F354861

General Info

Members Datasets Scaffolds Average Seq Length
242 143 242 174

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0268325|Ga0395899_0268325_47_676
Length 209
Sequence VASGRLQRQRRLRYLPGHQTNARFRTNIPREQGSGAIMKRILGLVAGLSLGLAVPAAAEPANLLGVFGNWSAFSSGSGSNLTCYALSRPRAKRPAGAKRGDIYLMVSDWPARKVKAEPQIVYGYQGKEGGAAALAVGGDKFTFFIRNNGKEGSSWLQQLADNGKLIDAMQAGVSAVATGISSRGTKTSDTYSLAGFNDAMTKVHAACNM

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 0
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000013 3300003214 Bacteria 402100
2 JGI25153J46596_10000391 3300003215 Bacteria 29754
3 Ga0070658_10005945 3300005327 Bacteria 9902
4 Ga0070658_10482376 3300005327 Bacteria 1070
5 Ga0070658_10571496 3300005327 Bacteria 979
6 Ga0070676_10007422 3300005328 Bacteria 5887
7 Ga0070683_100367137 3300005329 Bacteria 1371
8 Ga0070670_100116799 3300005331 Bacteria 2301
9 Ga0068869_100046082 3300005334 Bacteria 3143
10 Ga0070666_10237677 3300005335 Unclassified 1288
11 Ga0068868_100240482 3300005338 Bacteria 1521
12 Ga0070660_100009282 3300005339 Bacteria 6913
13 Ga0070660_100208128 3300005339 Bacteria 1587
14 Ga0070660_101183176 3300005339 Unclassified 648
15 Ga0070689_101563794 3300005340 Unclassified 598
16 Ga0070675_100264876 3300005354 Bacteria 1507
17 Ga0070675_100634004 3300005354 Unclassified 971
18 Ga0070673_100064016 3300005364 Bacteria 2928
19 Ga0070667_100329284 3300005367 Bacteria 1379
20 Ga0070713_100356106 3300005436 Bacteria 1359
21 Ga0070701_10152163 3300005438 Bacteria 1333
22 Ga0070681_10177507 3300005458 Bacteria 2052
23 Ga0070681_11641299 3300005458 Unclassified 569
24 Ga0068867_100033182 3300005459 Bacteria 3737
25 Ga0070679_100122151 3300005530 Bacteria 2589
26 Ga0070679_100410880 3300005530 Bacteria 1299
27 Ga0068853_100027964 3300005539 Bacteria 4742
28 Ga0068853_100289464 3300005539 Unclassified 1512
29 Ga0068853_100667879 3300005539 Bacteria 990
30 Ga0068853_100764907 3300005539 Bacteria 924
31 Ga0070672_100303866 3300005543 Bacteria 1353
32 Ga0070665_100000571 3300005548 Bacteria 51504
33 Ga0070665_100004008 3300005548 Bacteria 15529
34 Ga0070665_100018597 3300005548 Bacteria 6964
35 Ga0070665_100063383 3300005548 Bacteria 3706
36 Ga0070665_100490583 3300005548 Bacteria 1239
37 Ga0070665_100865516 3300005548 Unclassified 917
38 Ga0068855_100009112 3300005563 Bacteria 11989
39 Ga0068855_100204271 3300005563 Bacteria 2223
40 Ga0068855_100562225 3300005563 Unclassified 1234
41 Ga0068857_100110896 3300005577 Bacteria 2466
42 Ga0068857_100566733 3300005577 Bacteria 1071
43 Ga0068854_100990513 3300005578 Bacteria 744
44 Ga0068852_100223731 3300005616 Bacteria 1791
45 Ga0068859_100987000 3300005617 Bacteria 925
46 Ga0068859_101595303 3300005617 Bacteria 721
47 Ga0068858_100027112 3300005842 Bacteria 5322
48 Ga0068858_100041586 3300005842 Bacteria 4261
49 Ga0075365_10561668 3300006038 Bacteria 807
50 Ga0097621_100102228 3300006237 Bacteria 2413
51 Ga0097621_100105646 3300006237 Bacteria 2374
52 Ga0097621_100478235 3300006237 Bacteria 1126
53 Ga0068871_100260099 3300006358 Bacteria 1514
54 Ga0068871_100417925 3300006358 Bacteria 1197
55 Ga0068871_100566778 3300006358 Bacteria 1030
56 Ga0068865_100293880 3300006881 Bacteria 1298
57 Ga0097620_100987038 3300006931 Bacteria 925
58 Ga0097620_101595396 3300006931 Bacteria 721
59 Ga0105240_10016248 3300009093 Bacteria 10087
60 Ga0105240_10027810 3300009093 Bacteria 7399
61 Ga0105240_10667468 3300009093 Unclassified 1138
62 Ga0105240_10785351 3300009093 Bacteria 1033
63 Ga0105245_10021803 3300009098 Bacteria 5623
64 Ga0105241_10076653 3300009174 Bacteria 2608
65 Ga0105241_10271143 3300009174 Bacteria 1446
66 Ga0105241_10512018 3300009174 Unclassified 1072
67 Ga0105242_10147785 3300009176 Bacteria 2046
68 Ga0105242_10218740 3300009176 Bacteria 1701
69 Ga0105248_10242411 3300009177 Bacteria 2029
70 Ga0105237_10083944 3300009545 Bacteria 3175
71 Ga0105237_10154180 3300009545 Bacteria 2294
72 Ga0105237_10177556 3300009545 Bacteria 2130
73 Ga0105237_10372173 3300009545 Bacteria 1433
74 Ga0105237_10886263 3300009545 Unclassified 899
75 Ga0105238_10018323 3300009551 Bacteria 7125
76 Ga0105238_10024629 3300009551 Bacteria 6134
77 Ga0105238_12209382 3300009551 Unclassified 585
78 Ga0105249_10573519 3300009553 Bacteria 1181
79 Ga0105239_10076054 3300010375 Bacteria 3692
80 Ga0105239_10231446 3300010375 Bacteria 2073
81 Ga0105239_10270944 3300010375 Bacteria 1909
82 Ga0105239_10348468 3300010375 Bacteria 1672
83 Ga0105239_10376959 3300010375 Unclassified 1604
84 Ga0105239_10396847 3300010375 Bacteria 1561
85 Ga0105239_10469568 3300010375 Bacteria 1429
86 Ga0105239_10816939 3300010375 Bacteria 1068
87 Ga0105239_10904301 3300010375 Bacteria 1013
88 Ga0157373_10075541 3300013100 Bacteria 2377
89 Ga0157370_10045519 3300013104 Bacteria 4209
90 Ga0157370_10764905 3300013104 Unclassified 880
91 Ga0157369_10153538 3300013105 Bacteria 2433
92 Ga0157369_10478863 3300013105 Unclassified 1288
93 Ga0157374_10837846 3300013296 Bacteria 936
94 Ga0157378_10047569 3300013297 Bacteria 3813
95 Ga0163162_10026030 3300013306 Bacteria 5781
96 Ga0163162_10402460 3300013306 Unclassified 1501
97 Ga0163162_10526879 3300013306 Bacteria 1311
98 Ga0157375_11112976 3300013308 Bacteria 925
99 Ga0163163_10000180 3300014325 Bacteria 64938
100 Ga0163163_10816482 3300014325 Unclassified 996
101 Ga0157380_10331116 3300014326 Unclassified 1416
102 Ga0157380_11602895 3300014326 Bacteria 706
103 Ga0157379_10001323 3300014968 Bacteria 20213
104 Ga0157376_10065383 3300014969 Bacteria 3071
105 Ga0157376_10792672 3300014969 Unclassified 959
106 Ga0157376_11189091 3300014969 Bacteria 790
107 Ga0213871_10107133 3300021441 Bacteria 823
108 Ga0209563_115541 3300025230 Bacteria 953
109 Ga0207427_104100 3300025231 Bacteria 2622
110 Ga0209233_1000013 3300025261 Bacteria 1013785
111 Ga0209233_1006408 3300025261 Bacteria 3796
112 Ga0209758_1000185 3300025297 Bacteria 139330
113 Ga0207688_10101914 3300025901 Bacteria 1659
114 Ga0207680_10012849 3300025903 Bacteria 4278
115 Ga0207680_10326264 3300025903 Bacteria 1074
116 Ga0207647_10096804 3300025904 Bacteria 1755
117 Ga0207699_10259254 3300025906 Unclassified 1201
118 Ga0207645_10010321 3300025907 Bacteria 6412
119 Ga0207705_10001833 3300025909 Bacteria 16733
120 Ga0207705_10058403 3300025909 Bacteria 2783
121 Ga0207654_10022056 3300025911 Bacteria 3393
122 Ga0207654_10200002 3300025911 Bacteria 1315
123 Ga0207654_10207792 3300025911 Unclassified 1292
124 Ga0207707_10335477 3300025912 Bacteria 1304
125 Ga0207707_10422851 3300025912 Bacteria 1142
126 Ga0207695_10037046 3300025913 Bacteria 5265
127 Ga0207695_10038116 3300025913 Bacteria 5179
128 Ga0207695_10049637 3300025913 Bacteria 4421
129 Ga0207695_10056156 3300025913 Bacteria 4099
130 Ga0207695_10080777 3300025913 Bacteria 3292
131 Ga0207695_10330070 3300025913 Bacteria 1414
132 Ga0207671_10026238 3300025914 Bacteria 4368
133 Ga0207671_10042964 3300025914 Bacteria 3344
134 Ga0207671_10079205 3300025914 Bacteria 2461
135 Ga0207657_10023389 3300025919 Bacteria 5754
136 Ga0207657_10133736 3300025919 Bacteria 2031
137 Ga0207652_10015982 3300025921 Bacteria 6119
138 Ga0207652_10045857 3300025921 Bacteria 3727
139 Ga0207652_10113969 3300025921 Bacteria 2400
140 Ga0207694_10298314 3300025924 Bacteria 1326
141 Ga0207650_10226319 3300025925 Bacteria 1507
142 Ga0207659_10209626 3300025926 Bacteria 1561
143 Ga0207687_10009766 3300025927 Bacteria 6278
144 Ga0207686_10237351 3300025934 Bacteria 1325
145 Ga0207709_10545088 3300025935 Unclassified 911
146 Ga0207669_10270830 3300025937 Bacteria 1275
147 Ga0207704_10354185 3300025938 Bacteria 1144
148 Ga0207691_10254850 3300025940 Bacteria 1514
149 Ga0207691_10400002 3300025940 Bacteria 1171
150 Ga0207711_10023314 3300025941 Bacteria 5180
151 Ga0207711_10971351 3300025941 Bacteria 788
152 Ga0207689_10042016 3300025942 Bacteria 3783
153 Ga0207667_10037381 3300025949 Bacteria 5190
154 Ga0207667_10191962 3300025949 Bacteria 2096
155 Ga0207667_10471983 3300025949 Unclassified 1274
156 Ga0207667_10552660 3300025949 Bacteria 1164
157 Ga0207651_10032852 3300025960 Bacteria 3338
158 Ga0207712_10391431 3300025961 Bacteria 1166
159 Ga0207712_11036208 3300025961 Unclassified 729
160 Ga0207658_10246483 3300025986 Bacteria 1516
161 Ga0207677_10760370 3300026023 Bacteria 864
162 Ga0207677_10795850 3300026023 Bacteria 846
163 Ga0207677_11067226 3300026023 Unclassified 735
164 Ga0207703_10055509 3300026035 Bacteria 3223
165 Ga0207703_10146184 3300026035 Bacteria 2056
166 Ga0207639_10089904 3300026041 Bacteria 2455
167 Ga0207639_10414927 3300026041 Unclassified 1216
168 Ga0207678_10184919 3300026067 Bacteria 1780
169 Ga0207702_10610606 3300026078 Bacteria 1071
170 Ga0207702_10915872 3300026078 Bacteria 869
171 Ga0207648_10011044 3300026089 Bacteria 8523
172 Ga0207674_10020199 3300026116 Bacteria 7203
173 Ga0207674_10325917 3300026116 Bacteria 1485
174 Ga0207675_100629500 3300026118 Bacteria 1078
175 Ga0207698_10189594 3300026142 Bacteria 1830
176 Ga0268266_10001485 3300028379 Bacteria 27831
177 Ga0268266_10023999 3300028379 Bacteria 5189
178 Ga0268266_10349790 3300028379 Bacteria 1389
179 Ga0268266_10449689 3300028379 Bacteria 1224
180 Ga0268266_10671955 3300028379 Bacteria 997
181 Ga0268265_10533709 3300028380 Unclassified 1111
182 Ga0265338_10067478 3300028800 Bacteria 3089
183 Ga0265328_10064854 3300031239 Bacteria 1342
184 Ga0265340_10043777 3300031247 Bacteria 2193
185 Ga0265339_10099373 3300031249 Bacteria 1517
186 Ga0265331_10037361 3300031250 Bacteria 2379
187 Ga0265316_10081358 3300031344 Bacteria 2483
188 Ga0265314_10038455 3300031711 Bacteria 3456
189 Ga0265342_10273246 3300031712 Bacteria 896
190 Ga0307410_11284252 3300031852 Unclassified 640
191 Ga0373936_0305889 3300035113 Unclassified 718
192 Ga0373933_0357559 3300035724 Bacteria 949
193 Ga0395899_0092312 3300037312 Bacteria 2193
194 Ga0395899_0268325 3300037312 Bacteria 1165
195 Ga0395900_0125609 3300037418 Bacteria 2631
196 Ga0395898_0060118 3300037466 Bacteria 3694
197 Ga0395898_0111854 3300037466 Bacteria 2617
198 Ga0395901_0034033 3300038443 Bacteria 5261
199 Ga0436365_0337108 3300039437 Unclassified 536
200 Ga0466957_0056965 3300044842 Bacteria 2391
201 Ga0466959_0409639 3300045049 Bacteria 921
202 Ga0466967_0514725 3300045976 Bacteria 1175
203 Ga0495585_0140128 3300046492 Bacteria 1267
204 Ga0495652_0492369 3300046529 Bacteria 851
205 Ga0495621_0156803 3300046539 Bacteria 898
206 Ga0495622_0252443 3300046557 Unclassified 776
207 Ga0495611_0058869 3300046648 Bacteria 1743
208 Ga0495649_0254034 3300046694 Bacteria 902
209 Ga0495600_0304019 3300046809 Unclassified 1006
210 Ga0495600_0323931 3300046809 Bacteria 969
211 Ga0495681_0197760 3300047470 Unclassified 817
212 Ga0496121_0003678 3300048924 Bacteria 21541
213 Ga0496126_0100442 3300048929 Bacteria 2532
214 Ga0501033_0005160 3300049570 Bacteria 10384
215 Ga0501033_0021542 3300049570 Bacteria 4862
216 Ga0501033_0154807 3300049570 Bacteria 1652
217 Ga0501034_0446564 3300049571 Bacteria 1211
218 Ga0501036_0187611 3300049572 Bacteria 1740
219 Ga0501037_0045442 3300049573 Bacteria 3224
220 Ga0501037_0192246 3300049573 Unclassified 1445
221 Ga0501046_0077403 3300049580 Bacteria 2575
222 Ga0501046_0331601 3300049580 Bacteria 1107
223 Ga0501047_0102234 3300049581 Bacteria 2745
224 Ga0501047_0270044 3300049581 Bacteria 1547
225 Ga0501047_0282947 3300049581 Bacteria 1503
226 Ga0501047_0488033 3300049581 Bacteria 1059
227 Ga0501047_1223599 3300049581 Bacteria 565
228 Ga0501073_0082609 3300049589 Bacteria 2235
229 Ga0501080_0428725 3300049742 Bacteria 1187
230 Ga0501083_0499202 3300049744 Bacteria 792
231 Ga0501035_0272207 3300049822 Bacteria 1433
232 Ga0501035_0571560 3300049822 Bacteria 924
233 Ga0501044_0030015 3300049823 Bacteria 5731
234 Ga0500643_000021 3300053087 Bacteria 284326
235 Ga0500555_028056 3300053103 Unclassified 1605
236 Ga0500595_002097 3300053119 Bacteria 10192
237 Ga0500595_037059 3300053119 Bacteria 1594
238 Ga0500595_037265 3300053119 Bacteria 1587
239 Ga0500642_0250172 3300053130 Bacteria 814
240 Ga0500568_0059936 3300053139 Bacteria 1475
241 Ga0501084_0851076 3300054114 Bacteria 767
242 Ga0501082_0643836 3300060353 Bacteria 927

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10027810 Ga0105240_1002781010 157
2 3300009093 Ga0105240_10667468 Ga0105240_106674682 157
3 3300013104 Ga0157370_10045519 Ga0157370_100455195 157
4 3300013105 Ga0157369_10153538 Ga0157369_101535382 157
5 3300039437 Ga0436365_0337108 Ga0436365_0337108_43_522 159
6 3300013104 Ga0157370_10764905 Ga0157370_107649052 160
7 3300025913 Ga0207695_10056156 Ga0207695_100561562 160
8 3300028800 Ga0265338_10067478 Ga0265338_100674782 160
9 3300031247 Ga0265340_10043777 Ga0265340_100437772 160
10 3300031249 Ga0265339_10099373 Ga0265339_100993732 160
11 3300031250 Ga0265331_10037361 Ga0265331_100373612 160
12 3300031344 Ga0265316_10081358 Ga0265316_100813582 160
13 3300031711 Ga0265314_10038455 Ga0265314_100384555 160
14 3300031712 Ga0265342_10273246 Ga0265342_102732462 160
15 3300053119 Ga0500595_037059 Ga0500595_037059_502_1023 166
16 3300053139 Ga0500568_0059936 Ga0500568_0059936_591_1118 168
17 3300025904 Ga0207647_10096804 Ga0207647_100968041 169
18 3300005327 Ga0070658_10482376 Ga0070658_104823761 170
19 3300005340 Ga0070689_101563794 Ga0070689_1015637941 170
20 3300006237 Ga0097621_100105646 Ga0097621_1001056462 170
21 3300006358 Ga0068871_100417925 Ga0068871_1004179252 170
22 3300009545 Ga0105237_10372173 Ga0105237_103721732 170
23 3300010375 Ga0105239_10076054 Ga0105239_100760543 170
24 3300010375 Ga0105239_10231446 Ga0105239_102314463 170
25 3300025913 Ga0207695_10038116 Ga0207695_100381162 170
26 3300025935 Ga0207709_10545088 Ga0207709_105450882 170
27 3300025949 Ga0207667_10552660 Ga0207667_105526602 170
28 3300026078 Ga0207702_10915872 Ga0207702_109158722 170
29 3300035113 Ga0373936_0305889 Ga0373936_0305889_183_701 170
30 3300035724 Ga0373933_0357559 Ga0373933_0357559_25_543 170
31 3300046557 Ga0495622_0252443 Ga0495622_0252443_185_703 170
32 3300046648 Ga0495611_0058869 Ga0495611_0058869_157_669 170
33 3300046809 Ga0495600_0304019 Ga0495600_0304019_250_768 170
34 3300049570 Ga0501033_0005160 Ga0501033_0005160_1103_1624 170
35 3300049573 Ga0501037_0192246 Ga0501037_0192246_768_1289 170
36 3300049581 Ga0501047_0282947 Ga0501047_0282947_523_1041 170
37 3300049581 Ga0501047_0488033 Ga0501047_0488033_431_952 170
38 3300049581 Ga0501047_1223599 Ga0501047_1223599_39_554 170
39 3300005327 Ga0070658_10005945 Ga0070658_1000594510 171
40 3300005339 Ga0070660_100009282 Ga0070660_1000092828 171
41 3300005458 Ga0070681_10177507 Ga0070681_101775072 171
42 3300005530 Ga0070679_100122151 Ga0070679_1001221514 171
43 3300005548 Ga0070665_100000571 Ga0070665_10000057143 171
44 3300005577 Ga0068857_100566733 Ga0068857_1005667332 171
45 3300005617 Ga0068859_101595303 Ga0068859_1015953031 171
46 3300005842 Ga0068858_100041586 Ga0068858_1000415863 171
47 3300006931 Ga0097620_101595396 Ga0097620_1015953962 171
48 3300009545 Ga0105237_10083944 Ga0105237_100839442 171
49 3300009545 Ga0105237_10886263 Ga0105237_108862631 171
50 3300010375 Ga0105239_10469568 Ga0105239_104695682 171
51 3300013105 Ga0157369_10478863 Ga0157369_104788631 171
52 3300013306 Ga0163162_10026030 Ga0163162_100260305 171
53 3300013306 Ga0163162_10402460 Ga0163162_104024602 171
54 3300014325 Ga0163163_10000180 Ga0163163_100001808 171
55 3300014325 Ga0163163_10816482 Ga0163163_108164822 171
56 3300014968 Ga0157379_10001323 Ga0157379_1000132310 171
57 3300014969 Ga0157376_10792672 Ga0157376_107926722 171
58 3300014969 Ga0157376_11189091 Ga0157376_111890912 171
59 3300025906 Ga0207699_10259254 Ga0207699_102592542 171
60 3300025909 Ga0207705_10001833 Ga0207705_100018336 171
61 3300025912 Ga0207707_10335477 Ga0207707_103354772 171
62 3300025919 Ga0207657_10023389 Ga0207657_100233896 171
63 3300025921 Ga0207652_10015982 Ga0207652_100159826 171
64 3300025937 Ga0207669_10270830 Ga0207669_102708302 171
65 3300026035 Ga0207703_10055509 Ga0207703_100555092 171
66 3300028379 Ga0268266_10001485 Ga0268266_1000148525 171
67 3300044842 Ga0466957_0056965 Ga0466957_0056965_1131_1646 171
68 3300045976 Ga0466967_0514725 Ga0466967_0514725_282_797 171
69 3300046529 Ga0495652_0492369 Ga0495652_0492369_227_742 171
70 3300046694 Ga0495649_0254034 Ga0495649_0254034_101_619 171
71 3300046809 Ga0495600_0323931 Ga0495600_0323931_344_859 171
72 3300047470 Ga0495681_0197760 Ga0495681_0197760_176_691 171
73 3300048924 Ga0496121_0003678 Ga0496121_0003678_5518_6039 171
74 3300049580 Ga0501046_0331601 Ga0501046_0331601_494_1009 171
75 3300049822 Ga0501035_0571560 Ga0501035_0571560_91_606 171
76 3300053103 Ga0500555_028056 Ga0500555_028056_748_1263 171
77 3300053119 Ga0500595_002097 Ga0500595_002097_6664_7182 171
78 3300003215 JGI25153J46596_10000391 JGI25153J46596_100003917 172
79 3300005327 Ga0070658_10571496 Ga0070658_105714961 172
80 3300005329 Ga0070683_100367137 Ga0070683_1003671372 172
81 3300005331 Ga0070670_100116799 Ga0070670_1001167993 172
82 3300005339 Ga0070660_100208128 Ga0070660_1002081282 172
83 3300005339 Ga0070660_101183176 Ga0070660_1011831761 172
84 3300005354 Ga0070675_100634004 Ga0070675_1006340042 172
85 3300005436 Ga0070713_100356106 Ga0070713_1003561062 172
86 3300005458 Ga0070681_11641299 Ga0070681_116412991 172
87 3300005530 Ga0070679_100410880 Ga0070679_1004108802 172
88 3300005539 Ga0068853_100027964 Ga0068853_1000279642 172
89 3300005539 Ga0068853_100289464 Ga0068853_1002894642 172
90 3300005539 Ga0068853_100667879 Ga0068853_1006678792 172
91 3300005539 Ga0068853_100764907 Ga0068853_1007649072 172
92 3300005548 Ga0070665_100004008 Ga0070665_10000400811 172
93 3300005548 Ga0070665_100063383 Ga0070665_1000633832 172
94 3300005548 Ga0070665_100490583 Ga0070665_1004905832 172
95 3300005563 Ga0068855_100009112 Ga0068855_1000091127 172
96 3300005563 Ga0068855_100204271 Ga0068855_1002042714 172
97 3300005563 Ga0068855_100562225 Ga0068855_1005622252 172
98 3300005577 Ga0068857_100110896 Ga0068857_1001108961 172
99 3300005578 Ga0068854_100990513 Ga0068854_1009905131 172
100 3300005616 Ga0068852_100223731 Ga0068852_1002237312 172
101 3300006038 Ga0075365_10561668 Ga0075365_105616682 172
102 3300006237 Ga0097621_100102228 Ga0097621_1001022284 172
103 3300006237 Ga0097621_100478235 Ga0097621_1004782352 172
104 3300006358 Ga0068871_100260099 Ga0068871_1002600992 172
105 3300006358 Ga0068871_100566778 Ga0068871_1005667782 172
106 3300006881 Ga0068865_100293880 Ga0068865_1002938802 172
107 3300009093 Ga0105240_10016248 Ga0105240_1001624810 172
108 3300009093 Ga0105240_10785351 Ga0105240_107853512 172
109 3300009174 Ga0105241_10076653 Ga0105241_100766532 172
110 3300009174 Ga0105241_10271143 Ga0105241_102711432 172
111 3300009176 Ga0105242_10147785 Ga0105242_101477851 172
112 3300009545 Ga0105237_10154180 Ga0105237_101541802 172
113 3300009545 Ga0105237_10177556 Ga0105237_101775563 172
114 3300009551 Ga0105238_10018323 Ga0105238_1001832310 172
115 3300009551 Ga0105238_10024629 Ga0105238_100246292 172
116 3300009551 Ga0105238_12209382 Ga0105238_122093821 172
117 3300009553 Ga0105249_10573519 Ga0105249_105735192 172
118 3300010375 Ga0105239_10376959 Ga0105239_103769591 172
119 3300010375 Ga0105239_10396847 Ga0105239_103968472 172
120 3300010375 Ga0105239_10816939 Ga0105239_108169392 172
121 3300010375 Ga0105239_10904301 Ga0105239_109043012 172
122 3300014326 Ga0157380_10331116 Ga0157380_103311162 172
123 3300014969 Ga0157376_10065383 Ga0157376_100653832 172
124 3300025230 Ga0209563_115541 Ga0209563_1155412 172
125 3300025297 Ga0209758_1000185 Ga0209758_100018577 172
126 3300025903 Ga0207680_10012849 Ga0207680_100128494 172
127 3300025909 Ga0207705_10058403 Ga0207705_100584032 172
128 3300025911 Ga0207654_10022056 Ga0207654_100220563 172
129 3300025911 Ga0207654_10200002 Ga0207654_102000022 172
130 3300025913 Ga0207695_10037046 Ga0207695_100370464 172
131 3300025913 Ga0207695_10049637 Ga0207695_100496371 172
132 3300025913 Ga0207695_10080777 Ga0207695_100807773 172
133 3300025914 Ga0207671_10026238 Ga0207671_100262382 172
134 3300025914 Ga0207671_10079205 Ga0207671_100792052 172
135 3300025919 Ga0207657_10133736 Ga0207657_101337362 172
136 3300025921 Ga0207652_10045857 Ga0207652_100458575 172
137 3300025921 Ga0207652_10113969 Ga0207652_101139693 172
138 3300025924 Ga0207694_10298314 Ga0207694_102983142 172
139 3300025925 Ga0207650_10226319 Ga0207650_102263192 172
140 3300025938 Ga0207704_10354185 Ga0207704_103541852 172
141 3300025940 Ga0207691_10400002 Ga0207691_104000021 172
142 3300025941 Ga0207711_10971351 Ga0207711_109713512 172
143 3300025949 Ga0207667_10037381 Ga0207667_100373816 172
144 3300025949 Ga0207667_10191962 Ga0207667_101919621 172
145 3300025949 Ga0207667_10471983 Ga0207667_104719832 172
146 3300025961 Ga0207712_11036208 Ga0207712_110362081 172
147 3300026023 Ga0207677_11067226 Ga0207677_110672261 172
148 3300026041 Ga0207639_10089904 Ga0207639_100899043 172
149 3300026041 Ga0207639_10414927 Ga0207639_104149272 172
150 3300026067 Ga0207678_10184919 Ga0207678_101849192 172
151 3300026116 Ga0207674_10020199 Ga0207674_100201991 172
152 3300026142 Ga0207698_10189594 Ga0207698_101895942 172
153 3300028379 Ga0268266_10349790 Ga0268266_103497902 172
154 3300028379 Ga0268266_10449689 Ga0268266_104496891 172
155 3300028379 Ga0268266_10671955 Ga0268266_106719552 172
156 3300028380 Ga0268265_10533709 Ga0268265_105337092 172
157 3300031239 Ga0265328_10064854 Ga0265328_100648541 172
158 3300037312 Ga0395899_0092312 Ga0395899_0092312_654_1181 172
159 3300037312 Ga0395899_0268325 Ga0395899_0268325_47_676 172
160 3300037418 Ga0395900_0125609 Ga0395900_0125609_1526_2155 172
161 3300037466 Ga0395898_0060118 Ga0395898_0060118_815_1342 172
162 3300037466 Ga0395898_0111854 Ga0395898_0111854_716_1345 172
163 3300038443 Ga0395901_0034033 Ga0395901_0034033_4037_4666 172
164 3300045049 Ga0466959_0409639 Ga0466959_0409639_333_851 172
165 3300046492 Ga0495585_0140128 Ga0495585_0140128_90_611 172
166 3300046539 Ga0495621_0156803 Ga0495621_0156803_191_712 172
167 3300048929 Ga0496126_0100442 Ga0496126_0100442_488_1012 172
168 3300049581 Ga0501047_0270044 Ga0501047_0270044_168_692 172
169 3300049589 Ga0501073_0082609 Ga0501073_0082609_1313_1942 172
170 3300049744 Ga0501083_0499202 Ga0501083_0499202_101_730 172
171 3300053119 Ga0500595_037265 Ga0500595_037265_812_1336 172
172 3300053130 Ga0500642_0250172 Ga0500642_0250172_129_647 172
173 3300005328 Ga0070676_10007422 Ga0070676_100074227 173
174 3300005334 Ga0068869_100046082 Ga0068869_1000460824 173
175 3300005338 Ga0068868_100240482 Ga0068868_1002404822 173
176 3300005354 Ga0070675_100264876 Ga0070675_1002648762 173
177 3300005364 Ga0070673_100064016 Ga0070673_1000640162 173
178 3300005438 Ga0070701_10152163 Ga0070701_101521631 173
179 3300005459 Ga0068867_100033182 Ga0068867_1000331822 173
180 3300005543 Ga0070672_100303866 Ga0070672_1003038662 173
181 3300009098 Ga0105245_10021803 Ga0105245_100218034 173
182 3300009176 Ga0105242_10218740 Ga0105242_102187402 173
183 3300010375 Ga0105239_10270944 Ga0105239_102709442 173
184 3300013100 Ga0157373_10075541 Ga0157373_100755413 173
185 3300013308 Ga0157375_11112976 Ga0157375_111129761 173
186 3300014326 Ga0157380_11602895 Ga0157380_116028951 173
187 3300025901 Ga0207688_10101914 Ga0207688_101019142 173
188 3300025907 Ga0207645_10010321 Ga0207645_100103211 173
189 3300025912 Ga0207707_10422851 Ga0207707_104228511 173
190 3300025926 Ga0207659_10209626 Ga0207659_102096262 173
191 3300025927 Ga0207687_10009766 Ga0207687_100097665 173
192 3300025934 Ga0207686_10237351 Ga0207686_102373512 173
193 3300025940 Ga0207691_10254850 Ga0207691_102548502 173
194 3300025942 Ga0207689_10042016 Ga0207689_100420165 173
195 3300025960 Ga0207651_10032852 Ga0207651_100328522 173
196 3300026023 Ga0207677_10795850 Ga0207677_107958502 173
197 3300026089 Ga0207648_10011044 Ga0207648_100110445 173
198 3300049570 Ga0501033_0154807 Ga0501033_0154807_759_1283 173
199 3300003214 JGI25165J46597_1000013 JGI25165J46597_1000013393 174
200 3300005335 Ga0070666_10237677 Ga0070666_102376772 174
201 3300005367 Ga0070667_100329284 Ga0070667_1003292842 174
202 3300005548 Ga0070665_100018597 Ga0070665_1000185973 174
203 3300005548 Ga0070665_100865516 Ga0070665_1008655162 174
204 3300005617 Ga0068859_100987000 Ga0068859_1009870001 174
205 3300005842 Ga0068858_100027112 Ga0068858_1000271122 174
206 3300006931 Ga0097620_100987038 Ga0097620_1009870381 174
207 3300009174 Ga0105241_10512018 Ga0105241_105120182 174
208 3300009177 Ga0105248_10242411 Ga0105248_102424113 174
209 3300010375 Ga0105239_10348468 Ga0105239_103484682 174
210 3300013296 Ga0157374_10837846 Ga0157374_108378461 174
211 3300013297 Ga0157378_10047569 Ga0157378_100475693 174
212 3300013306 Ga0163162_10526879 Ga0163162_105268792 174
213 3300021441 Ga0213871_10107133 Ga0213871_101071331 174
214 3300025231 Ga0207427_104100 Ga0207427_1041002 174
215 3300025261 Ga0209233_1000013 Ga0209233_1000013639 174
216 3300025261 Ga0209233_1006408 Ga0209233_10064086 174
217 3300025903 Ga0207680_10326264 Ga0207680_103262642 174
218 3300025911 Ga0207654_10207792 Ga0207654_102077922 174
219 3300025913 Ga0207695_10330070 Ga0207695_103300702 174
220 3300025914 Ga0207671_10042964 Ga0207671_100429644 174
221 3300025941 Ga0207711_10023314 Ga0207711_100233147 174
222 3300025961 Ga0207712_10391431 Ga0207712_103914312 174
223 3300025986 Ga0207658_10246483 Ga0207658_102464832 174
224 3300026023 Ga0207677_10760370 Ga0207677_107603702 174
225 3300026035 Ga0207703_10146184 Ga0207703_101461842 174
226 3300026078 Ga0207702_10610606 Ga0207702_106106062 174
227 3300026116 Ga0207674_10325917 Ga0207674_103259172 174
228 3300026118 Ga0207675_100629500 Ga0207675_1006295002 174
229 3300028379 Ga0268266_10023999 Ga0268266_100239992 174
230 3300031852 Ga0307410_11284252 Ga0307410_112842521 174
231 3300049570 Ga0501033_0021542 Ga0501033_0021542_1516_2046 174
232 3300049571 Ga0501034_0446564 Ga0501034_0446564_149_679 174
233 3300049572 Ga0501036_0187611 Ga0501036_0187611_692_1222 174
234 3300049573 Ga0501037_0045442 Ga0501037_0045442_2044_2574 174
235 3300049580 Ga0501046_0077403 Ga0501046_0077403_929_1459 174
236 3300049581 Ga0501047_0102234 Ga0501047_0102234_927_1457 174
237 3300049742 Ga0501080_0428725 Ga0501080_0428725_93_623 174
238 3300049822 Ga0501035_0272207 Ga0501035_0272207_317_847 174
239 3300049823 Ga0501044_0030015 Ga0501044_0030015_3513_4043 174
240 3300053087 Ga0500643_000021 Ga0500643_000021_63724_64269 174
241 3300054114 Ga0501084_0851076 Ga0501084_0851076_104_682 174
242 3300060353 Ga0501082_0643836 Ga0501082_0643836_272_814 174

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dtd-assembly1.cif.gz_G-2 crystal structure of invasion associated protein b from bartonella henselae 0.7129 30 174
3dtd-assembly1.cif.gz_C-2 crystal structure of invasion associated protein b from bartonella henselae 0.7122 30 173
3dtd-assembly1.cif.gz_F-1 crystal structure of invasion associated protein b from bartonella henselae 0.6977 30 174
3dtd-assembly1.cif.gz_G-2 crystal structure of invasion associated protein b from bartonella henselae 0.6959 30 174
3dtd-assembly1.cif.gz_C-2 crystal structure of invasion associated protein b from bartonella henselae 0.6845 30 173
ID Description Score Start End Superfamily
af_D3ZKP6_182_276_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.751 25 56 3.30.200.20
3dtdF00 Mainly Beta;Sandwich;Immunoglobulin-like;Invasion associated locus B (IalB) protein 0.6977 30 174 2.60.40.1880
3dtdF00 Mainly Beta;Sandwich;Immunoglobulin-like;Invasion associated locus B (IalB) protein 0.6812 30 174 2.60.40.1880
af_Q53QC7_413_508_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6575 27 52 3.30.200.20
af_Q2R148_105_188_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6489 20 56 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A3B9YUF1-F1-model_v4 Invasion associated locus B family protein 0.9502 21 172
AF-A0A2E6W1X7-F1-model_v4 Uncharacterized protein 0.9453 48 174
AF-A0A418WER9-F1-model_v4 Uncharacterized protein 0.9445 29 174
AF-A0A847JCV2-F1-model_v4 Invasion associated locus B family protein 0.944 28 172
AF-A0A537R5T5-F1-model_v4 Uncharacterized protein 0.9426 48 173

Feature Viewer

pLDDT pTM Quality
80.62 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map