F355356

General Info

Members Datasets Scaffolds Average Seq Length
243 162 486 125

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100622674|Ga0070667_1006226742
Length 144
Sequence LQEFAVTYTSNFSSHKNFIMATIEAVMTTQEVANRMNELFKENKWNEVQEELFSEDCESIEPANSPGLKTVKGKAAIKKKGEEFNERMEEMHGGWCSEPIVGGNYISFAMGLDATMKGMGRVKMEEICVYEVKDGKIVKEQFFF

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
114 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
125 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
126 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
127 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
128 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
129 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
130 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
131 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
132 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
133 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
134 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
135 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
136 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
137 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
138 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
139 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
151 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
152 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
156 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
157 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
158 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
159 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
160 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
161 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
162 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.82
Nodule 0
Rhizoplane 0.41
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 18.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100622674 3300005367 Bacteria 995
2 rootL2_10137732 3300003322 Bacteria 3814
3 Ga0065704_10084199 3300005289 Unclassified 3362
4 Ga0065712_10077062 3300005290 Unclassified 3555
5 Ga0065715_10098716 3300005293 Bacteria 3453
6 Ga0065707_10151562 3300005295 Bacteria 1643
7 Ga0070676_10094948 3300005328 Bacteria 1833
8 Ga0070683_100715706 3300005329 Bacteria 959
9 Ga0070690_100331784 3300005330 Unclassified 1099
10 Ga0070670_100132841 3300005331 Unclassified 2150
11 Ga0070670_100199496 3300005331 Bacteria 1738
12 Ga0068869_100206322 3300005334 Bacteria 1552
13 Ga0068869_100233244 3300005334 Bacteria 1463
14 Ga0070666_10368762 3300005335 Unclassified 1029
15 Ga0068868_100355307 3300005338 Unclassified 1256
16 Ga0068868_100604287 3300005338 Bacteria 972
17 Ga0070661_100109025 3300005344 Bacteria 2066
18 Ga0070668_100282267 3300005347 Bacteria 1387
19 Ga0070668_101993450 3300005347 Bacteria 535
20 Ga0070674_100008332 3300005356 Bacteria 6169
21 Ga0070674_100087712 3300005356 Unclassified 2238
22 Ga0070688_100080121 3300005365 Unclassified 2111
23 Ga0070688_100286135 3300005365 Unclassified 1186
24 Ga0070688_100360981 3300005365 Bacteria 1066
25 Ga0070667_100117662 3300005367 Bacteria 2309
26 Ga0070667_100136971 3300005367 Bacteria 2141
27 Ga0070667_100162718 3300005367 Bacteria 1966
28 Ga0070714_101157493 3300005435 Bacteria 754
29 Ga0070700_100608441 3300005441 Bacteria 857
30 Ga0070663_101043429 3300005455 Bacteria 712
31 Ga0070678_100536936 3300005456 Bacteria 1037
32 Ga0070681_10105139 3300005458 Bacteria 2765
33 Ga0068867_100005380 3300005459 Bacteria 9054
34 Ga0068867_100065672 3300005459 Unclassified 2701
35 Ga0068867_100619436 3300005459 Bacteria 946
36 Ga0068867_100714747 3300005459 Bacteria 885
37 Ga0068867_101339535 3300005459 Bacteria 662
38 Ga0070685_10656535 3300005466 Bacteria 760
39 Ga0070706_100889164 3300005467 Bacteria 823
40 Ga0070707_100404515 3300005468 Bacteria 1325
41 Ga0070698_100389498 3300005471 Bacteria 1326
42 Ga0070698_100405441 3300005471 Bacteria 1297
43 Ga0070699_100042662 3300005518 Bacteria 3926
44 Ga0070684_100154227 3300005535 Bacteria 2082
45 Ga0070684_100296590 3300005535 Bacteria 1483
46 Ga0068853_100013223 3300005539 Bacteria 6735
47 Ga0068853_101001772 3300005539 Bacteria 804
48 Ga0070672_100368881 3300005543 Bacteria 1226
49 Ga0070672_100487544 3300005543 Bacteria 1065
50 Ga0070672_100687060 3300005543 Bacteria 896
51 Ga0070695_101542541 3300005545 Bacteria 553
52 Ga0070696_100275340 3300005546 Unclassified 1281
53 Ga0070693_100313075 3300005547 Bacteria 1062
54 Ga0070665_100224654 3300005548 Unclassified 1878
55 Ga0070704_100672372 3300005549 Bacteria 916
56 Ga0070664_101291361 3300005564 Unclassified 689
57 Ga0068857_100457454 3300005577 Bacteria 1194
58 Ga0068852_101179911 3300005616 Unclassified 786
59 Ga0068852_101618381 3300005616 Unclassified 670
60 Ga0068859_100051629 3300005617 Bacteria 4133
61 Ga0068859_100058501 3300005617 Bacteria 3883
62 Ga0068859_100190670 3300005617 Bacteria 2134
63 Ga0068859_101378414 3300005617 Bacteria 777
64 Ga0068864_100042861 3300005618 Bacteria 3873
65 Ga0068864_100296113 3300005618 Bacteria 1514
66 Ga0068864_100989702 3300005618 Bacteria 834
67 Ga0068866_10074648 3300005718 Bacteria 1803
68 Ga0068861_100134861 3300005719 Bacteria 2008
69 Ga0068861_100256034 3300005719 Bacteria 1496
70 Ga0068851_10067866 3300005834 Bacteria 1840
71 Ga0068863_100414955 3300005841 Bacteria 1318
72 Ga0068863_100941425 3300005841 Bacteria 865
73 Ga0068863_100989105 3300005841 Unclassified 844
74 Ga0068860_100001707 3300005843 Bacteria 23468
75 Ga0068860_100276946 3300005843 Unclassified 1639
76 Ga0068860_100535094 3300005843 Bacteria 1172
77 Ga0068860_101222726 3300005843 Bacteria 772
78 Ga0068862_101636628 3300005844 Bacteria 651
79 Ga0081455_10734319 3300005937 Bacteria 626
80 Ga0075366_10025991 3300006195 Bacteria 3425
81 Ga0075366_10382918 3300006195 Bacteria 865
82 Ga0097621_100108464 3300006237 Bacteria 2344
83 Ga0068871_100275730 3300006358 Bacteria 1470
84 Ga0068871_101143602 3300006358 Bacteria 729
85 Ga0068865_100709980 3300006881 Bacteria 860
86 Ga0097620_100051629 3300006931 Bacteria 4133
87 Ga0097620_100058501 3300006931 Bacteria 3883
88 Ga0097620_100190676 3300006931 Bacteria 2134
89 Ga0097620_101378397 3300006931 Bacteria 777
90 Ga0105251_10263476 3300009011 Bacteria 778
91 Ga0111539_10003729 3300009094 Bacteria 20051
92 Ga0105247_10786008 3300009101 Bacteria 725
93 Ga0114129_10062285 3300009147 Bacteria 5212
94 Ga0105241_10147229 3300009174 Unclassified 1923
95 Ga0105242_10019543 3300009176 Bacteria 5310
96 Ga0105237_11161389 3300009545 Bacteria 779
97 Ga0105238_10123272 3300009551 Unclassified 2571
98 Ga0105249_10003003 3300009553 Bacteria 14553
99 Ga0105249_10015629 3300009553 Bacteria 6720
100 Ga0105249_10023569 3300009553 Bacteria 5524
101 Ga0105249_10100374 3300009553 Unclassified 2721
102 Ga0105249_10867056 3300009553 Bacteria 969
103 Ga0105249_10872162 3300009553 Bacteria 966
104 Ga0105249_11175200 3300009553 Unclassified 838
105 Ga0105249_13512715 3300009553 Bacteria 505
106 Ga0105239_10007505 3300010375 Bacteria 12508
107 Ga0157371_11609604 3300013102 Bacteria 508
108 Ga0157369_10364036 3300013105 Bacteria 1501
109 Ga0157374_10138146 3300013296 Unclassified 2364
110 Ga0157374_10240891 3300013296 Bacteria 1779
111 Ga0157378_10010437 3300013297 Bacteria 8112
112 Ga0157378_10885317 3300013297 Bacteria 923
113 Ga0157378_10893213 3300013297 Unclassified 919
114 Ga0163162_10337362 3300013306 Unclassified 1640
115 Ga0157375_10492638 3300013308 Bacteria 1390
116 Ga0157375_11478362 3300013308 Bacteria 801
117 Ga0163163_10299904 3300014325 Bacteria 1659
118 Ga0163163_10635237 3300014325 Unclassified 1131
119 Ga0157380_10004281 3300014326 Bacteria 9883
120 Ga0157380_10705836 3300014326 Bacteria 1014
121 Ga0157376_10194376 3300014969 Unclassified 1862
122 Ga0157376_12604139 3300014969 Bacteria 546
123 Ga0207656_10050021 3300025321 Bacteria 1804
124 Ga0207656_10215418 3300025321 Bacteria 932
125 Ga0207713_1265742 3300025735 Bacteria 501
126 Ga0207642_10054527 3300025899 Bacteria 1824
127 Ga0207680_10058848 3300025903 Bacteria 2331
128 Ga0207645_10072612 3300025907 Bacteria 2203
129 Ga0207645_10726121 3300025907 Bacteria 675
130 Ga0207695_11415610 3300025913 Unclassified 576
131 Ga0207646_10716896 3300025922 Bacteria 894
132 Ga0207694_11620171 3300025924 Unclassified 545
133 Ga0207650_10006283 3300025925 Bacteria 8095
134 Ga0207650_10057973 3300025925 Bacteria 2882
135 Ga0207650_10337175 3300025925 Bacteria 1238
136 Ga0207650_11401781 3300025925 Unclassified 594
137 Ga0207659_11633513 3300025926 Bacteria 550
138 Ga0207644_10245206 3300025931 Unclassified 1428
139 Ga0207686_10014814 3300025934 Bacteria 4351
140 Ga0207669_10185422 3300025937 Bacteria 1496
141 Ga0207691_10337651 3300025940 Bacteria 1290
142 Ga0207689_10221919 3300025942 Bacteria 1562
143 Ga0207689_10357736 3300025942 Unclassified 1214
144 Ga0207651_11487599 3300025960 Unclassified 610
145 Ga0207712_10006020 3300025961 Bacteria 7653
146 Ga0207712_10015521 3300025961 Bacteria 4916
147 Ga0207712_10132493 3300025961 Bacteria 1901
148 Ga0207668_10255619 3300025972 Bacteria 1425
149 Ga0207668_11109320 3300025972 Bacteria 709
150 Ga0207658_10061227 3300025986 Bacteria 2812
151 Ga0207658_10108378 3300025986 Bacteria 2191
152 Ga0207658_10113692 3300025986 Bacteria 2145
153 Ga0207658_10207106 3300025986 Bacteria 1641
154 Ga0207658_10437512 3300025986 Bacteria 1156
155 Ga0207658_12184686 3300025986 Bacteria 502
156 Ga0207703_11192203 3300026035 Unclassified 732
157 Ga0207639_10364862 3300026041 Bacteria 1293
158 Ga0207639_10826578 3300026041 Bacteria 864
159 Ga0207708_10675447 3300026075 Bacteria 881
160 Ga0207641_10247227 3300026088 Unclassified 1664
161 Ga0207641_10803790 3300026088 Bacteria 930
162 Ga0207648_10002678 3300026089 Bacteria 18951
163 Ga0207648_10241751 3300026089 Bacteria 1607
164 Ga0207648_10702239 3300026089 Bacteria 937
165 Ga0207648_12145341 3300026089 Bacteria 519
166 Ga0207676_10034992 3300026095 Bacteria 3807
167 Ga0207676_10078855 3300026095 Bacteria 2669
168 Ga0207676_10091677 3300026095 Bacteria 2497
169 Ga0207676_10625793 3300026095 Bacteria 1036
170 Ga0207674_10518251 3300026116 Bacteria 1152
171 Ga0207675_100104231 3300026118 Bacteria 2673
172 Ga0207675_100225744 3300026118 Bacteria 1805
173 Ga0207675_102113758 3300026118 Bacteria 579
174 Ga0207683_10472302 3300026121 Bacteria 1157
175 Ga0207698_10453373 3300026142 Bacteria 1239
176 Ga0207428_10149099 3300027907 Bacteria 1781
177 Ga0268266_10707160 3300028379 Unclassified 971
178 Ga0268265_10044622 3300028380 Bacteria 3302
179 Ga0268265_10872452 3300028380 Bacteria 882
180 Ga0268264_10002457 3300028381 Bacteria 16284
181 Ga0268264_10039259 3300028381 Bacteria 3911
182 Ga0268264_10357334 3300028381 Bacteria 1392
183 Ga0268264_10871696 3300028381 Unclassified 902
184 Ga0307517_10622965 3300028786 Bacteria 528
185 Ga0307509_10650233 3300031507 Unclassified 723
186 Ga0307516_10822758 3300031730 Bacteria 591
187 Ga0316574_0972581 3300035398 Unclassified 512
188 Ga0395900_0090731 3300037418 Unclassified 3141
189 Ga0395905_1642368 3300037471 Bacteria 548
190 Ga0439436_0006506 3300041404 Bacteria 3586
191 Ga0439439_0053290 3300041406 Bacteria 1064
192 Ga0439457_002001 3300042014 Bacteria 5988
193 Ga0439462_0095314 3300042015 Bacteria 818
194 Ga0439446_0110115 3300042156 Bacteria 878
195 Ga0495638_0067898 3300046460 Bacteria 2188
196 Ga0495638_0203533 3300046460 Bacteria 1116
197 Ga0495650_0025568 3300046471 Bacteria 2764
198 Ga0495648_0014167 3300046524 Bacteria 5850
199 Ga0495672_0027205 3300047320 Bacteria 3637
200 Ga0495686_0005507 3300047472 Bacteria 9966
201 Ga0496115_1227580 3300048918 Unclassified 562
202 Ga0501034_1565446 3300049571 Unclassified 532
203 Ga0501202_000240 3300049652 Bacteria 7271
204 Ga0501206_000629 3300049653 Bacteria 4240
205 Ga0501208_162985 3300049655 Bacteria 508
206 Ga0501217_015274 3300049661 Bacteria 1746
207 Ga0501222_002957 3300049662 Bacteria 2343
208 Ga0501223_022383 3300049663 Bacteria 1234
209 Ga0501235_077295 3300049669 Bacteria 792
210 Ga0501238_002744 3300049671 Bacteria 2128
211 Ga0501240_005579 3300049673 Bacteria 1512
212 Ga0501243_000627 3300049675 Bacteria 4791
213 Ga0501252_006448 3300049682 Bacteria 1305
214 Ga0501257_004898 3300049686 Bacteria 2931
215 Ga0501259_009555 3300049688 Bacteria 1576
216 Ga0501260_006236 3300049689 Bacteria 1142
217 Ga0501261_000789 3300049690 Bacteria 3959
218 Ga0501221_008371 3300049704 Bacteria 1796
219 Ga0501225_0052412 3300049705 Bacteria 1138
220 Ga0501232_008506 3300049757 Bacteria 1111
221 Ga0501044_0430463 3300049823 Bacteria 1229
222 nmdc:mga0k408_370064_c1 3300050493 Bacteria 854
223 nmdc:mga0k408_573654_c1 3300050493 Unclassified 666
224 nmdc:mga08y16_22657_c1 3300050511 Bacteria 6631
225 Ga0500644_0139612 3300053088 Bacteria 962
226 Ga0500646_0046766 3300053090 Unclassified 1236
227 Ga0500646_0060305 3300053090 Bacteria 1115
228 Ga0500583_0089053 3300053092 Bacteria 1500
229 Ga0500651_0784069 3300053093 Bacteria 504
230 Ga0500658_0426004 3300053134 Bacteria 606
231 Ga0500568_0000699 3300053139 Bacteria 24055
232 Ga0500573_0128408 3300053140 Bacteria 1406
233 Ga0500589_096991 3300053147 Bacteria 1287
234 Ga0500616_0172202 3300053153 Bacteria 982
235 Ga0500622_0001237 3300053156 Bacteria 20921
236 Ga0500627_0146944 3300053158 Bacteria 1065
237 Ga0500630_281226 3300053159 Unclassified 557
238 Ga0500639_264820 3300053163 Unclassified 676
239 Ga0500636_0236997 3300053177 Bacteria 940
240 2896115272 2896109856 Bacteria 7140722
241 2929180402 2929177148 Bacteria 7883697
242 2945982795 2945977869 Bacteria 7777518
243 2946017812 2946013367 Bacteria 7766675
244 Ga0070667_100622674
245 rootL2_10137732
246 Ga0065704_10084199
247 Ga0065712_10077062
248 Ga0065715_10098716
249 Ga0065707_10151562
250 Ga0070676_10094948
251 Ga0070683_100715706
252 Ga0070690_100331784
253 Ga0070670_100132841
254 Ga0070670_100199496
255 Ga0068869_100206322
256 Ga0068869_100233244
257 Ga0070666_10368762
258 Ga0068868_100355307
259 Ga0068868_100604287
260 Ga0070661_100109025
261 Ga0070668_100282267
262 Ga0070668_101993450
263 Ga0070674_100008332
264 Ga0070674_100087712
265 Ga0070688_100080121
266 Ga0070688_100286135
267 Ga0070688_100360981
268 Ga0070667_100117662
269 Ga0070667_100136971
270 Ga0070667_100162718
271 Ga0070714_101157493
272 Ga0070700_100608441
273 Ga0070663_101043429
274 Ga0070678_100536936
275 Ga0070681_10105139
276 Ga0068867_100005380
277 Ga0068867_100065672
278 Ga0068867_100619436
279 Ga0068867_100714747
280 Ga0068867_101339535
281 Ga0070685_10656535
282 Ga0070706_100889164
283 Ga0070707_100404515
284 Ga0070698_100389498
285 Ga0070698_100405441
286 Ga0070699_100042662
287 Ga0070684_100154227
288 Ga0070684_100296590
289 Ga0068853_100013223
290 Ga0068853_101001772
291 Ga0070672_100368881
292 Ga0070672_100487544
293 Ga0070672_100687060
294 Ga0070695_101542541
295 Ga0070696_100275340
296 Ga0070693_100313075
297 Ga0070665_100224654
298 Ga0070704_100672372
299 Ga0070664_101291361
300 Ga0068857_100457454
301 Ga0068852_101179911
302 Ga0068852_101618381
303 Ga0068859_100051629
304 Ga0068859_100058501
305 Ga0068859_100190670
306 Ga0068859_101378414
307 Ga0068864_100042861
308 Ga0068864_100296113
309 Ga0068864_100989702
310 Ga0068866_10074648
311 Ga0068861_100134861
312 Ga0068861_100256034
313 Ga0068851_10067866
314 Ga0068863_100414955
315 Ga0068863_100941425
316 Ga0068863_100989105
317 Ga0068860_100001707
318 Ga0068860_100276946
319 Ga0068860_100535094
320 Ga0068860_101222726
321 Ga0068862_101636628
322 Ga0081455_10734319
323 Ga0075366_10025991
324 Ga0075366_10382918
325 Ga0097621_100108464
326 Ga0068871_100275730
327 Ga0068871_101143602
328 Ga0068865_100709980
329 Ga0097620_100051629
330 Ga0097620_100058501
331 Ga0097620_100190676
332 Ga0097620_101378397
333 Ga0105251_10263476
334 Ga0111539_10003729
335 Ga0105247_10786008
336 Ga0114129_10062285
337 Ga0105241_10147229
338 Ga0105242_10019543
339 Ga0105237_11161389
340 Ga0105238_10123272
341 Ga0105249_10003003
342 Ga0105249_10015629
343 Ga0105249_10023569
344 Ga0105249_10100374
345 Ga0105249_10867056
346 Ga0105249_10872162
347 Ga0105249_11175200
348 Ga0105249_13512715
349 Ga0105239_10007505
350 Ga0157371_11609604
351 Ga0157369_10364036
352 Ga0157374_10138146
353 Ga0157374_10240891
354 Ga0157378_10010437
355 Ga0157378_10885317
356 Ga0157378_10893213
357 Ga0163162_10337362
358 Ga0157375_10492638
359 Ga0157375_11478362
360 Ga0163163_10299904
361 Ga0163163_10635237
362 Ga0157380_10004281
363 Ga0157380_10705836
364 Ga0157376_10194376
365 Ga0157376_12604139
366 Ga0207656_10050021
367 Ga0207656_10215418
368 Ga0207713_1265742
369 Ga0207642_10054527
370 Ga0207680_10058848
371 Ga0207645_10072612
372 Ga0207645_10726121
373 Ga0207695_11415610
374 Ga0207646_10716896
375 Ga0207694_11620171
376 Ga0207650_10006283
377 Ga0207650_10057973
378 Ga0207650_10337175
379 Ga0207650_11401781
380 Ga0207659_11633513
381 Ga0207644_10245206
382 Ga0207686_10014814
383 Ga0207669_10185422
384 Ga0207691_10337651
385 Ga0207689_10221919
386 Ga0207689_10357736
387 Ga0207651_11487599
388 Ga0207712_10006020
389 Ga0207712_10015521
390 Ga0207712_10132493
391 Ga0207668_10255619
392 Ga0207668_11109320
393 Ga0207658_10061227
394 Ga0207658_10108378
395 Ga0207658_10113692
396 Ga0207658_10207106
397 Ga0207658_10437512
398 Ga0207658_12184686
399 Ga0207703_11192203
400 Ga0207639_10364862
401 Ga0207639_10826578
402 Ga0207708_10675447
403 Ga0207641_10247227
404 Ga0207641_10803790
405 Ga0207648_10002678
406 Ga0207648_10241751
407 Ga0207648_10702239
408 Ga0207648_12145341
409 Ga0207676_10034992
410 Ga0207676_10078855
411 Ga0207676_10091677
412 Ga0207676_10625793
413 Ga0207674_10518251
414 Ga0207675_100104231
415 Ga0207675_100225744
416 Ga0207675_102113758
417 Ga0207683_10472302
418 Ga0207698_10453373
419 Ga0207428_10149099
420 Ga0268266_10707160
421 Ga0268265_10044622
422 Ga0268265_10872452
423 Ga0268264_10002457
424 Ga0268264_10039259
425 Ga0268264_10357334
426 Ga0268264_10871696
427 Ga0307517_10622965
428 Ga0307509_10650233
429 Ga0307516_10822758
430 Ga0316574_0972581
431 Ga0395900_0090731
432 Ga0395905_1642368
433 Ga0439436_0006506
434 Ga0439439_0053290
435 Ga0439457_002001
436 Ga0439462_0095314
437 Ga0439446_0110115
438 Ga0495638_0067898
439 Ga0495638_0203533
440 Ga0495650_0025568
441 Ga0495648_0014167
442 Ga0495672_0027205
443 Ga0495686_0005507
444 Ga0496115_1227580
445 Ga0501034_1565446
446 Ga0501202_000240
447 Ga0501206_000629
448 Ga0501208_162985
449 Ga0501217_015274
450 Ga0501222_002957
451 Ga0501223_022383
452 Ga0501235_077295
453 Ga0501238_002744
454 Ga0501240_005579
455 Ga0501243_000627
456 Ga0501252_006448
457 Ga0501257_004898
458 Ga0501259_009555
459 Ga0501260_006236
460 Ga0501261_000789
461 Ga0501221_008371
462 Ga0501225_0052412
463 Ga0501232_008506
464 Ga0501044_0430463
465 nmdc:mga0k408_370064_c1
466 nmdc:mga0k408_573654_c1
467 nmdc:mga08y16_22657_c1
468 Ga0500644_0139612
469 Ga0500646_0046766
470 Ga0500646_0060305
471 Ga0500583_0089053
472 Ga0500651_0784069
473 Ga0500658_0426004
474 Ga0500568_0000699
475 Ga0500573_0128408
476 Ga0500589_096991
477 Ga0500616_0172202
478 Ga0500622_0001237
479 Ga0500627_0146944
480 Ga0500630_281226
481 Ga0500639_264820
482 Ga0500636_0236997
483 2896115272
484 2929180402
485 2945982795
486 2946017812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20409

SnoaL_5

SnoaL-like domain

27

144

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hk4-assembly2.cif.gz_D crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution 0.9353 8 125
3hk4-assembly2.cif.gz_D crystal structure of a putative snoal-like polyketide cyclase [carbohydrate phosphatase] (mlr7391) from mesorhizobium loti at 1.96 a resolution 0.9276 8 125
5u35-assembly1.cif.gz_B crystal structure of a de novo designed protein with curved beta-sheet 0.8437 1 124
3ec9-assembly1.cif.gz_A crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution 0.8375 8 124
7epn-assembly1.cif.gz_A ketosteroid isomerase ksi native 0.8281 8 123
ID Description Score Start End Superfamily
3hk4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9188 9 125 3.10.450.50
3hk4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9111 9 125 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.868 12 124 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8538 12 124 3.10.450.50
af_Q55DR3_11_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8184 10 124 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A3D2SBG4-F1-model_v4 SnoaL-like domain-containing protein 0.9859 8 125
AF-A0A7W1EDJ0-F1-model_v4 Nuclear transport factor 2 family protein 0.9858 8 125
AF-A0A537K939-F1-model_v4 Nuclear transport factor 2 family protein 0.9815 8 125
AF-A0A7K0EKB8-F1-model_v4 SRPBCC domain-containing protein 0.9789 4 125
AF-A0A7W1EDJ0-F1-model_v4 Nuclear transport factor 2 family protein 0.9776 8 125

Map