F355113

General Info

Members Datasets Scaffolds Average Seq Length
242 189 238 118

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_008440|Ga0500643_008440_2082_2513
Length 143
Sequence MSDTHWLERPSAQPGRTIVTKHRIYGTSFASVYPHYLAKAQKKGRTKEEVDEIILWLTGFDQQSLDAHLAEKSDFETFFALAPEPNPARAEIKGLICGIRVEEVAEPLMREIRYLDKLIDELAKGRPMEKILRGAGSSAGQRR

Samples

Sample ID Description Type Environment
1 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
2 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
3 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
4 2932401849 Devosia sp. 2618 Isolate Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
125 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
178 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
179 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
180 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.83
Nodule 0.83
Rhizoplane 4.55
Rhizosphere 68.6
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10193557 3300001989 Bacteria 597
2 JGI24737J22298_10009433 3300001990 Bacteria 3246
3 rootH1_10072533 3300003316 Bacteria 1943
4 Ga0055536_1001505 3300003781 Bacteria 14002
5 Ga0055536_1002538 3300003781 Bacteria 10216
6 Ga0055530_10003215 3300003791 Bacteria 9564
7 Ga0055530_10015673 3300003791 Bacteria 2462
8 Ga0055531_10000786 3300003794 Bacteria 26370
9 Ga0055531_10002024 3300003794 Bacteria 14020
10 Ga0065165_1000749 3300005262 Bacteria 44604
11 Ga0065165_1046557 3300005262 Bacteria 1257
12 Ga0065712_10792173 3300005290 Bacteria 515
13 Ga0070658_10089483 3300005327 Bacteria 2535
14 Ga0070683_100863370 3300005329 Bacteria 868
15 Ga0070690_101287659 3300005330 Bacteria 585
16 Ga0070670_100062023 3300005331 Bacteria 3209
17 Ga0070670_100124536 3300005331 Bacteria 2224
18 Ga0068868_100642691 3300005338 Bacteria 944
19 Ga0070660_101690618 3300005339 Bacteria 539
20 Ga0070661_100334703 3300005344 Bacteria 1185
21 Ga0070668_100024435 3300005347 Bacteria 4579
22 Ga0070671_100212265 3300005355 Bacteria 1642
23 Ga0070671_100386975 3300005355 Bacteria 1195
24 Ga0070671_101069399 3300005355 Bacteria 708
25 Ga0070673_100514747 3300005364 Bacteria 1084
26 Ga0070659_100012307 3300005366 Bacteria 6341
27 Ga0070663_100373446 3300005455 Bacteria 1160
28 Ga0070678_100064343 3300005456 Bacteria 2718
29 Ga0070662_100103196 3300005457 Bacteria 2162
30 Ga0068867_101663857 3300005459 Bacteria 598
31 Ga0070684_101101703 3300005535 Bacteria 746
32 Ga0068853_100587871 3300005539 Bacteria 1057
33 Ga0070686_100000526 3300005544 Bacteria 22933
34 Ga0070665_101383810 3300005548 Bacteria 713
35 Ga0070664_100169176 3300005564 Bacteria 1938
36 Ga0068857_100091196 3300005577 Bacteria 2727
37 Ga0068859_102532319 3300005617 Bacteria 565
38 Ga0068864_100010466 3300005618 Bacteria 7664
39 Ga0068863_100118673 3300005841 Bacteria 2521
40 Ga0068863_100135812 3300005841 Bacteria 2350
41 Ga0068863_101890281 3300005841 Bacteria 607
42 Ga0068858_101157370 3300005842 Bacteria 760
43 Ga0070717_11604300 3300006028 Bacteria 590
44 Ga0075365_10659078 3300006038 Bacteria 740
45 Ga0075367_10692615 3300006178 Bacteria 648
46 Ga0075369_10020326 3300006186 Bacteria 2719
47 Ga0075369_10216014 3300006186 Bacteria 887
48 Ga0075366_10160777 3300006195 Bacteria 1361
49 Ga0075370_10233794 3300006353 Bacteria 1088
50 Ga0068871_100286993 3300006358 Bacteria 1441
51 Ga0068865_100042631 3300006881 Bacteria 3095
52 Ga0097620_102532907 3300006931 Bacteria 565
53 Ga0079104_1006809 3300006946 Bacteria 4241
54 Ga0105240_10526028 3300009093 Bacteria 1312
55 Ga0105242_10148097 3300009176 Bacteria 2044
56 Ga0105248_10040919 3300009177 Bacteria 5196
57 Ga0105248_10506469 3300009177 Bacteria 1361
58 Ga0105248_10806134 3300009177 Bacteria 1060
59 Ga0105238_13000923 3300009551 Bacteria 507
60 Ga0105246_10024202 3300011119 Bacteria 3942
61 Ga0157371_10072013 3300013102 Bacteria 2447
62 Ga0157374_12914029 3300013296 Bacteria 506
63 Ga0157378_10824652 3300013297 Bacteria 955
64 Ga0163162_10116662 3300013306 Bacteria 2771
65 Ga0163162_12087849 3300013306 Bacteria 650
66 Ga0157372_11205668 3300013307 Bacteria 874
67 Ga0157375_10077586 3300013308 Bacteria 3353
68 Ga0157375_10382308 3300013308 Bacteria 1574
69 Ga0157375_11464092 3300013308 Bacteria 805
70 Ga0163163_10040546 3300014325 Bacteria 4547
71 Ga0163163_11420028 3300014325 Bacteria 756
72 Ga0157377_10464344 3300014745 Bacteria 877
73 Ga0157377_11376284 3300014745 Bacteria 555
74 Ga0157379_10538824 3300014968 Bacteria 1085
75 Ga0163161_11026652 3300017792 Bacteria 705
76 Ga0163161_11053930 3300017792 Bacteria 697
77 Ga0213876_10133439 3300021384 Bacteria 1320
78 Ga0209026_1011694 3300025250 Bacteria 1563
79 Ga0209673_1050964 3300025273 Bacteria 1096
80 Ga0209676_1000099 3300025292 Bacteria 230048
81 Ga0209676_1000150 3300025292 Bacteria 167474
82 Ga0209564_1001613 3300025295 Bacteria 21895
83 Ga0209758_1001753 3300025297 Bacteria 24107
84 Ga0209050_1000249 3300025298 Bacteria 116136
85 Ga0209050_1001509 3300025298 Bacteria 24592
86 Ga0209051_1003855 3300025303 Bacteria 9590
87 Ga0209257_1000203 3300025304 Bacteria 146148
88 Ga0209257_1001466 3300025304 Bacteria 27822
89 Ga0209257_1004337 3300025304 Bacteria 11087
90 Ga0207680_10356999 3300025903 Bacteria 1027
91 Ga0207647_10070444 3300025904 Bacteria 2112
92 Ga0207647_10352676 3300025904 Bacteria 833
93 Ga0207643_10028166 3300025908 Bacteria 3119
94 Ga0207705_10279062 3300025909 Bacteria 1279
95 Ga0207695_10913845 3300025913 Bacteria 757
96 Ga0207657_10078742 3300025919 Bacteria 2774
97 Ga0207657_11416026 3300025919 Bacteria 522
98 Ga0207649_10446356 3300025920 Bacteria 975
99 Ga0207652_11155779 3300025921 Bacteria 675
100 Ga0207681_10148269 3300025923 Bacteria 1755
101 Ga0207694_10827988 3300025924 Bacteria 782
102 Ga0207650_10097514 3300025925 Bacteria 2257
103 Ga0207650_10447884 3300025925 Bacteria 1074
104 Ga0207644_10101968 3300025931 Bacteria 2158
105 Ga0207644_10176177 3300025931 Bacteria 1673
106 Ga0207690_10012989 3300025932 Bacteria 4993
107 Ga0207706_10362879 3300025933 Bacteria 1258
108 Ga0207686_10027148 3300025934 Bacteria 3350
109 Ga0207704_10001415 3300025938 Bacteria 10726
110 Ga0207711_10691778 3300025941 Bacteria 951
111 Ga0207661_10316256 3300025944 Bacteria 1403
112 Ga0207679_10211729 3300025945 Bacteria 1626
113 Ga0207667_11604146 3300025949 Bacteria 619
114 Ga0207712_11794015 3300025961 Bacteria 550
115 Ga0207668_10003586 3300025972 Bacteria 9121
116 Ga0207658_11313613 3300025986 Bacteria 661
117 Ga0207677_11134030 3300026023 Bacteria 714
118 Ga0207703_11024977 3300026035 Bacteria 792
119 Ga0207678_10626445 3300026067 Bacteria 944
120 Ga0207641_10017108 3300026088 Bacteria 5932
121 Ga0207641_10201027 3300026088 Bacteria 1837
122 Ga0207641_10635179 3300026088 Bacteria 1048
123 Ga0207676_10007835 3300026095 Bacteria 7595
124 Ga0207674_10000082 3300026116 Bacteria 101650
125 Ga0207683_10236092 3300026121 Bacteria 1668
126 Ga0207698_10700812 3300026142 Bacteria 1007
127 Ga0209281_1029076 3300027111 Bacteria 1000
128 Ga0268266_10136589 3300028379 Bacteria 2197
129 Ga0268265_10172128 3300028380 Bacteria 1852
130 Ga0268265_10240551 3300028380 Bacteria 1597
131 Ga0265326_10065964 3300028558 Bacteria 1023
132 Ga0265334_10011806 3300028573 Bacteria 3671
133 Ga0307515_10192568 3300028794 Bacteria 1943
134 Ga0265338_10069471 3300028800 Bacteria 3026
135 Ga0265338_10079624 3300028800 Bacteria 2756
136 Ga0265338_10265449 3300028800 Bacteria 1260
137 Ga0265327_10053836 3300031251 Bacteria 2086
138 Ga0265314_10231567 3300031711 Bacteria 1071
139 Ga0307406_10170079 3300031901 Bacteria 1576
140 Ga0307412_10068702 3300031911 Bacteria 2410
141 Ga0373936_0008405 3300035113 Bacteria 3886
142 Ga0373946_0186275 3300035171 Bacteria 987
143 Ga0373927_0000735 3300035695 Bacteria 24989
144 Ga0373927_0018228 3300035695 Bacteria 4614
145 Ga0373925_0000160 3300037068 Bacteria 72172
146 Ga0373925_0026161 3300037068 Bacteria 4268
147 Ga0395899_0915939 3300037312 Bacteria 534
148 Ga0395900_0200710 3300037418 Bacteria 2018
149 Ga0395905_0002477 3300037471 Bacteria 20432
150 Ga0436364_0138670 3300037853 Bacteria 601
151 Ga0395901_0021774 3300038443 Bacteria 6569
152 Ga0436365_0761047 3300039437 Bacteria 5873
153 Ga0439441_044292 3300042001 Bacteria 900
154 Ga0450890_087138 3300042127 Bacteria 515
155 Ga0495590_0004604 3300046457 Bacteria 5541
156 Ga0495638_0005198 3300046460 Bacteria 9729
157 Ga0495638_0006686 3300046460 Bacteria 8355
158 Ga0495638_0076762 3300046460 Bacteria 2035
159 Ga0495650_0000069 3300046471 Bacteria 261124
160 Ga0495650_0292669 3300046471 Bacteria 546
161 Ga0495606_0393319 3300046507 Bacteria 724
162 Ga0495610_0001211 3300046512 Bacteria 23221
163 Ga0495610_0003215 3300046512 Bacteria 12928
164 Ga0495620_0072570 3300046515 Bacteria 1405
165 Ga0495631_0000827 3300046518 Bacteria 19791
166 Ga0495637_0027620 3300046520 Bacteria 2537
167 Ga0495648_0168837 3300046524 Bacteria 1123
168 Ga0495654_0000024 3300046530 Bacteria 238195
169 Ga0495597_0268323 3300046542 Bacteria 667
170 Ga0495645_0783093 3300046543 Bacteria 573
171 Ga0495668_0000031 3300046616 Bacteria 256576
172 Ga0495668_0155559 3300046616 Bacteria 1252
173 Ga0495611_0304322 3300046648 Bacteria 735
174 Ga0495625_0004432 3300046660 Bacteria 13281
175 Ga0495625_0015845 3300046660 Bacteria 5950
176 Ga0495625_0087062 3300046660 Bacteria 2166
177 Ga0495671_0105229 3300046692 Bacteria 1378
178 Ga0495660_0050012 3300046810 Bacteria 2279
179 Ga0495672_0002995 3300047320 Bacteria 14857
180 Ga0495673_0001615 3300047469 Bacteria 17467
181 Ga0495681_0052613 3300047470 Bacteria 1909
182 Ga0495686_0001958 3300047472 Bacteria 20461
183 Ga0495686_0005770 3300047472 Bacteria 9672
184 Ga0496100_0270159 3300048903 Bacteria 1264
185 Ga0496102_0914325 3300048905 Bacteria 799
186 Ga0496104_0783659 3300048907 Bacteria 860
187 Ga0496106_1015317 3300048909 Bacteria 652
188 Ga0496108_0256920 3300048911 Bacteria 1520
189 Ga0496109_0050290 3300048912 Bacteria 3796
190 Ga0496111_0209252 3300048914 Bacteria 1449
191 Ga0496112_0282651 3300048915 Bacteria 1606
192 Ga0496113_0356880 3300048916 Bacteria 1173
193 Ga0496113_1518311 3300048916 Bacteria 517
194 Ga0496115_0942056 3300048918 Bacteria 663
195 Ga0496123_0368159 3300048926 Bacteria 663
196 Ga0496124_0369319 3300048927 Bacteria 1008
197 Ga0496125_0016301 3300048928 Bacteria 7141
198 Ga0496125_0186929 3300048928 Bacteria 1373
199 Ga0496126_0006322 3300048929 Bacteria 13223
200 Ga0496126_0472365 3300048929 Bacteria 1006
201 Ga0495678_001041 3300049459 Bacteria 23510
202 Ga0501034_0011712 3300049571 Bacteria 9072
203 Ga0501034_0055953 3300049571 Bacteria 3970
204 Ga0501037_0095694 3300049573 Bacteria 2146
205 Ga0501038_0227942 3300049574 Bacteria 1484
206 Ga0501043_0405044 3300049579 Bacteria 1030
207 Ga0501047_0135567 3300049581 Bacteria 2342
208 Ga0501068_0750349 3300049584 Bacteria 639
209 Ga0501073_0279964 3300049589 Bacteria 1151
210 Ga0501238_001934 3300049671 Bacteria 2425
211 Ga0501035_0046254 3300049822 Bacteria 3914
212 Ga0501044_0002366 3300049823 Bacteria 21482
213 Ga0501044_0082818 3300049823 Bacteria 3245
214 Ga0501044_1170580 3300049823 Bacteria 637
215 nmdc:mga03n38_472906_c1 3300050490 Bacteria 700
216 nmdc:mga0k408_158730_c1 3300050493 Bacteria 1347
217 nmdc:mga06z11_301217_c1 3300050494 Bacteria 953
218 nmdc:mga0sz30_15486_c1 3300050516 Bacteria 3014
219 nmdc:mga0sz30_422335_c1 3300050516 Bacteria 598
220 Ga0500643_008440 3300053087 Bacteria 4046
221 Ga0500641_0116945 3300053096 Bacteria 1148
222 Ga0500641_0286779 3300053096 Bacteria 680
223 Ga0500555_034694 3300053103 Bacteria 1420
224 Ga0500556_0001003 3300053104 Bacteria 14903
225 Ga0500562_000770 3300053108 Bacteria 7798
226 Ga0500594_0000456 3300053118 Bacteria 9009
227 Ga0500594_0298600 3300053118 Bacteria 540
228 Ga0500655_014144 3300053133 Bacteria 1459
229 Ga0500559_0123472 3300053136 Bacteria 1205
230 Ga0500577_0364730 3300053142 Bacteria 632
231 Ga0500616_0167006 3300053153 Bacteria 1003
232 Ga0500622_0001059 3300053156 Bacteria 22916
233 Ga0500622_0115728 3300053156 Bacteria 1305
234 Ga0500627_0052524 3300053158 Bacteria 1779
235 Ga0500627_0369123 3300053158 Bacteria 616
236 Ga0500645_013024 3300053730 Bacteria 2677
237 Ga0500645_086891 3300053730 Bacteria 889
238 Ga0501082_0039312 3300060353 Bacteria 4081

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0005770 Ga0495686_0005770_6408_6755 108
2 iso_pu_bacteria 2643221663 2644352466 111
3 iso_pu_bacteria 2643221545 2643749338 112
4 iso_pu_bacteria 2643221691 2644508888 112
5 3300001990 JGI24737J22298_10009433 JGI24737J22298_100094336 114
6 3300005331 Ga0070670_100062023 Ga0070670_1000620232 114
7 3300005339 Ga0070660_101690618 Ga0070660_1016906181 114
8 3300005355 Ga0070671_101069399 Ga0070671_1010693991 114
9 3300005366 Ga0070659_100012307 Ga0070659_1000123074 114
10 3300005577 Ga0068857_100091196 Ga0068857_1000911964 114
11 3300005841 Ga0068863_100118673 Ga0068863_1001186734 114
12 3300006946 Ga0079104_1006809 Ga0079104_10068095 114
13 3300009177 Ga0105248_10506469 Ga0105248_105064692 114
14 3300011119 Ga0105246_10024202 Ga0105246_100242028 114
15 3300013102 Ga0157371_10072013 Ga0157371_100720131 114
16 3300013307 Ga0157372_11205668 Ga0157372_112056682 114
17 3300014745 Ga0157377_11376284 Ga0157377_113762841 114
18 3300017792 Ga0163161_11026652 Ga0163161_110266521 114
19 3300025904 Ga0207647_10070444 Ga0207647_100704442 114
20 3300025919 Ga0207657_11416026 Ga0207657_114160261 114
21 3300025932 Ga0207690_10012989 Ga0207690_1001298910 114
22 3300026088 Ga0207641_10017108 Ga0207641_1001710810 114
23 3300026116 Ga0207674_10000082 Ga0207674_10000082120 114
24 3300026142 Ga0207698_10700812 Ga0207698_107008122 114
25 3300028380 Ga0268265_10240551 Ga0268265_102405512 114
26 3300042127 Ga0450890_087138 Ga0450890_087138_135_482 114
27 3300049571 Ga0501034_0011712 Ga0501034_0011712_4408_4755 114
28 3300049573 Ga0501037_0095694 Ga0501037_0095694_1344_1691 114
29 3300049574 Ga0501038_0227942 Ga0501038_0227942_931_1278 114
30 3300049823 Ga0501044_0002366 Ga0501044_0002366_19061_19408 114
31 3300053142 Ga0500577_0364730 Ga0500577_0364730_130_477 114
32 3300053153 Ga0500616_0167006 Ga0500616_0167006_269_649 114
33 3300001989 JGI24739J22299_10193557 JGI24739J22299_101935571 115
34 3300003316 rootH1_10072533 rootH1_100725332 115
35 3300003781 Ga0055536_1001505 Ga0055536_100150513 115
36 3300003781 Ga0055536_1002538 Ga0055536_10025384 115
37 3300003791 Ga0055530_10003215 Ga0055530_1000321510 115
38 3300003791 Ga0055530_10015673 Ga0055530_100156733 115
39 3300003794 Ga0055531_10000786 Ga0055531_1000078613 115
40 3300003794 Ga0055531_10002024 Ga0055531_100020243 115
41 3300005262 Ga0065165_1000749 Ga0065165_100074927 115
42 3300005262 Ga0065165_1046557 Ga0065165_10465572 115
43 3300005290 Ga0065712_10792173 Ga0065712_107921731 115
44 3300005327 Ga0070658_10089483 Ga0070658_100894831 115
45 3300005329 Ga0070683_100863370 Ga0070683_1008633701 115
46 3300005330 Ga0070690_101287659 Ga0070690_1012876592 115
47 3300005331 Ga0070670_100124536 Ga0070670_1001245364 115
48 3300005338 Ga0068868_100642691 Ga0068868_1006426912 115
49 3300005344 Ga0070661_100334703 Ga0070661_1003347033 115
50 3300005347 Ga0070668_100024435 Ga0070668_1000244354 115
51 3300005355 Ga0070671_100212265 Ga0070671_1002122652 115
52 3300005355 Ga0070671_100386975 Ga0070671_1003869753 115
53 3300005364 Ga0070673_100514747 Ga0070673_1005147472 115
54 3300005455 Ga0070663_100373446 Ga0070663_1003734461 115
55 3300005456 Ga0070678_100064343 Ga0070678_1000643432 115
56 3300005457 Ga0070662_100103196 Ga0070662_1001031962 115
57 3300005459 Ga0068867_101663857 Ga0068867_1016638571 115
58 3300005535 Ga0070684_101101703 Ga0070684_1011017032 115
59 3300005539 Ga0068853_100587871 Ga0068853_1005878712 115
60 3300005544 Ga0070686_100000526 Ga0070686_10000052624 115
61 3300005548 Ga0070665_101383810 Ga0070665_1013838102 115
62 3300005564 Ga0070664_100169176 Ga0070664_1001691763 115
63 3300005617 Ga0068859_102532319 Ga0068859_1025323192 115
64 3300005618 Ga0068864_100010466 Ga0068864_1000104663 115
65 3300005841 Ga0068863_100135812 Ga0068863_1001358124 115
66 3300005841 Ga0068863_101890281 Ga0068863_1018902812 115
67 3300005842 Ga0068858_101157370 Ga0068858_1011573702 115
68 3300006028 Ga0070717_11604300 Ga0070717_116043001 115
69 3300006038 Ga0075365_10659078 Ga0075365_106590782 115
70 3300006178 Ga0075367_10692615 Ga0075367_106926151 115
71 3300006186 Ga0075369_10020326 Ga0075369_100203263 115
72 3300006186 Ga0075369_10216014 Ga0075369_102160142 115
73 3300006195 Ga0075366_10160777 Ga0075366_101607773 115
74 3300006353 Ga0075370_10233794 Ga0075370_102337941 115
75 3300006358 Ga0068871_100286993 Ga0068871_1002869933 115
76 3300006881 Ga0068865_100042631 Ga0068865_1000426315 115
77 3300006931 Ga0097620_102532907 Ga0097620_1025329071 115
78 3300009093 Ga0105240_10526028 Ga0105240_105260282 115
79 3300009176 Ga0105242_10148097 Ga0105242_101480974 115
80 3300009177 Ga0105248_10040919 Ga0105248_100409194 115
81 3300009177 Ga0105248_10806134 Ga0105248_108061342 115
82 3300009551 Ga0105238_13000923 Ga0105238_130009231 115
83 3300013296 Ga0157374_12914029 Ga0157374_129140291 115
84 3300013297 Ga0157378_10824652 Ga0157378_108246522 115
85 3300013306 Ga0163162_10116662 Ga0163162_101166622 115
86 3300013306 Ga0163162_12087849 Ga0163162_120878492 115
87 3300013308 Ga0157375_10077586 Ga0157375_100775863 115
88 3300013308 Ga0157375_10382308 Ga0157375_103823081 115
89 3300013308 Ga0157375_11464092 Ga0157375_114640922 115
90 3300014325 Ga0163163_10040546 Ga0163163_100405462 115
91 3300014325 Ga0163163_11420028 Ga0163163_114200282 115
92 3300014745 Ga0157377_10464344 Ga0157377_104643442 115
93 3300014968 Ga0157379_10538824 Ga0157379_105388243 115
94 3300017792 Ga0163161_11053930 Ga0163161_110539301 115
95 3300021384 Ga0213876_10133439 Ga0213876_101334391 115
96 3300025250 Ga0209026_1011694 Ga0209026_10116942 115
97 3300025273 Ga0209673_1050964 Ga0209673_10509642 115
98 3300025292 Ga0209676_1000099 Ga0209676_1000099199 115
99 3300025292 Ga0209676_1000150 Ga0209676_100015088 115
100 3300025295 Ga0209564_1001613 Ga0209564_100161322 115
101 3300025297 Ga0209758_1001753 Ga0209758_100175323 115
102 3300025298 Ga0209050_1000249 Ga0209050_100024924 115
103 3300025298 Ga0209050_1001509 Ga0209050_100150914 115
104 3300025303 Ga0209051_1003855 Ga0209051_100385511 115
105 3300025304 Ga0209257_1000203 Ga0209257_10002039 115
106 3300025304 Ga0209257_1001466 Ga0209257_100146621 115
107 3300025304 Ga0209257_1004337 Ga0209257_10043374 115
108 3300025903 Ga0207680_10356999 Ga0207680_103569992 115
109 3300025904 Ga0207647_10352676 Ga0207647_103526762 115
110 3300025908 Ga0207643_10028166 Ga0207643_100281666 115
111 3300025909 Ga0207705_10279062 Ga0207705_102790623 115
112 3300025913 Ga0207695_10913845 Ga0207695_109138451 115
113 3300025919 Ga0207657_10078742 Ga0207657_100787422 115
114 3300025920 Ga0207649_10446356 Ga0207649_104463561 115
115 3300025921 Ga0207652_11155779 Ga0207652_111557792 115
116 3300025923 Ga0207681_10148269 Ga0207681_101482692 115
117 3300025924 Ga0207694_10827988 Ga0207694_108279881 115
118 3300025925 Ga0207650_10097514 Ga0207650_100975143 115
119 3300025925 Ga0207650_10447884 Ga0207650_104478842 115
120 3300025931 Ga0207644_10101968 Ga0207644_101019684 115
121 3300025931 Ga0207644_10176177 Ga0207644_101761772 115
122 3300025933 Ga0207706_10362879 Ga0207706_103628792 115
123 3300025934 Ga0207686_10027148 Ga0207686_100271482 115
124 3300025938 Ga0207704_10001415 Ga0207704_100014153 115
125 3300025941 Ga0207711_10691778 Ga0207711_106917782 115
126 3300025944 Ga0207661_10316256 Ga0207661_103162562 115
127 3300025945 Ga0207679_10211729 Ga0207679_102117292 115
128 3300025949 Ga0207667_11604146 Ga0207667_116041462 115
129 3300025961 Ga0207712_11794015 Ga0207712_117940151 115
130 3300025972 Ga0207668_10003586 Ga0207668_100035865 115
131 3300025986 Ga0207658_11313613 Ga0207658_113136131 115
132 3300026023 Ga0207677_11134030 Ga0207677_111340302 115
133 3300026035 Ga0207703_11024977 Ga0207703_110249772 115
134 3300026067 Ga0207678_10626445 Ga0207678_106264452 115
135 3300026088 Ga0207641_10201027 Ga0207641_102010272 115
136 3300026088 Ga0207641_10635179 Ga0207641_106351792 115
137 3300026095 Ga0207676_10007835 Ga0207676_100078353 115
138 3300026121 Ga0207683_10236092 Ga0207683_102360923 115
139 3300027111 Ga0209281_1029076 Ga0209281_10290762 115
140 3300028379 Ga0268266_10136589 Ga0268266_101365894 115
141 3300028380 Ga0268265_10172128 Ga0268265_101721284 115
142 3300028558 Ga0265326_10065964 Ga0265326_100659642 115
143 3300028573 Ga0265334_10011806 Ga0265334_100118063 115
144 3300028794 Ga0307515_10192568 Ga0307515_101925683 115
145 3300028800 Ga0265338_10069471 Ga0265338_100694715 115
146 3300028800 Ga0265338_10079624 Ga0265338_100796242 115
147 3300028800 Ga0265338_10265449 Ga0265338_102654493 115
148 3300031251 Ga0265327_10053836 Ga0265327_100538362 115
149 3300031711 Ga0265314_10231567 Ga0265314_102315672 115
150 3300031901 Ga0307406_10170079 Ga0307406_101700792 115
151 3300031911 Ga0307412_10068702 Ga0307412_100687023 115
152 3300035113 Ga0373936_0008405 Ga0373936_0008405_438_827 115
153 3300035171 Ga0373946_0186275 Ga0373946_0186275_255_611 115
154 3300035695 Ga0373927_0000735 Ga0373927_0000735_12015_12365 115
155 3300035695 Ga0373927_0018228 Ga0373927_0018228_695_1051 115
156 3300037068 Ga0373925_0000160 Ga0373925_0000160_2650_3006 115
157 3300037068 Ga0373925_0026161 Ga0373925_0026161_2139_2489 115
158 3300037312 Ga0395899_0915939 Ga0395899_0915939_95_442 115
159 3300037418 Ga0395900_0200710 Ga0395900_0200710_32_379 115
160 3300037471 Ga0395905_0002477 Ga0395905_0002477_4099_4446 115
161 3300037853 Ga0436364_0138670 Ga0436364_0138670_68_421 115
162 3300038443 Ga0395901_0021774 Ga0395901_0021774_1296_1643 115
163 3300039437 Ga0436365_0761047 Ga0436365_0761047_1280_1660 115
164 3300042001 Ga0439441_044292 Ga0439441_044292_171_521 115
165 3300046457 Ga0495590_0004604 Ga0495590_0004604_4127_4477 115
166 3300046460 Ga0495638_0005198 Ga0495638_0005198_9260_9667 115
167 3300046460 Ga0495638_0006686 Ga0495638_0006686_4504_4854 115
168 3300046460 Ga0495638_0076762 Ga0495638_0076762_1493_1843 115
169 3300046471 Ga0495650_0000069 Ga0495650_0000069_54563_54931 115
170 3300046471 Ga0495650_0292669 Ga0495650_0292669_68_418 115
171 3300046507 Ga0495606_0393319 Ga0495606_0393319_173_526 115
172 3300046512 Ga0495610_0001211 Ga0495610_0001211_10873_11280 115
173 3300046512 Ga0495610_0003215 Ga0495610_0003215_9541_9891 115
174 3300046515 Ga0495620_0072570 Ga0495620_0072570_156_521 115
175 3300046518 Ga0495631_0000827 Ga0495631_0000827_7448_7798 115
176 3300046520 Ga0495637_0027620 Ga0495637_0027620_88_450 115
177 3300046524 Ga0495648_0168837 Ga0495648_0168837_111_479 115
178 3300046530 Ga0495654_0000024 Ga0495654_0000024_66720_67088 115
179 3300046542 Ga0495597_0268323 Ga0495597_0268323_280_630 115
180 3300046543 Ga0495645_0783093 Ga0495645_0783093_142_495 115
181 3300046616 Ga0495668_0000031 Ga0495668_0000031_44914_45273 115
182 3300046616 Ga0495668_0155559 Ga0495668_0155559_234_581 115
183 3300046648 Ga0495611_0304322 Ga0495611_0304322_115_483 115
184 3300046660 Ga0495625_0004432 Ga0495625_0004432_11081_11488 115
185 3300046660 Ga0495625_0015845 Ga0495625_0015845_2014_2382 115
186 3300046660 Ga0495625_0087062 Ga0495625_0087062_1516_1866 115
187 3300046692 Ga0495671_0105229 Ga0495671_0105229_352_702 115
188 3300046810 Ga0495660_0050012 Ga0495660_0050012_503_853 115
189 3300047320 Ga0495672_0002995 Ga0495672_0002995_11799_12212 115
190 3300047469 Ga0495673_0001615 Ga0495673_0001615_16183_16536 115
191 3300047470 Ga0495681_0052613 Ga0495681_0052613_1011_1379 115
192 3300047472 Ga0495686_0001958 Ga0495686_0001958_16059_16409 115
193 3300048903 Ga0496100_0270159 Ga0496100_0270159_507_857 115
194 3300048905 Ga0496102_0914325 Ga0496102_0914325_248_598 115
195 3300048907 Ga0496104_0783659 Ga0496104_0783659_432_782 115
196 3300048909 Ga0496106_1015317 Ga0496106_1015317_244_594 115
197 3300048911 Ga0496108_0256920 Ga0496108_0256920_330_680 115
198 3300048912 Ga0496109_0050290 Ga0496109_0050290_3314_3664 115
199 3300048914 Ga0496111_0209252 Ga0496111_0209252_239_589 115
200 3300048915 Ga0496112_0282651 Ga0496112_0282651_982_1332 115
201 3300048916 Ga0496113_0356880 Ga0496113_0356880_236_586 115
202 3300048916 Ga0496113_1518311 Ga0496113_1518311_40_390 115
203 3300048918 Ga0496115_0942056 Ga0496115_0942056_33_383 115
204 3300048926 Ga0496123_0368159 Ga0496123_0368159_122_535 115
205 3300048927 Ga0496124_0369319 Ga0496124_0369319_84_434 115
206 3300048928 Ga0496125_0016301 Ga0496125_0016301_2796_3146 115
207 3300048928 Ga0496125_0186929 Ga0496125_0186929_769_1128 115
208 3300048929 Ga0496126_0006322 Ga0496126_0006322_979_1329 115
209 3300048929 Ga0496126_0472365 Ga0496126_0472365_460_816 115
210 3300049459 Ga0495678_001041 Ga0495678_001041_9635_9985 115
211 3300049571 Ga0501034_0055953 Ga0501034_0055953_478_900 115
212 3300049579 Ga0501043_0405044 Ga0501043_0405044_301_723 115
213 3300049581 Ga0501047_0135567 Ga0501047_0135567_1860_2282 115
214 3300049584 Ga0501068_0750349 Ga0501068_0750349_245_595 115
215 3300049589 Ga0501073_0279964 Ga0501073_0279964_562_984 115
216 3300049671 Ga0501238_001934 Ga0501238_001934_1714_2064 115
217 3300049822 Ga0501035_0046254 Ga0501035_0046254_2953_3375 115
218 3300049823 Ga0501044_0082818 Ga0501044_0082818_2310_2732 115
219 3300049823 Ga0501044_1170580 Ga0501044_1170580_129_482 115
220 3300050490 nmdc:mga03n38_472906_c1 nmdc:mga03n38_472906_c1_65_418 115
221 3300050493 nmdc:mga0k408_158730_c1 nmdc:mga0k408_158730_c1_160_516 115
222 3300050494 nmdc:mga06z11_301217_c1 nmdc:mga06z11_301217_c1_410_766 115
223 3300050516 nmdc:mga0sz30_15486_c1 nmdc:mga0sz30_15486_c1_1431_1781 115
224 3300050516 nmdc:mga0sz30_422335_c1 nmdc:mga0sz30_422335_c1_122_472 115
225 3300053087 Ga0500643_008440 Ga0500643_008440_2082_2513 115
226 3300053096 Ga0500641_0116945 Ga0500641_0116945_640_1005 115
227 3300053096 Ga0500641_0286779 Ga0500641_0286779_304_654 115
228 3300053103 Ga0500555_034694 Ga0500555_034694_792_1160 115
229 3300053104 Ga0500556_0001003 Ga0500556_0001003_11186_11587 115
230 3300053108 Ga0500562_000770 Ga0500562_000770_5036_5386 115
231 3300053118 Ga0500594_0000456 Ga0500594_0000456_5281_5631 115
232 3300053118 Ga0500594_0298600 Ga0500594_0298600_145_510 115
233 3300053133 Ga0500655_014144 Ga0500655_014144_1048_1398 115
234 3300053136 Ga0500559_0123472 Ga0500559_0123472_304_657 115
235 3300053156 Ga0500622_0001059 Ga0500622_0001059_17748_18098 115
236 3300053156 Ga0500622_0115728 Ga0500622_0115728_724_1074 115
237 3300053158 Ga0500627_0052524 Ga0500627_0052524_1230_1598 115
238 3300053158 Ga0500627_0369123 Ga0500627_0369123_141_491 115
239 3300053730 Ga0500645_013024 Ga0500645_013024_2180_2542 115
240 3300053730 Ga0500645_086891 Ga0500645_086891_461_811 115
241 3300060353 Ga0501082_0039312 Ga0501082_0039312_1664_2014 115
242 iso_pu_bacteria 2932401849 2932405365 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

23

133

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.932 1 114
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9168 1 114
2r63-assembly1.cif.gz_A structural role of a buried salt bridge in the 434 repressor dna-binding domain, nmr, 20 structures 0.3964 13 107
2r63-assembly1.cif.gz_A structural role of a buried salt bridge in the 434 repressor dna-binding domain, nmr, 20 structures 0.3902 13 107
6p0d-assembly1.cif.gz_A human dna ligase 1 (e346a/e592a) bound to an adenylated, hydroxyl terminated dna nick 0.3749 28 114
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9398 4 114 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8857 4 114 1.10.8.290
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.796 8 114 1.10.8.10
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7924 8 114 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7651 8 114 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A1W6VMU7-F1-model_v4 deleted 1.006 32 115
AF-A0A4R9K0F8-F1-model_v4 DUF2200 family protein 1.004 2 115
AF-A0A7Y7HHU7-F1-model_v4 deleted 1.003 3 115
AF-S0K083-F1-model_v4 DUF2200 domain-containing protein 1.002 4 115
AF-A0A6B3C8S0-F1-model_v4 DUF2200 domain-containing protein 1.002 2 104

Feature Viewer

pLDDT pTM Quality
94.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map