545343
357 Ga0157372_10408944
358 Ga0157375_10558969
359 Ga0157375_11441035
360 Ga0163163_10021725
361 Ga0163163_10032337
362 Ga0157376_10006560
363 Ga0157376_10037788
364 Ga0157376_10040925
365 Ga0157376_10986854
366 Ga0207682_10009507
367 Ga0207642_10101522
368 Ga0207705_10122623
369 Ga0207707_10012114
370 Ga0207707_10039544
371 Ga0207707_10593702
372 Ga0207695_10174020
373 Ga0207657_10004241
374 Ga0207657_10025095
375 Ga0207652_10020777
376 Ga0207652_10033266
377 Ga0207646_10266269
378 Ga0207646_10389048
379 Ga0207681_10016129
380 Ga0207681_10055162
381 Ga0207650_10299081
382 Ga0207690_10217338
383 Ga0207709_10239083
384 Ga0207670_10452214
385 Ga0207691_10166063
386 Ga0207691_10167703
387 Ga0207711_10004786
388 Ga0207711_10273362
389 Ga0207667_10046054
390 Ga0207667_10789802
391 Ga0207651_10233598
392 Ga0207712_10068328
393 Ga0207712_10266222
394 Ga0207640_10428574
395 Ga0207703_10021948
396 Ga0207703_10228868
397 Ga0207641_10163554
398 Ga0207648_10007047
399 Ga0207648_10026798
400 Ga0207648_10792306
401 Ga0207675_100007173
402 Ga0207675_100365995
403 Ga0207683_10282533
404 Ga0207428_10010365
405 Ga0207428_10060982
406 Ga0268266_10415183
407 Ga0268265_10099096
408 Ga0268265_10387024
409 Ga0268264_10396559
410 Ga0265332_10095944
411 Ga0265314_10102753
412 Ga0265314_10134937
413 Ga0307406_10359868
414 Ga0307414_10591679
415 Ga0373939_0043820
416 Ga0373956_0123713
417 Ga0373957_0173474
418 Ga0373943_0337466
419 Ga0373933_0020575
420 Ga0373947_0008196
421 Ga0373937_0025812
422 Ga0373937_0217965
423 Ga0373937_0454939
424 Ga0373925_0202816
425 Ga0373925_0696861
426 Ga0436365_1158477
427 Ga0436365_1221619
428 Ga0451853_1582468
429 Ga0466963_0207321
430 Ga0495664_0052088
431 Ga0495628_0072753
432 Ga0495586_0043020
433 Ga0495645_0002679
434 Ga0495635_0127386
435 Ga0495599_0310090
436 Ga0495623_0374049
437 Ga0495658_0024501
438 Ga0495658_0057272
439 Ga0495600_0413968
440 Ga0496104_0054038
441 Ga0496105_0217276
442 Ga0496108_0007098
443 Ga0496108_0446177
444 Ga0496109_0149995
445 Ga0496109_0250703
446 Ga0496110_0288396
447 Ga0496110_0378342
448 Ga0496111_0161276
449 Ga0496112_0023415
450 Ga0496112_0135699
451 Ga0496112_0155797
452 Ga0496113_0081444
453 Ga0501038_0338426
454 Ga0501047_0018175
455 Ga0501044_0004635
456 nmdc:mga05p37_155899_c1
457 nmdc:mga05p37_160061_c1
458 nmdc:mga05p37_2105_c1
459 nmdc:mga05p37_2382_c1
460 nmdc:mga05p37_306263_c1
461 nmdc:mga05p37_34361_c1
462 nmdc:mga05p37_62142_c1
463 nmdc:mga05p37_719717_c1
464 nmdc:mga06r32_538184_c1
465 nmdc:mga08y16_13408_c1
466 nmdc:mga08y16_395461_c1
467 nmdc:mga08y16_4349_c1
468 nmdc:mga0n895_260290_c1
469 nmdc:mga0n895_40662_c1
470 nmdc:mga0n895_85690_c1
471 nmdc:mga0n895_97_c2
472 nmdc:mga0rr50_151792_c1
473 nmdc:mga0rr50_20_c1
474 nmdc:mga08x19_178_c1
475 nmdc:mga08x19_95318_c1
476 nmdc:mga08x19_98858_c1
477 nmdc:mga0a205_119706_c1
478 nmdc:mga0a205_4483_c1
479 nmdc:mga0a205_48073_c1
480 nmdc:mga0a205_59858_c1
481 nmdc:mga0a205_696074_c1
482 Ga0495601_0194640
483 Ga0495595_0018980
484 Ga0495619_0029921
485 Ga0501084_0379212
486 Ga0501082_0457155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

14

212

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9473 13 226
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9386 13 226
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9263 14 220
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8444 14 220
2dve-assembly1.cif.gz_B crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, mutation arg51ala 0.7964 10 222
ID Description Score Start End Superfamily
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9486 14 221 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9457 14 221 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.935 11 220 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9326 14 221 3.30.930.10
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9308 14 221 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A349UIK5-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9796 97 217 GO:0033819
AF-A0A3N5Q8C4-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9794 123 228 GO:0033819
AF-A0A2V7YPL2-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9781 12 226 GO:0005737
GO:0016787
GO:0033819
AF-A0A843SLD3-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9765 12 223 GO:0005737
GO:0033819
AF-A0A2L2X8I3-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9745 11 226 GO:0005737
GO:0033819

Map