F355113
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 189 | 238 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300053087|Ga0500643_008440|Ga0500643_008440_2082_2513 |
| Length | 143 |
| Sequence | MSDTHWLERPSAQPGRTIVTKHRIYGTSFASVYPHYLAKAQKKGRTKEEVDEIILWLTGFDQQSLDAHLAEKSDFETFFALAPEPNPARAEIKGLICGIRVEEVAEPLMREIRYLDKLIDELAKGRPMEKILRGAGSSAGQRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 2 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 3 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 4 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 64 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 107 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 113 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 114 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 125 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 126 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 151 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 157 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 158 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 159 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 170 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 173 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 174 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 176 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 177 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 178 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 179 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 180 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 181 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 182 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 183 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 184 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 187 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 189 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 0 |
| Isolates | 1.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.83 |
| Nodule | 0.83 |
| Rhizoplane | 4.55 |
| Rhizosphere | 68.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10193557 | 3300001989 | Bacteria | 597 |
| 2 | JGI24737J22298_10009433 | 3300001990 | Bacteria | 3246 |
| 3 | rootH1_10072533 | 3300003316 | Bacteria | 1943 |
| 4 | Ga0055536_1001505 | 3300003781 | Bacteria | 14002 |
| 5 | Ga0055536_1002538 | 3300003781 | Bacteria | 10216 |
| 6 | Ga0055530_10003215 | 3300003791 | Bacteria | 9564 |
| 7 | Ga0055530_10015673 | 3300003791 | Bacteria | 2462 |
| 8 | Ga0055531_10000786 | 3300003794 | Bacteria | 26370 |
| 9 | Ga0055531_10002024 | 3300003794 | Bacteria | 14020 |
| 10 | Ga0065165_1000749 | 3300005262 | Bacteria | 44604 |
| 11 | Ga0065165_1046557 | 3300005262 | Bacteria | 1257 |
| 12 | Ga0065712_10792173 | 3300005290 | Bacteria | 515 |
| 13 | Ga0070658_10089483 | 3300005327 | Bacteria | 2535 |
| 14 | Ga0070683_100863370 | 3300005329 | Bacteria | 868 |
| 15 | Ga0070690_101287659 | 3300005330 | Bacteria | 585 |
| 16 | Ga0070670_100062023 | 3300005331 | Bacteria | 3209 |
| 17 | Ga0070670_100124536 | 3300005331 | Bacteria | 2224 |
| 18 | Ga0068868_100642691 | 3300005338 | Bacteria | 944 |
| 19 | Ga0070660_101690618 | 3300005339 | Bacteria | 539 |
| 20 | Ga0070661_100334703 | 3300005344 | Bacteria | 1185 |
| 21 | Ga0070668_100024435 | 3300005347 | Bacteria | 4579 |
| 22 | Ga0070671_100212265 | 3300005355 | Bacteria | 1642 |
| 23 | Ga0070671_100386975 | 3300005355 | Bacteria | 1195 |
| 24 | Ga0070671_101069399 | 3300005355 | Bacteria | 708 |
| 25 | Ga0070673_100514747 | 3300005364 | Bacteria | 1084 |
| 26 | Ga0070659_100012307 | 3300005366 | Bacteria | 6341 |
| 27 | Ga0070663_100373446 | 3300005455 | Bacteria | 1160 |
| 28 | Ga0070678_100064343 | 3300005456 | Bacteria | 2718 |
| 29 | Ga0070662_100103196 | 3300005457 | Bacteria | 2162 |
| 30 | Ga0068867_101663857 | 3300005459 | Bacteria | 598 |
| 31 | Ga0070684_101101703 | 3300005535 | Bacteria | 746 |
| 32 | Ga0068853_100587871 | 3300005539 | Bacteria | 1057 |
| 33 | Ga0070686_100000526 | 3300005544 | Bacteria | 22933 |
| 34 | Ga0070665_101383810 | 3300005548 | Bacteria | 713 |
| 35 | Ga0070664_100169176 | 3300005564 | Bacteria | 1938 |
| 36 | Ga0068857_100091196 | 3300005577 | Bacteria | 2727 |
| 37 | Ga0068859_102532319 | 3300005617 | Bacteria | 565 |
| 38 | Ga0068864_100010466 | 3300005618 | Bacteria | 7664 |
| 39 | Ga0068863_100118673 | 3300005841 | Bacteria | 2521 |
| 40 | Ga0068863_100135812 | 3300005841 | Bacteria | 2350 |
| 41 | Ga0068863_101890281 | 3300005841 | Bacteria | 607 |
| 42 | Ga0068858_101157370 | 3300005842 | Bacteria | 760 |
| 43 | Ga0070717_11604300 | 3300006028 | Bacteria | 590 |
| 44 | Ga0075365_10659078 | 3300006038 | Bacteria | 740 |
| 45 | Ga0075367_10692615 | 3300006178 | Bacteria | 648 |
| 46 | Ga0075369_10020326 | 3300006186 | Bacteria | 2719 |
| 47 | Ga0075369_10216014 | 3300006186 | Bacteria | 887 |
| 48 | Ga0075366_10160777 | 3300006195 | Bacteria | 1361 |
| 49 | Ga0075370_10233794 | 3300006353 | Bacteria | 1088 |
| 50 | Ga0068871_100286993 | 3300006358 | Bacteria | 1441 |
| 51 | Ga0068865_100042631 | 3300006881 | Bacteria | 3095 |
| 52 | Ga0097620_102532907 | 3300006931 | Bacteria | 565 |
| 53 | Ga0079104_1006809 | 3300006946 | Bacteria | 4241 |
| 54 | Ga0105240_10526028 | 3300009093 | Bacteria | 1312 |
| 55 | Ga0105242_10148097 | 3300009176 | Bacteria | 2044 |
| 56 | Ga0105248_10040919 | 3300009177 | Bacteria | 5196 |
| 57 | Ga0105248_10506469 | 3300009177 | Bacteria | 1361 |
| 58 | Ga0105248_10806134 | 3300009177 | Bacteria | 1060 |
| 59 | Ga0105238_13000923 | 3300009551 | Bacteria | 507 |
| 60 | Ga0105246_10024202 | 3300011119 | Bacteria | 3942 |
| 61 | Ga0157371_10072013 | 3300013102 | Bacteria | 2447 |
| 62 | Ga0157374_12914029 | 3300013296 | Bacteria | 506 |
| 63 | Ga0157378_10824652 | 3300013297 | Bacteria | 955 |
| 64 | Ga0163162_10116662 | 3300013306 | Bacteria | 2771 |
| 65 | Ga0163162_12087849 | 3300013306 | Bacteria | 650 |
| 66 | Ga0157372_11205668 | 3300013307 | Bacteria | 874 |
| 67 | Ga0157375_10077586 | 3300013308 | Bacteria | 3353 |
| 68 | Ga0157375_10382308 | 3300013308 | Bacteria | 1574 |
| 69 | Ga0157375_11464092 | 3300013308 | Bacteria | 805 |
| 70 | Ga0163163_10040546 | 3300014325 | Bacteria | 4547 |
| 71 | Ga0163163_11420028 | 3300014325 | Bacteria | 756 |
| 72 | Ga0157377_10464344 | 3300014745 | Bacteria | 877 |
| 73 | Ga0157377_11376284 | 3300014745 | Bacteria | 555 |
| 74 | Ga0157379_10538824 | 3300014968 | Bacteria | 1085 |
| 75 | Ga0163161_11026652 | 3300017792 | Bacteria | 705 |
| 76 | Ga0163161_11053930 | 3300017792 | Bacteria | 697 |
| 77 | Ga0213876_10133439 | 3300021384 | Bacteria | 1320 |
| 78 | Ga0209026_1011694 | 3300025250 | Bacteria | 1563 |
| 79 | Ga0209673_1050964 | 3300025273 | Bacteria | 1096 |
| 80 | Ga0209676_1000099 | 3300025292 | Bacteria | 230048 |
| 81 | Ga0209676_1000150 | 3300025292 | Bacteria | 167474 |
| 82 | Ga0209564_1001613 | 3300025295 | Bacteria | 21895 |
| 83 | Ga0209758_1001753 | 3300025297 | Bacteria | 24107 |
| 84 | Ga0209050_1000249 | 3300025298 | Bacteria | 116136 |
| 85 | Ga0209050_1001509 | 3300025298 | Bacteria | 24592 |
| 86 | Ga0209051_1003855 | 3300025303 | Bacteria | 9590 |
| 87 | Ga0209257_1000203 | 3300025304 | Bacteria | 146148 |
| 88 | Ga0209257_1001466 | 3300025304 | Bacteria | 27822 |
| 89 | Ga0209257_1004337 | 3300025304 | Bacteria | 11087 |
| 90 | Ga0207680_10356999 | 3300025903 | Bacteria | 1027 |
| 91 | Ga0207647_10070444 | 3300025904 | Bacteria | 2112 |
| 92 | Ga0207647_10352676 | 3300025904 | Bacteria | 833 |
| 93 | Ga0207643_10028166 | 3300025908 | Bacteria | 3119 |
| 94 | Ga0207705_10279062 | 3300025909 | Bacteria | 1279 |
| 95 | Ga0207695_10913845 | 3300025913 | Bacteria | 757 |
| 96 | Ga0207657_10078742 | 3300025919 | Bacteria | 2774 |
| 97 | Ga0207657_11416026 | 3300025919 | Bacteria | 522 |
| 98 | Ga0207649_10446356 | 3300025920 | Bacteria | 975 |
| 99 | Ga0207652_11155779 | 3300025921 | Bacteria | 675 |
| 100 | Ga0207681_10148269 | 3300025923 | Bacteria | 1755 |
| 101 | Ga0207694_10827988 | 3300025924 | Bacteria | 782 |
| 102 | Ga0207650_10097514 | 3300025925 | Bacteria | 2257 |
| 103 | Ga0207650_10447884 | 3300025925 | Bacteria | 1074 |
| 104 | Ga0207644_10101968 | 3300025931 | Bacteria | 2158 |
| 105 | Ga0207644_10176177 | 3300025931 | Bacteria | 1673 |
| 106 | Ga0207690_10012989 | 3300025932 | Bacteria | 4993 |
| 107 | Ga0207706_10362879 | 3300025933 | Bacteria | 1258 |
| 108 | Ga0207686_10027148 | 3300025934 | Bacteria | 3350 |
| 109 | Ga0207704_10001415 | 3300025938 | Bacteria | 10726 |
| 110 | Ga0207711_10691778 | 3300025941 | Bacteria | 951 |
| 111 | Ga0207661_10316256 | 3300025944 | Bacteria | 1403 |
| 112 | Ga0207679_10211729 | 3300025945 | Bacteria | 1626 |
| 113 | Ga0207667_11604146 | 3300025949 | Bacteria | 619 |
| 114 | Ga0207712_11794015 | 3300025961 | Bacteria | 550 |
| 115 | Ga0207668_10003586 | 3300025972 | Bacteria | 9121 |
| 116 | Ga0207658_11313613 | 3300025986 | Bacteria | 661 |
| 117 | Ga0207677_11134030 | 3300026023 | Bacteria | 714 |
| 118 | Ga0207703_11024977 | 3300026035 | Bacteria | 792 |
| 119 | Ga0207678_10626445 | 3300026067 | Bacteria | 944 |
| 120 | Ga0207641_10017108 | 3300026088 | Bacteria | 5932 |
| 121 | Ga0207641_10201027 | 3300026088 | Bacteria | 1837 |
| 122 | Ga0207641_10635179 | 3300026088 | Bacteria | 1048 |
| 123 | Ga0207676_10007835 | 3300026095 | Bacteria | 7595 |
| 124 | Ga0207674_10000082 | 3300026116 | Bacteria | 101650 |
| 125 | Ga0207683_10236092 | 3300026121 | Bacteria | 1668 |
| 126 | Ga0207698_10700812 | 3300026142 | Bacteria | 1007 |
| 127 | Ga0209281_1029076 | 3300027111 | Bacteria | 1000 |
| 128 | Ga0268266_10136589 | 3300028379 | Bacteria | 2197 |
| 129 | Ga0268265_10172128 | 3300028380 | Bacteria | 1852 |
| 130 | Ga0268265_10240551 | 3300028380 | Bacteria | 1597 |
| 131 | Ga0265326_10065964 | 3300028558 | Bacteria | 1023 |
| 132 | Ga0265334_10011806 | 3300028573 | Bacteria | 3671 |
| 133 | Ga0307515_10192568 | 3300028794 | Bacteria | 1943 |
| 134 | Ga0265338_10069471 | 3300028800 | Bacteria | 3026 |
| 135 | Ga0265338_10079624 | 3300028800 | Bacteria | 2756 |
| 136 | Ga0265338_10265449 | 3300028800 | Bacteria | 1260 |
| 137 | Ga0265327_10053836 | 3300031251 | Bacteria | 2086 |
| 138 | Ga0265314_10231567 | 3300031711 | Bacteria | 1071 |
| 139 | Ga0307406_10170079 | 3300031901 | Bacteria | 1576 |
| 140 | Ga0307412_10068702 | 3300031911 | Bacteria | 2410 |
| 141 | Ga0373936_0008405 | 3300035113 | Bacteria | 3886 |
| 142 | Ga0373946_0186275 | 3300035171 | Bacteria | 987 |
| 143 | Ga0373927_0000735 | 3300035695 | Bacteria | 24989 |
| 144 | Ga0373927_0018228 | 3300035695 | Bacteria | 4614 |
| 145 | Ga0373925_0000160 | 3300037068 | Bacteria | 72172 |
| 146 | Ga0373925_0026161 | 3300037068 | Bacteria | 4268 |
| 147 | Ga0395899_0915939 | 3300037312 | Bacteria | 534 |
| 148 | Ga0395900_0200710 | 3300037418 | Bacteria | 2018 |
| 149 | Ga0395905_0002477 | 3300037471 | Bacteria | 20432 |
| 150 | Ga0436364_0138670 | 3300037853 | Bacteria | 601 |
| 151 | Ga0395901_0021774 | 3300038443 | Bacteria | 6569 |
| 152 | Ga0436365_0761047 | 3300039437 | Bacteria | 5873 |
| 153 | Ga0439441_044292 | 3300042001 | Bacteria | 900 |
| 154 | Ga0450890_087138 | 3300042127 | Bacteria | 515 |
| 155 | Ga0495590_0004604 | 3300046457 | Bacteria | 5541 |
| 156 | Ga0495638_0005198 | 3300046460 | Bacteria | 9729 |
| 157 | Ga0495638_0006686 | 3300046460 | Bacteria | 8355 |
| 158 | Ga0495638_0076762 | 3300046460 | Bacteria | 2035 |
| 159 | Ga0495650_0000069 | 3300046471 | Bacteria | 261124 |
| 160 | Ga0495650_0292669 | 3300046471 | Bacteria | 546 |
| 161 | Ga0495606_0393319 | 3300046507 | Bacteria | 724 |
| 162 | Ga0495610_0001211 | 3300046512 | Bacteria | 23221 |
| 163 | Ga0495610_0003215 | 3300046512 | Bacteria | 12928 |
| 164 | Ga0495620_0072570 | 3300046515 | Bacteria | 1405 |
| 165 | Ga0495631_0000827 | 3300046518 | Bacteria | 19791 |
| 166 | Ga0495637_0027620 | 3300046520 | Bacteria | 2537 |
| 167 | Ga0495648_0168837 | 3300046524 | Bacteria | 1123 |
| 168 | Ga0495654_0000024 | 3300046530 | Bacteria | 238195 |
| 169 | Ga0495597_0268323 | 3300046542 | Bacteria | 667 |
| 170 | Ga0495645_0783093 | 3300046543 | Bacteria | 573 |
| 171 | Ga0495668_0000031 | 3300046616 | Bacteria | 256576 |
| 172 | Ga0495668_0155559 | 3300046616 | Bacteria | 1252 |
| 173 | Ga0495611_0304322 | 3300046648 | Bacteria | 735 |
| 174 | Ga0495625_0004432 | 3300046660 | Bacteria | 13281 |
| 175 | Ga0495625_0015845 | 3300046660 | Bacteria | 5950 |
| 176 | Ga0495625_0087062 | 3300046660 | Bacteria | 2166 |
| 177 | Ga0495671_0105229 | 3300046692 | Bacteria | 1378 |
| 178 | Ga0495660_0050012 | 3300046810 | Bacteria | 2279 |
| 179 | Ga0495672_0002995 | 3300047320 | Bacteria | 14857 |
| 180 | Ga0495673_0001615 | 3300047469 | Bacteria | 17467 |
| 181 | Ga0495681_0052613 | 3300047470 | Bacteria | 1909 |
| 182 | Ga0495686_0001958 | 3300047472 | Bacteria | 20461 |
| 183 | Ga0495686_0005770 | 3300047472 | Bacteria | 9672 |
| 184 | Ga0496100_0270159 | 3300048903 | Bacteria | 1264 |
| 185 | Ga0496102_0914325 | 3300048905 | Bacteria | 799 |
| 186 | Ga0496104_0783659 | 3300048907 | Bacteria | 860 |
| 187 | Ga0496106_1015317 | 3300048909 | Bacteria | 652 |
| 188 | Ga0496108_0256920 | 3300048911 | Bacteria | 1520 |
| 189 | Ga0496109_0050290 | 3300048912 | Bacteria | 3796 |
| 190 | Ga0496111_0209252 | 3300048914 | Bacteria | 1449 |
| 191 | Ga0496112_0282651 | 3300048915 | Bacteria | 1606 |
| 192 | Ga0496113_0356880 | 3300048916 | Bacteria | 1173 |
| 193 | Ga0496113_1518311 | 3300048916 | Bacteria | 517 |
| 194 | Ga0496115_0942056 | 3300048918 | Bacteria | 663 |
| 195 | Ga0496123_0368159 | 3300048926 | Bacteria | 663 |
| 196 | Ga0496124_0369319 | 3300048927 | Bacteria | 1008 |
| 197 | Ga0496125_0016301 | 3300048928 | Bacteria | 7141 |
| 198 | Ga0496125_0186929 | 3300048928 | Bacteria | 1373 |
| 199 | Ga0496126_0006322 | 3300048929 | Bacteria | 13223 |
| 200 | Ga0496126_0472365 | 3300048929 | Bacteria | 1006 |
| 201 | Ga0495678_001041 | 3300049459 | Bacteria | 23510 |
| 202 | Ga0501034_0011712 | 3300049571 | Bacteria | 9072 |
| 203 | Ga0501034_0055953 | 3300049571 | Bacteria | 3970 |
| 204 | Ga0501037_0095694 | 3300049573 | Bacteria | 2146 |
| 205 | Ga0501038_0227942 | 3300049574 | Bacteria | 1484 |
| 206 | Ga0501043_0405044 | 3300049579 | Bacteria | 1030 |
| 207 | Ga0501047_0135567 | 3300049581 | Bacteria | 2342 |
| 208 | Ga0501068_0750349 | 3300049584 | Bacteria | 639 |
| 209 | Ga0501073_0279964 | 3300049589 | Bacteria | 1151 |
| 210 | Ga0501238_001934 | 3300049671 | Bacteria | 2425 |
| 211 | Ga0501035_0046254 | 3300049822 | Bacteria | 3914 |
| 212 | Ga0501044_0002366 | 3300049823 | Bacteria | 21482 |
| 213 | Ga0501044_0082818 | 3300049823 | Bacteria | 3245 |
| 214 | Ga0501044_1170580 | 3300049823 | Bacteria | 637 |
| 215 | nmdc:mga03n38_472906_c1 | 3300050490 | Bacteria | 700 |
| 216 | nmdc:mga0k408_158730_c1 | 3300050493 | Bacteria | 1347 |
| 217 | nmdc:mga06z11_301217_c1 | 3300050494 | Bacteria | 953 |
| 218 | nmdc:mga0sz30_15486_c1 | 3300050516 | Bacteria | 3014 |
| 219 | nmdc:mga0sz30_422335_c1 | 3300050516 | Bacteria | 598 |
| 220 | Ga0500643_008440 | 3300053087 | Bacteria | 4046 |
| 221 | Ga0500641_0116945 | 3300053096 | Bacteria | 1148 |
| 222 | Ga0500641_0286779 | 3300053096 | Bacteria | 680 |
| 223 | Ga0500555_034694 | 3300053103 | Bacteria | 1420 |
| 224 | Ga0500556_0001003 | 3300053104 | Bacteria | 14903 |
| 225 | Ga0500562_000770 | 3300053108 | Bacteria | 7798 |
| 226 | Ga0500594_0000456 | 3300053118 | Bacteria | 9009 |
| 227 | Ga0500594_0298600 | 3300053118 | Bacteria | 540 |
| 228 | Ga0500655_014144 | 3300053133 | Bacteria | 1459 |
| 229 | Ga0500559_0123472 | 3300053136 | Bacteria | 1205 |
| 230 | Ga0500577_0364730 | 3300053142 | Bacteria | 632 |
| 231 | Ga0500616_0167006 | 3300053153 | Bacteria | 1003 |
| 232 | Ga0500622_0001059 | 3300053156 | Bacteria | 22916 |
| 233 | Ga0500622_0115728 | 3300053156 | Bacteria | 1305 |
| 234 | Ga0500627_0052524 | 3300053158 | Bacteria | 1779 |
| 235 | Ga0500627_0369123 | 3300053158 | Bacteria | 616 |
| 236 | Ga0500645_013024 | 3300053730 | Bacteria | 2677 |
| 237 | Ga0500645_086891 | 3300053730 | Bacteria | 889 |
| 238 | Ga0501082_0039312 | 3300060353 | Bacteria | 4081 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0005770 | Ga0495686_0005770_6408_6755 | 108 |
| 2 | iso_pu_bacteria | 2643221663 | 2644352466 | 111 |
| 3 | iso_pu_bacteria | 2643221545 | 2643749338 | 112 |
| 4 | iso_pu_bacteria | 2643221691 | 2644508888 | 112 |
| 5 | 3300001990 | JGI24737J22298_10009433 | JGI24737J22298_100094336 | 114 |
| 6 | 3300005331 | Ga0070670_100062023 | Ga0070670_1000620232 | 114 |
| 7 | 3300005339 | Ga0070660_101690618 | Ga0070660_1016906181 | 114 |
| 8 | 3300005355 | Ga0070671_101069399 | Ga0070671_1010693991 | 114 |
| 9 | 3300005366 | Ga0070659_100012307 | Ga0070659_1000123074 | 114 |
| 10 | 3300005577 | Ga0068857_100091196 | Ga0068857_1000911964 | 114 |
| 11 | 3300005841 | Ga0068863_100118673 | Ga0068863_1001186734 | 114 |
| 12 | 3300006946 | Ga0079104_1006809 | Ga0079104_10068095 | 114 |
| 13 | 3300009177 | Ga0105248_10506469 | Ga0105248_105064692 | 114 |
| 14 | 3300011119 | Ga0105246_10024202 | Ga0105246_100242028 | 114 |
| 15 | 3300013102 | Ga0157371_10072013 | Ga0157371_100720131 | 114 |
| 16 | 3300013307 | Ga0157372_11205668 | Ga0157372_112056682 | 114 |
| 17 | 3300014745 | Ga0157377_11376284 | Ga0157377_113762841 | 114 |
| 18 | 3300017792 | Ga0163161_11026652 | Ga0163161_110266521 | 114 |
| 19 | 3300025904 | Ga0207647_10070444 | Ga0207647_100704442 | 114 |
| 20 | 3300025919 | Ga0207657_11416026 | Ga0207657_114160261 | 114 |
| 21 | 3300025932 | Ga0207690_10012989 | Ga0207690_1001298910 | 114 |
| 22 | 3300026088 | Ga0207641_10017108 | Ga0207641_1001710810 | 114 |
| 23 | 3300026116 | Ga0207674_10000082 | Ga0207674_10000082120 | 114 |
| 24 | 3300026142 | Ga0207698_10700812 | Ga0207698_107008122 | 114 |
| 25 | 3300028380 | Ga0268265_10240551 | Ga0268265_102405512 | 114 |
| 26 | 3300042127 | Ga0450890_087138 | Ga0450890_087138_135_482 | 114 |
| 27 | 3300049571 | Ga0501034_0011712 | Ga0501034_0011712_4408_4755 | 114 |
| 28 | 3300049573 | Ga0501037_0095694 | Ga0501037_0095694_1344_1691 | 114 |
| 29 | 3300049574 | Ga0501038_0227942 | Ga0501038_0227942_931_1278 | 114 |
| 30 | 3300049823 | Ga0501044_0002366 | Ga0501044_0002366_19061_19408 | 114 |
| 31 | 3300053142 | Ga0500577_0364730 | Ga0500577_0364730_130_477 | 114 |
| 32 | 3300053153 | Ga0500616_0167006 | Ga0500616_0167006_269_649 | 114 |
| 33 | 3300001989 | JGI24739J22299_10193557 | JGI24739J22299_101935571 | 115 |
| 34 | 3300003316 | rootH1_10072533 | rootH1_100725332 | 115 |
| 35 | 3300003781 | Ga0055536_1001505 | Ga0055536_100150513 | 115 |
| 36 | 3300003781 | Ga0055536_1002538 | Ga0055536_10025384 | 115 |
| 37 | 3300003791 | Ga0055530_10003215 | Ga0055530_1000321510 | 115 |
| 38 | 3300003791 | Ga0055530_10015673 | Ga0055530_100156733 | 115 |
| 39 | 3300003794 | Ga0055531_10000786 | Ga0055531_1000078613 | 115 |
| 40 | 3300003794 | Ga0055531_10002024 | Ga0055531_100020243 | 115 |
| 41 | 3300005262 | Ga0065165_1000749 | Ga0065165_100074927 | 115 |
| 42 | 3300005262 | Ga0065165_1046557 | Ga0065165_10465572 | 115 |
| 43 | 3300005290 | Ga0065712_10792173 | Ga0065712_107921731 | 115 |
| 44 | 3300005327 | Ga0070658_10089483 | Ga0070658_100894831 | 115 |
| 45 | 3300005329 | Ga0070683_100863370 | Ga0070683_1008633701 | 115 |
| 46 | 3300005330 | Ga0070690_101287659 | Ga0070690_1012876592 | 115 |
| 47 | 3300005331 | Ga0070670_100124536 | Ga0070670_1001245364 | 115 |
| 48 | 3300005338 | Ga0068868_100642691 | Ga0068868_1006426912 | 115 |
| 49 | 3300005344 | Ga0070661_100334703 | Ga0070661_1003347033 | 115 |
| 50 | 3300005347 | Ga0070668_100024435 | Ga0070668_1000244354 | 115 |
| 51 | 3300005355 | Ga0070671_100212265 | Ga0070671_1002122652 | 115 |
| 52 | 3300005355 | Ga0070671_100386975 | Ga0070671_1003869753 | 115 |
| 53 | 3300005364 | Ga0070673_100514747 | Ga0070673_1005147472 | 115 |
| 54 | 3300005455 | Ga0070663_100373446 | Ga0070663_1003734461 | 115 |
| 55 | 3300005456 | Ga0070678_100064343 | Ga0070678_1000643432 | 115 |
| 56 | 3300005457 | Ga0070662_100103196 | Ga0070662_1001031962 | 115 |
| 57 | 3300005459 | Ga0068867_101663857 | Ga0068867_1016638571 | 115 |
| 58 | 3300005535 | Ga0070684_101101703 | Ga0070684_1011017032 | 115 |
| 59 | 3300005539 | Ga0068853_100587871 | Ga0068853_1005878712 | 115 |
| 60 | 3300005544 | Ga0070686_100000526 | Ga0070686_10000052624 | 115 |
| 61 | 3300005548 | Ga0070665_101383810 | Ga0070665_1013838102 | 115 |
| 62 | 3300005564 | Ga0070664_100169176 | Ga0070664_1001691763 | 115 |
| 63 | 3300005617 | Ga0068859_102532319 | Ga0068859_1025323192 | 115 |
| 64 | 3300005618 | Ga0068864_100010466 | Ga0068864_1000104663 | 115 |
| 65 | 3300005841 | Ga0068863_100135812 | Ga0068863_1001358124 | 115 |
| 66 | 3300005841 | Ga0068863_101890281 | Ga0068863_1018902812 | 115 |
| 67 | 3300005842 | Ga0068858_101157370 | Ga0068858_1011573702 | 115 |
| 68 | 3300006028 | Ga0070717_11604300 | Ga0070717_116043001 | 115 |
| 69 | 3300006038 | Ga0075365_10659078 | Ga0075365_106590782 | 115 |
| 70 | 3300006178 | Ga0075367_10692615 | Ga0075367_106926151 | 115 |
| 71 | 3300006186 | Ga0075369_10020326 | Ga0075369_100203263 | 115 |
| 72 | 3300006186 | Ga0075369_10216014 | Ga0075369_102160142 | 115 |
| 73 | 3300006195 | Ga0075366_10160777 | Ga0075366_101607773 | 115 |
| 74 | 3300006353 | Ga0075370_10233794 | Ga0075370_102337941 | 115 |
| 75 | 3300006358 | Ga0068871_100286993 | Ga0068871_1002869933 | 115 |
| 76 | 3300006881 | Ga0068865_100042631 | Ga0068865_1000426315 | 115 |
| 77 | 3300006931 | Ga0097620_102532907 | Ga0097620_1025329071 | 115 |
| 78 | 3300009093 | Ga0105240_10526028 | Ga0105240_105260282 | 115 |
| 79 | 3300009176 | Ga0105242_10148097 | Ga0105242_101480974 | 115 |
| 80 | 3300009177 | Ga0105248_10040919 | Ga0105248_100409194 | 115 |
| 81 | 3300009177 | Ga0105248_10806134 | Ga0105248_108061342 | 115 |
| 82 | 3300009551 | Ga0105238_13000923 | Ga0105238_130009231 | 115 |
| 83 | 3300013296 | Ga0157374_12914029 | Ga0157374_129140291 | 115 |
| 84 | 3300013297 | Ga0157378_10824652 | Ga0157378_108246522 | 115 |
| 85 | 3300013306 | Ga0163162_10116662 | Ga0163162_101166622 | 115 |
| 86 | 3300013306 | Ga0163162_12087849 | Ga0163162_120878492 | 115 |
| 87 | 3300013308 | Ga0157375_10077586 | Ga0157375_100775863 | 115 |
| 88 | 3300013308 | Ga0157375_10382308 | Ga0157375_103823081 | 115 |
| 89 | 3300013308 | Ga0157375_11464092 | Ga0157375_114640922 | 115 |
| 90 | 3300014325 | Ga0163163_10040546 | Ga0163163_100405462 | 115 |
| 91 | 3300014325 | Ga0163163_11420028 | Ga0163163_114200282 | 115 |
| 92 | 3300014745 | Ga0157377_10464344 | Ga0157377_104643442 | 115 |
| 93 | 3300014968 | Ga0157379_10538824 | Ga0157379_105388243 | 115 |
| 94 | 3300017792 | Ga0163161_11053930 | Ga0163161_110539301 | 115 |
| 95 | 3300021384 | Ga0213876_10133439 | Ga0213876_101334391 | 115 |
| 96 | 3300025250 | Ga0209026_1011694 | Ga0209026_10116942 | 115 |
| 97 | 3300025273 | Ga0209673_1050964 | Ga0209673_10509642 | 115 |
| 98 | 3300025292 | Ga0209676_1000099 | Ga0209676_1000099199 | 115 |
| 99 | 3300025292 | Ga0209676_1000150 | Ga0209676_100015088 | 115 |
| 100 | 3300025295 | Ga0209564_1001613 | Ga0209564_100161322 | 115 |
| 101 | 3300025297 | Ga0209758_1001753 | Ga0209758_100175323 | 115 |
| 102 | 3300025298 | Ga0209050_1000249 | Ga0209050_100024924 | 115 |
| 103 | 3300025298 | Ga0209050_1001509 | Ga0209050_100150914 | 115 |
| 104 | 3300025303 | Ga0209051_1003855 | Ga0209051_100385511 | 115 |
| 105 | 3300025304 | Ga0209257_1000203 | Ga0209257_10002039 | 115 |
| 106 | 3300025304 | Ga0209257_1001466 | Ga0209257_100146621 | 115 |
| 107 | 3300025304 | Ga0209257_1004337 | Ga0209257_10043374 | 115 |
| 108 | 3300025903 | Ga0207680_10356999 | Ga0207680_103569992 | 115 |
| 109 | 3300025904 | Ga0207647_10352676 | Ga0207647_103526762 | 115 |
| 110 | 3300025908 | Ga0207643_10028166 | Ga0207643_100281666 | 115 |
| 111 | 3300025909 | Ga0207705_10279062 | Ga0207705_102790623 | 115 |
| 112 | 3300025913 | Ga0207695_10913845 | Ga0207695_109138451 | 115 |
| 113 | 3300025919 | Ga0207657_10078742 | Ga0207657_100787422 | 115 |
| 114 | 3300025920 | Ga0207649_10446356 | Ga0207649_104463561 | 115 |
| 115 | 3300025921 | Ga0207652_11155779 | Ga0207652_111557792 | 115 |
| 116 | 3300025923 | Ga0207681_10148269 | Ga0207681_101482692 | 115 |
| 117 | 3300025924 | Ga0207694_10827988 | Ga0207694_108279881 | 115 |
| 118 | 3300025925 | Ga0207650_10097514 | Ga0207650_100975143 | 115 |
| 119 | 3300025925 | Ga0207650_10447884 | Ga0207650_104478842 | 115 |
| 120 | 3300025931 | Ga0207644_10101968 | Ga0207644_101019684 | 115 |
| 121 | 3300025931 | Ga0207644_10176177 | Ga0207644_101761772 | 115 |
| 122 | 3300025933 | Ga0207706_10362879 | Ga0207706_103628792 | 115 |
| 123 | 3300025934 | Ga0207686_10027148 | Ga0207686_100271482 | 115 |
| 124 | 3300025938 | Ga0207704_10001415 | Ga0207704_100014153 | 115 |
| 125 | 3300025941 | Ga0207711_10691778 | Ga0207711_106917782 | 115 |
| 126 | 3300025944 | Ga0207661_10316256 | Ga0207661_103162562 | 115 |
| 127 | 3300025945 | Ga0207679_10211729 | Ga0207679_102117292 | 115 |
| 128 | 3300025949 | Ga0207667_11604146 | Ga0207667_116041462 | 115 |
| 129 | 3300025961 | Ga0207712_11794015 | Ga0207712_117940151 | 115 |
| 130 | 3300025972 | Ga0207668_10003586 | Ga0207668_100035865 | 115 |
| 131 | 3300025986 | Ga0207658_11313613 | Ga0207658_113136131 | 115 |
| 132 | 3300026023 | Ga0207677_11134030 | Ga0207677_111340302 | 115 |
| 133 | 3300026035 | Ga0207703_11024977 | Ga0207703_110249772 | 115 |
| 134 | 3300026067 | Ga0207678_10626445 | Ga0207678_106264452 | 115 |
| 135 | 3300026088 | Ga0207641_10201027 | Ga0207641_102010272 | 115 |
| 136 | 3300026088 | Ga0207641_10635179 | Ga0207641_106351792 | 115 |
| 137 | 3300026095 | Ga0207676_10007835 | Ga0207676_100078353 | 115 |
| 138 | 3300026121 | Ga0207683_10236092 | Ga0207683_102360923 | 115 |
| 139 | 3300027111 | Ga0209281_1029076 | Ga0209281_10290762 | 115 |
| 140 | 3300028379 | Ga0268266_10136589 | Ga0268266_101365894 | 115 |
| 141 | 3300028380 | Ga0268265_10172128 | Ga0268265_101721284 | 115 |
| 142 | 3300028558 | Ga0265326_10065964 | Ga0265326_100659642 | 115 |
| 143 | 3300028573 | Ga0265334_10011806 | Ga0265334_100118063 | 115 |
| 144 | 3300028794 | Ga0307515_10192568 | Ga0307515_101925683 | 115 |
| 145 | 3300028800 | Ga0265338_10069471 | Ga0265338_100694715 | 115 |
| 146 | 3300028800 | Ga0265338_10079624 | Ga0265338_100796242 | 115 |
| 147 | 3300028800 | Ga0265338_10265449 | Ga0265338_102654493 | 115 |
| 148 | 3300031251 | Ga0265327_10053836 | Ga0265327_100538362 | 115 |
| 149 | 3300031711 | Ga0265314_10231567 | Ga0265314_102315672 | 115 |
| 150 | 3300031901 | Ga0307406_10170079 | Ga0307406_101700792 | 115 |
| 151 | 3300031911 | Ga0307412_10068702 | Ga0307412_100687023 | 115 |
| 152 | 3300035113 | Ga0373936_0008405 | Ga0373936_0008405_438_827 | 115 |
| 153 | 3300035171 | Ga0373946_0186275 | Ga0373946_0186275_255_611 | 115 |
| 154 | 3300035695 | Ga0373927_0000735 | Ga0373927_0000735_12015_12365 | 115 |
| 155 | 3300035695 | Ga0373927_0018228 | Ga0373927_0018228_695_1051 | 115 |
| 156 | 3300037068 | Ga0373925_0000160 | Ga0373925_0000160_2650_3006 | 115 |
| 157 | 3300037068 | Ga0373925_0026161 | Ga0373925_0026161_2139_2489 | 115 |
| 158 | 3300037312 | Ga0395899_0915939 | Ga0395899_0915939_95_442 | 115 |
| 159 | 3300037418 | Ga0395900_0200710 | Ga0395900_0200710_32_379 | 115 |
| 160 | 3300037471 | Ga0395905_0002477 | Ga0395905_0002477_4099_4446 | 115 |
| 161 | 3300037853 | Ga0436364_0138670 | Ga0436364_0138670_68_421 | 115 |
| 162 | 3300038443 | Ga0395901_0021774 | Ga0395901_0021774_1296_1643 | 115 |
| 163 | 3300039437 | Ga0436365_0761047 | Ga0436365_0761047_1280_1660 | 115 |
| 164 | 3300042001 | Ga0439441_044292 | Ga0439441_044292_171_521 | 115 |
| 165 | 3300046457 | Ga0495590_0004604 | Ga0495590_0004604_4127_4477 | 115 |
| 166 | 3300046460 | Ga0495638_0005198 | Ga0495638_0005198_9260_9667 | 115 |
| 167 | 3300046460 | Ga0495638_0006686 | Ga0495638_0006686_4504_4854 | 115 |
| 168 | 3300046460 | Ga0495638_0076762 | Ga0495638_0076762_1493_1843 | 115 |
| 169 | 3300046471 | Ga0495650_0000069 | Ga0495650_0000069_54563_54931 | 115 |
| 170 | 3300046471 | Ga0495650_0292669 | Ga0495650_0292669_68_418 | 115 |
| 171 | 3300046507 | Ga0495606_0393319 | Ga0495606_0393319_173_526 | 115 |
| 172 | 3300046512 | Ga0495610_0001211 | Ga0495610_0001211_10873_11280 | 115 |
| 173 | 3300046512 | Ga0495610_0003215 | Ga0495610_0003215_9541_9891 | 115 |
| 174 | 3300046515 | Ga0495620_0072570 | Ga0495620_0072570_156_521 | 115 |
| 175 | 3300046518 | Ga0495631_0000827 | Ga0495631_0000827_7448_7798 | 115 |
| 176 | 3300046520 | Ga0495637_0027620 | Ga0495637_0027620_88_450 | 115 |
| 177 | 3300046524 | Ga0495648_0168837 | Ga0495648_0168837_111_479 | 115 |
| 178 | 3300046530 | Ga0495654_0000024 | Ga0495654_0000024_66720_67088 | 115 |
| 179 | 3300046542 | Ga0495597_0268323 | Ga0495597_0268323_280_630 | 115 |
| 180 | 3300046543 | Ga0495645_0783093 | Ga0495645_0783093_142_495 | 115 |
| 181 | 3300046616 | Ga0495668_0000031 | Ga0495668_0000031_44914_45273 | 115 |
| 182 | 3300046616 | Ga0495668_0155559 | Ga0495668_0155559_234_581 | 115 |
| 183 | 3300046648 | Ga0495611_0304322 | Ga0495611_0304322_115_483 | 115 |
| 184 | 3300046660 | Ga0495625_0004432 | Ga0495625_0004432_11081_11488 | 115 |
| 185 | 3300046660 | Ga0495625_0015845 | Ga0495625_0015845_2014_2382 | 115 |
| 186 | 3300046660 | Ga0495625_0087062 | Ga0495625_0087062_1516_1866 | 115 |
| 187 | 3300046692 | Ga0495671_0105229 | Ga0495671_0105229_352_702 | 115 |
| 188 | 3300046810 | Ga0495660_0050012 | Ga0495660_0050012_503_853 | 115 |
| 189 | 3300047320 | Ga0495672_0002995 | Ga0495672_0002995_11799_12212 | 115 |
| 190 | 3300047469 | Ga0495673_0001615 | Ga0495673_0001615_16183_16536 | 115 |
| 191 | 3300047470 | Ga0495681_0052613 | Ga0495681_0052613_1011_1379 | 115 |
| 192 | 3300047472 | Ga0495686_0001958 | Ga0495686_0001958_16059_16409 | 115 |
| 193 | 3300048903 | Ga0496100_0270159 | Ga0496100_0270159_507_857 | 115 |
| 194 | 3300048905 | Ga0496102_0914325 | Ga0496102_0914325_248_598 | 115 |
| 195 | 3300048907 | Ga0496104_0783659 | Ga0496104_0783659_432_782 | 115 |
| 196 | 3300048909 | Ga0496106_1015317 | Ga0496106_1015317_244_594 | 115 |
| 197 | 3300048911 | Ga0496108_0256920 | Ga0496108_0256920_330_680 | 115 |
| 198 | 3300048912 | Ga0496109_0050290 | Ga0496109_0050290_3314_3664 | 115 |
| 199 | 3300048914 | Ga0496111_0209252 | Ga0496111_0209252_239_589 | 115 |
| 200 | 3300048915 | Ga0496112_0282651 | Ga0496112_0282651_982_1332 | 115 |
| 201 | 3300048916 | Ga0496113_0356880 | Ga0496113_0356880_236_586 | 115 |
| 202 | 3300048916 | Ga0496113_1518311 | Ga0496113_1518311_40_390 | 115 |
| 203 | 3300048918 | Ga0496115_0942056 | Ga0496115_0942056_33_383 | 115 |
| 204 | 3300048926 | Ga0496123_0368159 | Ga0496123_0368159_122_535 | 115 |
| 205 | 3300048927 | Ga0496124_0369319 | Ga0496124_0369319_84_434 | 115 |
| 206 | 3300048928 | Ga0496125_0016301 | Ga0496125_0016301_2796_3146 | 115 |
| 207 | 3300048928 | Ga0496125_0186929 | Ga0496125_0186929_769_1128 | 115 |
| 208 | 3300048929 | Ga0496126_0006322 | Ga0496126_0006322_979_1329 | 115 |
| 209 | 3300048929 | Ga0496126_0472365 | Ga0496126_0472365_460_816 | 115 |
| 210 | 3300049459 | Ga0495678_001041 | Ga0495678_001041_9635_9985 | 115 |
| 211 | 3300049571 | Ga0501034_0055953 | Ga0501034_0055953_478_900 | 115 |
| 212 | 3300049579 | Ga0501043_0405044 | Ga0501043_0405044_301_723 | 115 |
| 213 | 3300049581 | Ga0501047_0135567 | Ga0501047_0135567_1860_2282 | 115 |
| 214 | 3300049584 | Ga0501068_0750349 | Ga0501068_0750349_245_595 | 115 |
| 215 | 3300049589 | Ga0501073_0279964 | Ga0501073_0279964_562_984 | 115 |
| 216 | 3300049671 | Ga0501238_001934 | Ga0501238_001934_1714_2064 | 115 |
| 217 | 3300049822 | Ga0501035_0046254 | Ga0501035_0046254_2953_3375 | 115 |
| 218 | 3300049823 | Ga0501044_0082818 | Ga0501044_0082818_2310_2732 | 115 |
| 219 | 3300049823 | Ga0501044_1170580 | Ga0501044_1170580_129_482 | 115 |
| 220 | 3300050490 | nmdc:mga03n38_472906_c1 | nmdc:mga03n38_472906_c1_65_418 | 115 |
| 221 | 3300050493 | nmdc:mga0k408_158730_c1 | nmdc:mga0k408_158730_c1_160_516 | 115 |
| 222 | 3300050494 | nmdc:mga06z11_301217_c1 | nmdc:mga06z11_301217_c1_410_766 | 115 |
| 223 | 3300050516 | nmdc:mga0sz30_15486_c1 | nmdc:mga0sz30_15486_c1_1431_1781 | 115 |
| 224 | 3300050516 | nmdc:mga0sz30_422335_c1 | nmdc:mga0sz30_422335_c1_122_472 | 115 |
| 225 | 3300053087 | Ga0500643_008440 | Ga0500643_008440_2082_2513 | 115 |
| 226 | 3300053096 | Ga0500641_0116945 | Ga0500641_0116945_640_1005 | 115 |
| 227 | 3300053096 | Ga0500641_0286779 | Ga0500641_0286779_304_654 | 115 |
| 228 | 3300053103 | Ga0500555_034694 | Ga0500555_034694_792_1160 | 115 |
| 229 | 3300053104 | Ga0500556_0001003 | Ga0500556_0001003_11186_11587 | 115 |
| 230 | 3300053108 | Ga0500562_000770 | Ga0500562_000770_5036_5386 | 115 |
| 231 | 3300053118 | Ga0500594_0000456 | Ga0500594_0000456_5281_5631 | 115 |
| 232 | 3300053118 | Ga0500594_0298600 | Ga0500594_0298600_145_510 | 115 |
| 233 | 3300053133 | Ga0500655_014144 | Ga0500655_014144_1048_1398 | 115 |
| 234 | 3300053136 | Ga0500559_0123472 | Ga0500559_0123472_304_657 | 115 |
| 235 | 3300053156 | Ga0500622_0001059 | Ga0500622_0001059_17748_18098 | 115 |
| 236 | 3300053156 | Ga0500622_0115728 | Ga0500622_0115728_724_1074 | 115 |
| 237 | 3300053158 | Ga0500627_0052524 | Ga0500627_0052524_1230_1598 | 115 |
| 238 | 3300053158 | Ga0500627_0369123 | Ga0500627_0369123_141_491 | 115 |
| 239 | 3300053730 | Ga0500645_013024 | Ga0500645_013024_2180_2542 | 115 |
| 240 | 3300053730 | Ga0500645_086891 | Ga0500645_086891_461_811 | 115 |
| 241 | 3300060353 | Ga0501082_0039312 | Ga0501082_0039312_1664_2014 | 115 |
| 242 | iso_pu_bacteria | 2932401849 | 2932405365 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c9p-assembly1.cif.gz_A | crystal structure of uncharacterized protein sp1917 | 0.932 | 1 | 114 |
| 3c9p-assembly1.cif.gz_A | crystal structure of uncharacterized protein sp1917 | 0.9168 | 1 | 114 |
| 2r63-assembly1.cif.gz_A | structural role of a buried salt bridge in the 434 repressor dna-binding domain, nmr, 20 structures | 0.3964 | 13 | 107 |
| 2r63-assembly1.cif.gz_A | structural role of a buried salt bridge in the 434 repressor dna-binding domain, nmr, 20 structures | 0.3902 | 13 | 107 |
| 6p0d-assembly1.cif.gz_A | human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick | 0.3749 | 28 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c9pA00 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain | 0.9398 | 4 | 114 | 1.10.8.290 |
| 3c9pA00 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain | 0.8857 | 4 | 114 | 1.10.8.290 |
| af_P9WHV3_1_82_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.796 | 8 | 114 | 1.10.8.10 |
| af_Q2FWE1_2_83_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.7924 | 8 | 114 | 1.10.8.10 |
| af_P0ACC1_1_83_1.10.8.10 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain | 0.7651 | 8 | 114 | 1.10.8.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W6VMU7-F1-model_v4 | deleted | 1.006 | 32 | 115 |
|
| AF-A0A4R9K0F8-F1-model_v4 | DUF2200 family protein | 1.004 | 2 | 115 |
|
| AF-A0A7Y7HHU7-F1-model_v4 | deleted | 1.003 | 3 | 115 |
|
| AF-S0K083-F1-model_v4 | DUF2200 domain-containing protein | 1.002 | 4 | 115 |
|
| AF-A0A6B3C8S0-F1-model_v4 | DUF2200 domain-containing protein | 1.002 | 2 | 104 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar