F354945

General Info

Members Datasets Scaffolds Average Seq Length
242 129 484 175

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0294204|Ga0495653_0294204_19_621
Length 200
Sequence MNRKLRSTILEGVKCIKIMQYRGEIMNLWKSSWLFGIFLVLIVIPSEAQVASPRARTTCKYTDGKTITVNYSSPRMRGRKIFGDLVPFGEVWRTGADEATSFVPNTDLTIGGKNVPAGKYTLFTLPNPTKWTLIISKQTGEWGIPYPGPQFDFARMEMKIAKLPSPFENFTISFDQTGNNCTMKLDWETTHASIEISEKR

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
46 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
47 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
48 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
109 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
118 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.21
Metatranscriptomes 5.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 2.48
Rhizosphere 97.11
Stem 0
Stem Tuber 0
Unclassified 23.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0294204 3300046463 Unclassified 1061
2 LJNas_1001102 3300000546 Bacteria 4168
3 Ga0058863_11691799 3300004799 Bacteria 727
4 Ga0058861_10828347 3300004800 Bacteria 679
5 Ga0058862_12208205 3300004803 Bacteria 675
6 Ga0070680_100094256 3300005336 Bacteria 2481
7 Ga0070709_10026557 3300005434 Unclassified 3433
8 Ga0070709_10065593 3300005434 Bacteria 2325
9 Ga0070709_10085277 3300005434 Unclassified 2071
10 Ga0070709_10874691 3300005434 Bacteria 709
11 Ga0070714_100018865 3300005435 Bacteria 5611
12 Ga0070714_100122731 3300005435 Unclassified 2312
13 Ga0070714_100764718 3300005435 Bacteria 934
14 Ga0070713_100001789 3300005436 Bacteria 13855
15 Ga0070713_100064637 3300005436 Bacteria 3071
16 Ga0070713_100145712 3300005436 Bacteria 2102
17 Ga0070713_100148122 3300005436 Unclassified 2085
18 Ga0070713_100189848 3300005436 Unclassified 1851
19 Ga0070713_100448357 3300005436 Bacteria 1211
20 Ga0070713_100574457 3300005436 Bacteria 1069
21 Ga0070710_10010100 3300005437 Bacteria 4632
22 Ga0070710_10053761 3300005437 Bacteria 2270
23 Ga0070710_10140897 3300005437 Archaea 1479
24 Ga0070711_100000124 3300005439 Bacteria 40990
25 Ga0070711_100100756 3300005439 Bacteria 2101
26 Ga0070711_101040311 3300005439 Unclassified 704
27 Ga0070708_100005272 3300005445 Bacteria 10237
28 Ga0070708_100011920 3300005445 Bacteria 7082
29 Ga0070708_100030585 3300005445 Unclassified 4655
30 Ga0070681_10001704 3300005458 Bacteria 19679
31 Ga0070706_100008435 3300005467 Bacteria 9597
32 Ga0070706_100046949 3300005467 Unclassified 3985
33 Ga0070706_100341150 3300005467 Bacteria 1397
34 Ga0070706_100830653 3300005467 Unclassified 855
35 Ga0070707_100006396 3300005468 Bacteria 10954
36 Ga0070707_100088480 3300005468 Bacteria 2996
37 Ga0070698_100030569 3300005471 Bacteria 5583
38 Ga0070698_100034505 3300005471 Bacteria 5235
39 Ga0070698_100081730 3300005471 Bacteria 3224
40 Ga0070698_100571816 3300005471 Bacteria 1070
41 Ga0070699_100008229 3300005518 Bacteria 9047
42 Ga0070699_100010202 3300005518 Bacteria 8124
43 Ga0070699_100031425 3300005518 Bacteria 4584
44 Ga0070699_100046330 3300005518 Bacteria 3762
45 Ga0070699_100324289 3300005518 Bacteria 1385
46 Ga0070684_100457708 3300005535 Bacteria 1180
47 Ga0070697_100000467 3300005536 Bacteria 30923
48 Ga0070697_100005699 3300005536 Bacteria 9594
49 Ga0070697_100071398 3300005536 Bacteria 2847
50 Ga0070697_100083679 3300005536 Bacteria 2631
51 Ga0068855_100316170 3300005563 Bacteria 1727
52 Ga0068857_100565889 3300005577 Bacteria 1072
53 Ga0068856_100203701 3300005614 Bacteria 1993
54 Ga0068856_100887716 3300005614 Bacteria 910
55 Ga0070717_10002965 3300006028 Bacteria 12066
56 Ga0070717_10003272 3300006028 Bacteria 11587
57 Ga0070717_10063095 3300006028 Bacteria 3074
58 Ga0070717_10080022 3300006028 Bacteria 2741
59 Ga0070717_10090796 3300006028 Bacteria 2578
60 Ga0070717_10127726 3300006028 Bacteria 2184
61 Ga0070717_10254393 3300006028 Bacteria 1552
62 Ga0070717_10265431 3300006028 Unclassified 1519
63 Ga0070717_10738001 3300006028 Unclassified 895
64 Ga0070715_10004919 3300006163 Bacteria 4427
65 Ga0070715_10336331 3300006163 Unclassified 820
66 Ga0070715_10639228 3300006163 Unclassified 628
67 Ga0070716_100009963 3300006173 Bacteria 4753
68 Ga0070716_100937635 3300006173 Unclassified 680
69 Ga0070712_100000916 3300006175 Bacteria 17684
70 Ga0070712_100001074 3300006175 Bacteria 16499
71 Ga0070712_100148681 3300006175 Unclassified 1796
72 Ga0070712_100252430 3300006175 Unclassified 1410
73 Ga0070712_100679277 3300006175 Unclassified 877
74 Ga0075434_100192992 3300006871 Bacteria 2057
75 Ga0075436_100065181 3300006914 Bacteria 2518
76 Ga0075436_100571713 3300006914 Unclassified 831
77 Ga0075435_100026555 3300007076 Bacteria 4520
78 Ga0099794_10004775 3300007265 Bacteria 5373
79 Ga0105240_10051042 3300009093 Bacteria 5208
80 Ga0105240_10903556 3300009093 Unclassified 950
81 Ga0105245_10044643 3300009098 Bacteria 3957
82 Ga0105247_10166437 3300009101 Bacteria 1463
83 Ga0105241_10314885 3300009174 Bacteria 1347
84 Ga0105237_10186324 3300009545 Bacteria 2075
85 Ga0099796_10128818 3300010159 Unclassified 979
86 Ga0105246_10864770 3300011119 Unclassified 808
87 Ga0157374_10027682 3300013296 Bacteria 5117
88 Ga0157374_10745881 3300013296 Bacteria 994
89 Ga0157378_10035749 3300013297 Unclassified 4396
90 Ga0157372_10018497 3300013307 Bacteria 7491
91 Ga0182007_10181602 3300015262 Unclassified 728
92 Ga0182005_1112040 3300015265 Unclassified 771
93 Ga0184592_109848 3300019177 Bacteria 1055
94 Ga0206356_11899834 3300020070 Bacteria 644
95 Ga0224569_100200 3300022732 Bacteria 4923
96 Ga0224571_101443 3300022734 Bacteria 1488
97 Ga0224572_1071383 3300024225 Bacteria 641
98 Ga0228598_1004963 3300024227 Bacteria 2800
99 Ga0207692_10018926 3300025898 Unclassified 3101
100 Ga0207692_10022502 3300025898 Bacteria 2901
101 Ga0207692_10036298 3300025898 Bacteria 2402
102 Ga0207685_10009240 3300025905 Bacteria 2854
103 Ga0207699_10000189 3300025906 Bacteria 37481
104 Ga0207699_10007483 3300025906 Bacteria 5342
105 Ga0207699_10021088 3300025906 Unclassified 3505
106 Ga0207699_10828185 3300025906 Bacteria 681
107 Ga0207699_10943616 3300025906 Bacteria 637
108 Ga0207684_10000859 3300025910 Bacteria 34855
109 Ga0207684_10009618 3300025910 Bacteria 8527
110 Ga0207695_10153417 3300025913 Bacteria 2240
111 Ga0207695_10764649 3300025913 Unclassified 846
112 Ga0207671_10092367 3300025914 Bacteria 2282
113 Ga0207693_10000077 3300025915 Bacteria 87615
114 Ga0207693_10000210 3300025915 Bacteria 53555
115 Ga0207693_10017069 3300025915 Bacteria 5794
116 Ga0207693_11021675 3300025915 Bacteria 630
117 Ga0207663_10001080 3300025916 Bacteria 12502
118 Ga0207663_10076269 3300025916 Bacteria 2178
119 Ga0207660_10186172 3300025917 Bacteria 1615
120 Ga0207646_10003441 3300025922 Bacteria 17872
121 Ga0207646_10009018 3300025922 Bacteria 9913
122 Ga0207646_10058285 3300025922 Bacteria 3448
123 Ga0207694_10393554 3300025924 Bacteria 1152
124 Ga0207687_10010974 3300025927 Bacteria 5920
125 Ga0207700_10000111 3300025928 Bacteria 48784
126 Ga0207700_10000385 3300025928 Bacteria 25704
127 Ga0207700_10011766 3300025928 Bacteria 5599
128 Ga0207700_10123459 3300025928 Bacteria 2103
129 Ga0207700_10267484 3300025928 Unclassified 1466
130 Ga0207700_10341809 3300025928 Unclassified 1301
131 Ga0207700_10458926 3300025928 Bacteria 1124
132 Ga0207664_10308818 3300025929 Unclassified 1393
133 Ga0207664_10372172 3300025929 Bacteria 1267
134 Ga0207665_10016679 3300025939 Bacteria 4825
135 Ga0207665_10081185 3300025939 Bacteria 2232
136 Ga0207665_10120413 3300025939 Bacteria 1853
137 Ga0207665_10277570 3300025939 Unclassified 1246
138 Ga0207679_10080082 3300025945 Bacteria 2493
139 Ga0207667_10245890 3300025949 Bacteria 1830
140 Ga0207702_10028786 3300026078 Bacteria 4620
141 Ga0209588_1001563 3300027671 Bacteria 6023
142 Ga0265355_1002620 3300028036 Bacteria 1268
143 Ga0265338_10006033 3300028800 Bacteria 15560
144 Ga0265338_10074405 3300028800 Bacteria 2890
145 Ga0265762_1011995 3300030760 Bacteria 1551
146 Ga0265762_1012400 3300030760 Unclassified 1528
147 Ga0265763_1005554 3300030763 Unclassified 1061
148 Ga0265770_1026283 3300030878 Bacteria 952
149 Ga0265765_1001412 3300030879 Bacteria 2192
150 Ga0265760_10002153 3300031090 Bacteria 5764
151 Ga0265760_10016904 3300031090 Bacteria 2094
152 Ga0265760_10051010 3300031090 Bacteria 1246
153 Ga0265760_10057625 3300031090 Bacteria 1177
154 Ga0265325_10101130 3300031241 Unclassified 1411
155 Ga0265325_10189910 3300031241 Unclassified 952
156 Ga0265325_10229029 3300031241 Bacteria 848
157 Ga0265339_10052313 3300031249 Bacteria 2225
158 Ga0265339_10094085 3300031249 Bacteria 1567
159 Ga0265331_10053557 3300031250 Bacteria 1924
160 Ga0265316_10060990 3300031344 Bacteria 2930
161 Ga0265316_10137694 3300031344 Bacteria 1836
162 Ga0265313_10026774 3300031595 Bacteria 3031
163 Ga0265314_10018071 3300031711 Bacteria 5511
164 Ga0373934_0017474 3300035086 Bacteria 2738
165 Ga0373934_0021232 3300035086 Bacteria 2501
166 Ga0373945_0106728 3300035116 Unclassified 1101
167 Ga0373954_0028367 3300035118 Unclassified 2573
168 Ga0373954_0556400 3300035118 Unclassified 568
169 Ga0373956_0009848 3300035119 Bacteria 3893
170 Ga0373956_0019040 3300035119 Bacteria 2908
171 Ga0373956_0307367 3300035119 Unclassified 755
172 Ga0373943_0041774 3300035170 Bacteria 2219
173 Ga0373943_0368431 3300035170 Unclassified 825
174 Ga0373946_0202092 3300035171 Bacteria 952
175 Ga0373955_0014294 3300035172 Bacteria 3858
176 Ga0373955_0043304 3300035172 Bacteria 2421
177 Ga0373955_0521117 3300035172 Bacteria 726
178 Ga0373924_0195071 3300035410 Bacteria 892
179 Ga0373935_0084717 3300035692 Bacteria 2065
180 Ga0373935_0382807 3300035692 Unclassified 1008
181 Ga0373927_0099112 3300035695 Bacteria 1895
182 Ga0373933_0001961 3300035724 Bacteria 11873
183 Ga0373933_0005381 3300035724 Bacteria 6970
184 Ga0373933_0250179 3300035724 Bacteria 1141
185 Ga0373933_0331711 3300035724 Bacteria 987
186 Ga0373947_0053264 3300035725 Bacteria 2439
187 Ga0373937_0000170 3300036401 Bacteria 63587
188 Ga0373937_0029784 3300036401 Bacteria 4944
189 Ga0373937_0257379 3300036401 Unclassified 1646
190 Ga0373937_0491024 3300036401 Unclassified 1166
191 Ga0373925_0005107 3300037068 Bacteria 9826
192 Ga0373925_0140540 3300037068 Bacteria 1889
193 Ga0495629_0035309 3300046459 Bacteria 3533
194 Ga0495651_0002008 3300046462 Bacteria 15709
195 Ga0495580_0000232 3300046472 Bacteria 43742
196 Ga0495580_0008222 3300046472 Bacteria 8302
197 Ga0495582_0001190 3300046473 Bacteria 14658
198 Ga0495608_0029590 3300046511 Bacteria 3714
199 Ga0495628_0025021 3300046516 Unclassified 4880
200 Ga0495628_0243816 3300046516 Bacteria 1344
201 Ga0495628_0301455 3300046516 Unclassified 1186
202 Ga0495630_0102785 3300046517 Bacteria 2162
203 Ga0495630_0315887 3300046517 Bacteria 1194
204 Ga0495630_0936137 3300046517 Unclassified 659
205 Ga0495652_0075520 3300046529 Bacteria 2799
206 Ga0495640_0085511 3300046533 Bacteria 2090
207 Ga0495587_0000292 3300046536 Bacteria 35533
208 Ga0495667_0726669 3300046559 Unclassified 614
209 Ga0495657_0027886 3300046675 Bacteria 3977
210 Ga0495599_0379969 3300046678 Bacteria 843
211 Ga0495623_0099043 3300046679 Bacteria 1778
212 Ga0495623_0116727 3300046679 Bacteria 1612
213 Ga0495646_0038890 3300046680 Unclassified 2935
214 Ga0495658_0046799 3300046683 Bacteria 2433
215 Ga0495624_0163509 3300046690 Unclassified 1359
216 Ga0495581_0122914 3300047315 Bacteria 1511
217 Ga0495604_0015361 3300047317 Bacteria 6110
218 Ga0495604_0052267 3300047317 Bacteria 3165
219 Ga0495674_0010742 3300047319 Bacteria 8661
220 Ga0495674_0128642 3300047319 Bacteria 2135
221 Ga0495674_0741806 3300047319 Unclassified 768
222 Ga0495676_0640642 3300047321 Bacteria 690
223 Ga0495680_0186694 3300047322 Bacteria 1493
224 Ga0495683_0178530 3300047323 Unclassified 971
225 Ga0495675_0013513 3300047444 Bacteria 5155
226 Ga0495675_0322071 3300047444 Unclassified 914
227 Ga0495684_0005485 3300047471 Bacteria 9873
228 Ga0495684_0456255 3300047471 Unclassified 887
229 Ga0495684_0774184 3300047471 Unclassified 629
230 Ga0495602_0000456 3300048088 Bacteria 38089
231 Ga0495602_0101973 3300048088 Bacteria 2353
232 Ga0496100_0034603 3300048903 Bacteria 3172
233 Ga0496112_0178419 3300048915 Bacteria 2088
234 Ga0496112_0612884 3300048915 Unclassified 1020
235 Ga0496114_0192668 3300048917 Unclassified 1784
236 Ga0496115_0010046 3300048918 Bacteria 7055
237 Ga0496115_0053470 3300048918 Bacteria 3241
238 nmdc:mga0n895_52630_c1 3300050512 Bacteria 3997
239 nmdc:mga08x19_55553_c1 3300050514 Bacteria 2552
240 Ga0495612_0186188 3300053078 Bacteria 913
241 Ga0495595_0511594 3300053084 Bacteria 612
242 Ga0500595_075590 3300053119 Unclassified 993
243 Ga0495653_0294204
244 LJNas_1001102
245 Ga0058863_11691799
246 Ga0058861_10828347
247 Ga0058862_12208205
248 Ga0070680_100094256
249 Ga0070709_10026557
250 Ga0070709_10065593
251 Ga0070709_10085277
252 Ga0070709_10874691
253 Ga0070714_100018865
254 Ga0070714_100122731
255 Ga0070714_100764718
256 Ga0070713_100001789
257 Ga0070713_100064637
258 Ga0070713_100145712
259 Ga0070713_100148122
260 Ga0070713_100189848
261 Ga0070713_100448357
262 Ga0070713_100574457
263 Ga0070710_10010100
264 Ga0070710_10053761
265 Ga0070710_10140897
266 Ga0070711_100000124
267 Ga0070711_100100756
268 Ga0070711_101040311
269 Ga0070708_100005272
270 Ga0070708_100011920
271 Ga0070708_100030585
272 Ga0070681_10001704
273 Ga0070706_100008435
274 Ga0070706_100046949
275 Ga0070706_100341150
276 Ga0070706_100830653
277 Ga0070707_100006396
278 Ga0070707_100088480
279 Ga0070698_100030569
280 Ga0070698_100034505
281 Ga0070698_100081730
282 Ga0070698_100571816
283 Ga0070699_100008229
284 Ga0070699_100010202
285 Ga0070699_100031425
286 Ga0070699_100046330
287 Ga0070699_100324289
288 Ga0070684_100457708
289 Ga0070697_100000467
290 Ga0070697_100005699
291 Ga0070697_100071398
292 Ga0070697_100083679
293 Ga0068855_100316170
294 Ga0068857_100565889
295 Ga0068856_100203701
296 Ga0068856_100887716
297 Ga0070717_10002965
298 Ga0070717_10003272
299 Ga0070717_10063095
300 Ga0070717_10080022
301 Ga0070717_10090796
302 Ga0070717_10127726
303 Ga0070717_10254393
304 Ga0070717_10265431
305 Ga0070717_10738001
306 Ga0070715_10004919
307 Ga0070715_10336331
308 Ga0070715_10639228
309 Ga0070716_100009963
310 Ga0070716_100937635
311 Ga0070712_100000916
312 Ga0070712_100001074
313 Ga0070712_100148681
314 Ga0070712_100252430
315 Ga0070712_100679277
316 Ga0075434_100192992
317 Ga0075436_100065181
318 Ga0075436_100571713
319 Ga0075435_100026555
320 Ga0099794_10004775
321 Ga0105240_10051042
322 Ga0105240_10903556
323 Ga0105245_10044643
324 Ga0105247_10166437
325 Ga0105241_10314885
326 Ga0105237_10186324
327 Ga0099796_10128818
328 Ga0105246_10864770
329 Ga0157374_10027682
330 Ga0157374_10745881
331 Ga0157378_10035749
332 Ga0157372_10018497
333 Ga0182007_10181602
334 Ga0182005_1112040
335 Ga0184592_109848
336 Ga0206356_11899834
337 Ga0224569_100200
338 Ga0224571_101443
339 Ga0224572_1071383
340 Ga0228598_1004963
341 Ga0207692_10018926
342 Ga0207692_10022502
343 Ga0207692_10036298
344 Ga0207685_10009240
345 Ga0207699_10000189
346 Ga0207699_10007483
347 Ga0207699_10021088
348 Ga0207699_10828185
349 Ga0207699_10943616
350 Ga0207684_10000859
351 Ga0207684_10009618
352 Ga0207695_10153417
353 Ga0207695_10764649
354 Ga0207671_10092367
355 Ga0207693_10000077
356 Ga0207693_10000210
357 Ga0207693_10017069
358 Ga0207693_11021675
359 Ga0207663_10001080
360 Ga0207663_10076269
361 Ga0207660_10186172
362 Ga0207646_10003441
363 Ga0207646_10009018
364 Ga0207646_10058285
365 Ga0207694_10393554
366 Ga0207687_10010974
367 Ga0207700_10000111
368 Ga0207700_10000385
369 Ga0207700_10011766
370 Ga0207700_10123459
371 Ga0207700_10267484
372 Ga0207700_10341809
373 Ga0207700_10458926
374 Ga0207664_10308818
375 Ga0207664_10372172
376 Ga0207665_10016679
377 Ga0207665_10081185
378 Ga0207665_10120413
379 Ga0207665_10277570
380 Ga0207679_10080082
381 Ga0207667_10245890
382 Ga0207702_10028786
383 Ga0209588_1001563
384 Ga0265355_1002620
385 Ga0265338_10006033
386 Ga0265338_10074405
387 Ga0265762_1011995
388 Ga0265762_1012400
389 Ga0265763_1005554
390 Ga0265770_1026283
391 Ga0265765_1001412
392 Ga0265760_10002153
393 Ga0265760_10016904
394 Ga0265760_10051010
395 Ga0265760_10057625
396 Ga0265325_10101130
397 Ga0265325_10189910
398 Ga0265325_10229029
399 Ga0265339_10052313
400 Ga0265339_10094085
401 Ga0265331_10053557
402 Ga0265316_10060990
403 Ga0265316_10137694
404 Ga0265313_10026774
405 Ga0265314_10018071
406 Ga0373934_0017474
407 Ga0373934_0021232
408 Ga0373945_0106728
409 Ga0373954_0028367
410 Ga0373954_0556400
411 Ga0373956_0009848
412 Ga0373956_0019040
413 Ga0373956_0307367
414 Ga0373943_0041774
415 Ga0373943_0368431
416 Ga0373946_0202092
417 Ga0373955_0014294
418 Ga0373955_0043304
419 Ga0373955_0521117
420 Ga0373924_0195071
421 Ga0373935_0084717
422 Ga0373935_0382807
423 Ga0373927_0099112
424 Ga0373933_0001961
425 Ga0373933_0005381
426 Ga0373933_0250179
427 Ga0373933_0331711
428 Ga0373947_0053264
429 Ga0373937_0000170
430 Ga0373937_0029784
431 Ga0373937_0257379
432 Ga0373937_0491024
433 Ga0373925_0005107
434 Ga0373925_0140540
435 Ga0495629_0035309
436 Ga0495651_0002008
437 Ga0495580_0000232
438 Ga0495580_0008222
439 Ga0495582_0001190
440 Ga0495608_0029590
441 Ga0495628_0025021
442 Ga0495628_0243816
443 Ga0495628_0301455
444 Ga0495630_0102785
445 Ga0495630_0315887
446 Ga0495630_0936137
447 Ga0495652_0075520
448 Ga0495640_0085511
449 Ga0495587_0000292
450 Ga0495667_0726669
451 Ga0495657_0027886
452 Ga0495599_0379969
453 Ga0495623_0099043
454 Ga0495623_0116727
455 Ga0495646_0038890
456 Ga0495658_0046799
457 Ga0495624_0163509
458 Ga0495581_0122914
459 Ga0495604_0015361
460 Ga0495604_0052267
461 Ga0495674_0010742
462 Ga0495674_0128642
463 Ga0495674_0741806
464 Ga0495676_0640642
465 Ga0495680_0186694
466 Ga0495683_0178530
467 Ga0495675_0013513
468 Ga0495675_0322071
469 Ga0495684_0005485
470 Ga0495684_0456255
471 Ga0495684_0774184
472 Ga0495602_0000456
473 Ga0495602_0101973
474 Ga0496100_0034603
475 Ga0496112_0178419
476 Ga0496112_0612884
477 Ga0496114_0192668
478 Ga0496115_0010046
479 Ga0496115_0053470
480 nmdc:mga0n895_52630_c1
481 nmdc:mga08x19_55553_c1
482 Ga0495612_0186188
483 Ga0495595_0511594
484 Ga0500595_075590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11138

DUF2911

Protein of unknown function (DUF2911)

52

196

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s1t-assembly1.cif.gz_B crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with uc-781 0.7828 33 55
1klm-assembly1.cif.gz_B hiv-1 reverse transcriptase complexed with bhap u-90152 0.7788 33 55
4dx9-assembly14.cif.gz_a icap1 in complex with integrin beta 1 cytoplasmic tail 0.7733 152 179
3dle-assembly1.cif.gz_B crystal structure of hiv-1 reverse transcriptase in complex with gf128590. 0.7718 33 55
1jlg-assembly1.cif.gz_B crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with uc-781 0.7675 33 55
ID Description Score Start End Superfamily
af_Q9MAS5_1_127_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7985 152 177 3.30.450.50
af_Q6YZI8_1_149_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.768 153 176 3.30.450.50
af_K7L4D0_610_722_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7606 140 180 2.30.29.30
af_Q9LK47_276_392_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7369 140 180 2.30.29.30
af_O23429_6_117_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7238 145 176 3.30.450.50
ID Description Score Start End GO Terms
AF-A0A2V8XAT5-F1-model_v4 DUF2911 domain-containing protein 0.9601 30 180
AF-A0A2V8Y448-F1-model_v4 DUF2911 domain-containing protein 0.9566 30 180
AF-A0A3B0VWH5-F1-model_v4 DUF2911 domain-containing protein 0.9401 33 178
AF-A0A7Y2EKU2-F1-model_v4 DUF2911 domain-containing protein 0.9398 46 179
AF-A0A2V9YA20-F1-model_v4 DUF2911 domain-containing protein 0.9388 78 180

Map