F354861
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 242 | 143 | 242 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0268325|Ga0395899_0268325_47_676 |
| Length | 209 |
| Sequence | VASGRLQRQRRLRYLPGHQTNARFRTNIPREQGSGAIMKRILGLVAGLSLGLAVPAAAEPANLLGVFGNWSAFSSGSGSNLTCYALSRPRAKRPAGAKRGDIYLMVSDWPARKVKAEPQIVYGYQGKEGGAAALAVGGDKFTFFIRNNGKEGSSWLQQLADNGKLIDAMQAGVSAVATGISSRGTKTSDTYSLAGFNDAMTKVHAACNM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 29 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 55 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 100 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 107 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 125 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 126 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 138 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 139 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 140 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 141 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 142 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.2 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 92.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000013 | 3300003214 | Bacteria | 402100 |
| 2 | JGI25153J46596_10000391 | 3300003215 | Bacteria | 29754 |
| 3 | Ga0070658_10005945 | 3300005327 | Bacteria | 9902 |
| 4 | Ga0070658_10482376 | 3300005327 | Bacteria | 1070 |
| 5 | Ga0070658_10571496 | 3300005327 | Bacteria | 979 |
| 6 | Ga0070676_10007422 | 3300005328 | Bacteria | 5887 |
| 7 | Ga0070683_100367137 | 3300005329 | Bacteria | 1371 |
| 8 | Ga0070670_100116799 | 3300005331 | Bacteria | 2301 |
| 9 | Ga0068869_100046082 | 3300005334 | Bacteria | 3143 |
| 10 | Ga0070666_10237677 | 3300005335 | Unclassified | 1288 |
| 11 | Ga0068868_100240482 | 3300005338 | Bacteria | 1521 |
| 12 | Ga0070660_100009282 | 3300005339 | Bacteria | 6913 |
| 13 | Ga0070660_100208128 | 3300005339 | Bacteria | 1587 |
| 14 | Ga0070660_101183176 | 3300005339 | Unclassified | 648 |
| 15 | Ga0070689_101563794 | 3300005340 | Unclassified | 598 |
| 16 | Ga0070675_100264876 | 3300005354 | Bacteria | 1507 |
| 17 | Ga0070675_100634004 | 3300005354 | Unclassified | 971 |
| 18 | Ga0070673_100064016 | 3300005364 | Bacteria | 2928 |
| 19 | Ga0070667_100329284 | 3300005367 | Bacteria | 1379 |
| 20 | Ga0070713_100356106 | 3300005436 | Bacteria | 1359 |
| 21 | Ga0070701_10152163 | 3300005438 | Bacteria | 1333 |
| 22 | Ga0070681_10177507 | 3300005458 | Bacteria | 2052 |
| 23 | Ga0070681_11641299 | 3300005458 | Unclassified | 569 |
| 24 | Ga0068867_100033182 | 3300005459 | Bacteria | 3737 |
| 25 | Ga0070679_100122151 | 3300005530 | Bacteria | 2589 |
| 26 | Ga0070679_100410880 | 3300005530 | Bacteria | 1299 |
| 27 | Ga0068853_100027964 | 3300005539 | Bacteria | 4742 |
| 28 | Ga0068853_100289464 | 3300005539 | Unclassified | 1512 |
| 29 | Ga0068853_100667879 | 3300005539 | Bacteria | 990 |
| 30 | Ga0068853_100764907 | 3300005539 | Bacteria | 924 |
| 31 | Ga0070672_100303866 | 3300005543 | Bacteria | 1353 |
| 32 | Ga0070665_100000571 | 3300005548 | Bacteria | 51504 |
| 33 | Ga0070665_100004008 | 3300005548 | Bacteria | 15529 |
| 34 | Ga0070665_100018597 | 3300005548 | Bacteria | 6964 |
| 35 | Ga0070665_100063383 | 3300005548 | Bacteria | 3706 |
| 36 | Ga0070665_100490583 | 3300005548 | Bacteria | 1239 |
| 37 | Ga0070665_100865516 | 3300005548 | Unclassified | 917 |
| 38 | Ga0068855_100009112 | 3300005563 | Bacteria | 11989 |
| 39 | Ga0068855_100204271 | 3300005563 | Bacteria | 2223 |
| 40 | Ga0068855_100562225 | 3300005563 | Unclassified | 1234 |
| 41 | Ga0068857_100110896 | 3300005577 | Bacteria | 2466 |
| 42 | Ga0068857_100566733 | 3300005577 | Bacteria | 1071 |
| 43 | Ga0068854_100990513 | 3300005578 | Bacteria | 744 |
| 44 | Ga0068852_100223731 | 3300005616 | Bacteria | 1791 |
| 45 | Ga0068859_100987000 | 3300005617 | Bacteria | 925 |
| 46 | Ga0068859_101595303 | 3300005617 | Bacteria | 721 |
| 47 | Ga0068858_100027112 | 3300005842 | Bacteria | 5322 |
| 48 | Ga0068858_100041586 | 3300005842 | Bacteria | 4261 |
| 49 | Ga0075365_10561668 | 3300006038 | Bacteria | 807 |
| 50 | Ga0097621_100102228 | 3300006237 | Bacteria | 2413 |
| 51 | Ga0097621_100105646 | 3300006237 | Bacteria | 2374 |
| 52 | Ga0097621_100478235 | 3300006237 | Bacteria | 1126 |
| 53 | Ga0068871_100260099 | 3300006358 | Bacteria | 1514 |
| 54 | Ga0068871_100417925 | 3300006358 | Bacteria | 1197 |
| 55 | Ga0068871_100566778 | 3300006358 | Bacteria | 1030 |
| 56 | Ga0068865_100293880 | 3300006881 | Bacteria | 1298 |
| 57 | Ga0097620_100987038 | 3300006931 | Bacteria | 925 |
| 58 | Ga0097620_101595396 | 3300006931 | Bacteria | 721 |
| 59 | Ga0105240_10016248 | 3300009093 | Bacteria | 10087 |
| 60 | Ga0105240_10027810 | 3300009093 | Bacteria | 7399 |
| 61 | Ga0105240_10667468 | 3300009093 | Unclassified | 1138 |
| 62 | Ga0105240_10785351 | 3300009093 | Bacteria | 1033 |
| 63 | Ga0105245_10021803 | 3300009098 | Bacteria | 5623 |
| 64 | Ga0105241_10076653 | 3300009174 | Bacteria | 2608 |
| 65 | Ga0105241_10271143 | 3300009174 | Bacteria | 1446 |
| 66 | Ga0105241_10512018 | 3300009174 | Unclassified | 1072 |
| 67 | Ga0105242_10147785 | 3300009176 | Bacteria | 2046 |
| 68 | Ga0105242_10218740 | 3300009176 | Bacteria | 1701 |
| 69 | Ga0105248_10242411 | 3300009177 | Bacteria | 2029 |
| 70 | Ga0105237_10083944 | 3300009545 | Bacteria | 3175 |
| 71 | Ga0105237_10154180 | 3300009545 | Bacteria | 2294 |
| 72 | Ga0105237_10177556 | 3300009545 | Bacteria | 2130 |
| 73 | Ga0105237_10372173 | 3300009545 | Bacteria | 1433 |
| 74 | Ga0105237_10886263 | 3300009545 | Unclassified | 899 |
| 75 | Ga0105238_10018323 | 3300009551 | Bacteria | 7125 |
| 76 | Ga0105238_10024629 | 3300009551 | Bacteria | 6134 |
| 77 | Ga0105238_12209382 | 3300009551 | Unclassified | 585 |
| 78 | Ga0105249_10573519 | 3300009553 | Bacteria | 1181 |
| 79 | Ga0105239_10076054 | 3300010375 | Bacteria | 3692 |
| 80 | Ga0105239_10231446 | 3300010375 | Bacteria | 2073 |
| 81 | Ga0105239_10270944 | 3300010375 | Bacteria | 1909 |
| 82 | Ga0105239_10348468 | 3300010375 | Bacteria | 1672 |
| 83 | Ga0105239_10376959 | 3300010375 | Unclassified | 1604 |
| 84 | Ga0105239_10396847 | 3300010375 | Bacteria | 1561 |
| 85 | Ga0105239_10469568 | 3300010375 | Bacteria | 1429 |
| 86 | Ga0105239_10816939 | 3300010375 | Bacteria | 1068 |
| 87 | Ga0105239_10904301 | 3300010375 | Bacteria | 1013 |
| 88 | Ga0157373_10075541 | 3300013100 | Bacteria | 2377 |
| 89 | Ga0157370_10045519 | 3300013104 | Bacteria | 4209 |
| 90 | Ga0157370_10764905 | 3300013104 | Unclassified | 880 |
| 91 | Ga0157369_10153538 | 3300013105 | Bacteria | 2433 |
| 92 | Ga0157369_10478863 | 3300013105 | Unclassified | 1288 |
| 93 | Ga0157374_10837846 | 3300013296 | Bacteria | 936 |
| 94 | Ga0157378_10047569 | 3300013297 | Bacteria | 3813 |
| 95 | Ga0163162_10026030 | 3300013306 | Bacteria | 5781 |
| 96 | Ga0163162_10402460 | 3300013306 | Unclassified | 1501 |
| 97 | Ga0163162_10526879 | 3300013306 | Bacteria | 1311 |
| 98 | Ga0157375_11112976 | 3300013308 | Bacteria | 925 |
| 99 | Ga0163163_10000180 | 3300014325 | Bacteria | 64938 |
| 100 | Ga0163163_10816482 | 3300014325 | Unclassified | 996 |
| 101 | Ga0157380_10331116 | 3300014326 | Unclassified | 1416 |
| 102 | Ga0157380_11602895 | 3300014326 | Bacteria | 706 |
| 103 | Ga0157379_10001323 | 3300014968 | Bacteria | 20213 |
| 104 | Ga0157376_10065383 | 3300014969 | Bacteria | 3071 |
| 105 | Ga0157376_10792672 | 3300014969 | Unclassified | 959 |
| 106 | Ga0157376_11189091 | 3300014969 | Bacteria | 790 |
| 107 | Ga0213871_10107133 | 3300021441 | Bacteria | 823 |
| 108 | Ga0209563_115541 | 3300025230 | Bacteria | 953 |
| 109 | Ga0207427_104100 | 3300025231 | Bacteria | 2622 |
| 110 | Ga0209233_1000013 | 3300025261 | Bacteria | 1013785 |
| 111 | Ga0209233_1006408 | 3300025261 | Bacteria | 3796 |
| 112 | Ga0209758_1000185 | 3300025297 | Bacteria | 139330 |
| 113 | Ga0207688_10101914 | 3300025901 | Bacteria | 1659 |
| 114 | Ga0207680_10012849 | 3300025903 | Bacteria | 4278 |
| 115 | Ga0207680_10326264 | 3300025903 | Bacteria | 1074 |
| 116 | Ga0207647_10096804 | 3300025904 | Bacteria | 1755 |
| 117 | Ga0207699_10259254 | 3300025906 | Unclassified | 1201 |
| 118 | Ga0207645_10010321 | 3300025907 | Bacteria | 6412 |
| 119 | Ga0207705_10001833 | 3300025909 | Bacteria | 16733 |
| 120 | Ga0207705_10058403 | 3300025909 | Bacteria | 2783 |
| 121 | Ga0207654_10022056 | 3300025911 | Bacteria | 3393 |
| 122 | Ga0207654_10200002 | 3300025911 | Bacteria | 1315 |
| 123 | Ga0207654_10207792 | 3300025911 | Unclassified | 1292 |
| 124 | Ga0207707_10335477 | 3300025912 | Bacteria | 1304 |
| 125 | Ga0207707_10422851 | 3300025912 | Bacteria | 1142 |
| 126 | Ga0207695_10037046 | 3300025913 | Bacteria | 5265 |
| 127 | Ga0207695_10038116 | 3300025913 | Bacteria | 5179 |
| 128 | Ga0207695_10049637 | 3300025913 | Bacteria | 4421 |
| 129 | Ga0207695_10056156 | 3300025913 | Bacteria | 4099 |
| 130 | Ga0207695_10080777 | 3300025913 | Bacteria | 3292 |
| 131 | Ga0207695_10330070 | 3300025913 | Bacteria | 1414 |
| 132 | Ga0207671_10026238 | 3300025914 | Bacteria | 4368 |
| 133 | Ga0207671_10042964 | 3300025914 | Bacteria | 3344 |
| 134 | Ga0207671_10079205 | 3300025914 | Bacteria | 2461 |
| 135 | Ga0207657_10023389 | 3300025919 | Bacteria | 5754 |
| 136 | Ga0207657_10133736 | 3300025919 | Bacteria | 2031 |
| 137 | Ga0207652_10015982 | 3300025921 | Bacteria | 6119 |
| 138 | Ga0207652_10045857 | 3300025921 | Bacteria | 3727 |
| 139 | Ga0207652_10113969 | 3300025921 | Bacteria | 2400 |
| 140 | Ga0207694_10298314 | 3300025924 | Bacteria | 1326 |
| 141 | Ga0207650_10226319 | 3300025925 | Bacteria | 1507 |
| 142 | Ga0207659_10209626 | 3300025926 | Bacteria | 1561 |
| 143 | Ga0207687_10009766 | 3300025927 | Bacteria | 6278 |
| 144 | Ga0207686_10237351 | 3300025934 | Bacteria | 1325 |
| 145 | Ga0207709_10545088 | 3300025935 | Unclassified | 911 |
| 146 | Ga0207669_10270830 | 3300025937 | Bacteria | 1275 |
| 147 | Ga0207704_10354185 | 3300025938 | Bacteria | 1144 |
| 148 | Ga0207691_10254850 | 3300025940 | Bacteria | 1514 |
| 149 | Ga0207691_10400002 | 3300025940 | Bacteria | 1171 |
| 150 | Ga0207711_10023314 | 3300025941 | Bacteria | 5180 |
| 151 | Ga0207711_10971351 | 3300025941 | Bacteria | 788 |
| 152 | Ga0207689_10042016 | 3300025942 | Bacteria | 3783 |
| 153 | Ga0207667_10037381 | 3300025949 | Bacteria | 5190 |
| 154 | Ga0207667_10191962 | 3300025949 | Bacteria | 2096 |
| 155 | Ga0207667_10471983 | 3300025949 | Unclassified | 1274 |
| 156 | Ga0207667_10552660 | 3300025949 | Bacteria | 1164 |
| 157 | Ga0207651_10032852 | 3300025960 | Bacteria | 3338 |
| 158 | Ga0207712_10391431 | 3300025961 | Bacteria | 1166 |
| 159 | Ga0207712_11036208 | 3300025961 | Unclassified | 729 |
| 160 | Ga0207658_10246483 | 3300025986 | Bacteria | 1516 |
| 161 | Ga0207677_10760370 | 3300026023 | Bacteria | 864 |
| 162 | Ga0207677_10795850 | 3300026023 | Bacteria | 846 |
| 163 | Ga0207677_11067226 | 3300026023 | Unclassified | 735 |
| 164 | Ga0207703_10055509 | 3300026035 | Bacteria | 3223 |
| 165 | Ga0207703_10146184 | 3300026035 | Bacteria | 2056 |
| 166 | Ga0207639_10089904 | 3300026041 | Bacteria | 2455 |
| 167 | Ga0207639_10414927 | 3300026041 | Unclassified | 1216 |
| 168 | Ga0207678_10184919 | 3300026067 | Bacteria | 1780 |
| 169 | Ga0207702_10610606 | 3300026078 | Bacteria | 1071 |
| 170 | Ga0207702_10915872 | 3300026078 | Bacteria | 869 |
| 171 | Ga0207648_10011044 | 3300026089 | Bacteria | 8523 |
| 172 | Ga0207674_10020199 | 3300026116 | Bacteria | 7203 |
| 173 | Ga0207674_10325917 | 3300026116 | Bacteria | 1485 |
| 174 | Ga0207675_100629500 | 3300026118 | Bacteria | 1078 |
| 175 | Ga0207698_10189594 | 3300026142 | Bacteria | 1830 |
| 176 | Ga0268266_10001485 | 3300028379 | Bacteria | 27831 |
| 177 | Ga0268266_10023999 | 3300028379 | Bacteria | 5189 |
| 178 | Ga0268266_10349790 | 3300028379 | Bacteria | 1389 |
| 179 | Ga0268266_10449689 | 3300028379 | Bacteria | 1224 |
| 180 | Ga0268266_10671955 | 3300028379 | Bacteria | 997 |
| 181 | Ga0268265_10533709 | 3300028380 | Unclassified | 1111 |
| 182 | Ga0265338_10067478 | 3300028800 | Bacteria | 3089 |
| 183 | Ga0265328_10064854 | 3300031239 | Bacteria | 1342 |
| 184 | Ga0265340_10043777 | 3300031247 | Bacteria | 2193 |
| 185 | Ga0265339_10099373 | 3300031249 | Bacteria | 1517 |
| 186 | Ga0265331_10037361 | 3300031250 | Bacteria | 2379 |
| 187 | Ga0265316_10081358 | 3300031344 | Bacteria | 2483 |
| 188 | Ga0265314_10038455 | 3300031711 | Bacteria | 3456 |
| 189 | Ga0265342_10273246 | 3300031712 | Bacteria | 896 |
| 190 | Ga0307410_11284252 | 3300031852 | Unclassified | 640 |
| 191 | Ga0373936_0305889 | 3300035113 | Unclassified | 718 |
| 192 | Ga0373933_0357559 | 3300035724 | Bacteria | 949 |
| 193 | Ga0395899_0092312 | 3300037312 | Bacteria | 2193 |
| 194 | Ga0395899_0268325 | 3300037312 | Bacteria | 1165 |
| 195 | Ga0395900_0125609 | 3300037418 | Bacteria | 2631 |
| 196 | Ga0395898_0060118 | 3300037466 | Bacteria | 3694 |
| 197 | Ga0395898_0111854 | 3300037466 | Bacteria | 2617 |
| 198 | Ga0395901_0034033 | 3300038443 | Bacteria | 5261 |
| 199 | Ga0436365_0337108 | 3300039437 | Unclassified | 536 |
| 200 | Ga0466957_0056965 | 3300044842 | Bacteria | 2391 |
| 201 | Ga0466959_0409639 | 3300045049 | Bacteria | 921 |
| 202 | Ga0466967_0514725 | 3300045976 | Bacteria | 1175 |
| 203 | Ga0495585_0140128 | 3300046492 | Bacteria | 1267 |
| 204 | Ga0495652_0492369 | 3300046529 | Bacteria | 851 |
| 205 | Ga0495621_0156803 | 3300046539 | Bacteria | 898 |
| 206 | Ga0495622_0252443 | 3300046557 | Unclassified | 776 |
| 207 | Ga0495611_0058869 | 3300046648 | Bacteria | 1743 |
| 208 | Ga0495649_0254034 | 3300046694 | Bacteria | 902 |
| 209 | Ga0495600_0304019 | 3300046809 | Unclassified | 1006 |
| 210 | Ga0495600_0323931 | 3300046809 | Bacteria | 969 |
| 211 | Ga0495681_0197760 | 3300047470 | Unclassified | 817 |
| 212 | Ga0496121_0003678 | 3300048924 | Bacteria | 21541 |
| 213 | Ga0496126_0100442 | 3300048929 | Bacteria | 2532 |
| 214 | Ga0501033_0005160 | 3300049570 | Bacteria | 10384 |
| 215 | Ga0501033_0021542 | 3300049570 | Bacteria | 4862 |
| 216 | Ga0501033_0154807 | 3300049570 | Bacteria | 1652 |
| 217 | Ga0501034_0446564 | 3300049571 | Bacteria | 1211 |
| 218 | Ga0501036_0187611 | 3300049572 | Bacteria | 1740 |
| 219 | Ga0501037_0045442 | 3300049573 | Bacteria | 3224 |
| 220 | Ga0501037_0192246 | 3300049573 | Unclassified | 1445 |
| 221 | Ga0501046_0077403 | 3300049580 | Bacteria | 2575 |
| 222 | Ga0501046_0331601 | 3300049580 | Bacteria | 1107 |
| 223 | Ga0501047_0102234 | 3300049581 | Bacteria | 2745 |
| 224 | Ga0501047_0270044 | 3300049581 | Bacteria | 1547 |
| 225 | Ga0501047_0282947 | 3300049581 | Bacteria | 1503 |
| 226 | Ga0501047_0488033 | 3300049581 | Bacteria | 1059 |
| 227 | Ga0501047_1223599 | 3300049581 | Bacteria | 565 |
| 228 | Ga0501073_0082609 | 3300049589 | Bacteria | 2235 |
| 229 | Ga0501080_0428725 | 3300049742 | Bacteria | 1187 |
| 230 | Ga0501083_0499202 | 3300049744 | Bacteria | 792 |
| 231 | Ga0501035_0272207 | 3300049822 | Bacteria | 1433 |
| 232 | Ga0501035_0571560 | 3300049822 | Bacteria | 924 |
| 233 | Ga0501044_0030015 | 3300049823 | Bacteria | 5731 |
| 234 | Ga0500643_000021 | 3300053087 | Bacteria | 284326 |
| 235 | Ga0500555_028056 | 3300053103 | Unclassified | 1605 |
| 236 | Ga0500595_002097 | 3300053119 | Bacteria | 10192 |
| 237 | Ga0500595_037059 | 3300053119 | Bacteria | 1594 |
| 238 | Ga0500595_037265 | 3300053119 | Bacteria | 1587 |
| 239 | Ga0500642_0250172 | 3300053130 | Bacteria | 814 |
| 240 | Ga0500568_0059936 | 3300053139 | Bacteria | 1475 |
| 241 | Ga0501084_0851076 | 3300054114 | Bacteria | 767 |
| 242 | Ga0501082_0643836 | 3300060353 | Bacteria | 927 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10027810 | Ga0105240_1002781010 | 157 |
| 2 | 3300009093 | Ga0105240_10667468 | Ga0105240_106674682 | 157 |
| 3 | 3300013104 | Ga0157370_10045519 | Ga0157370_100455195 | 157 |
| 4 | 3300013105 | Ga0157369_10153538 | Ga0157369_101535382 | 157 |
| 5 | 3300039437 | Ga0436365_0337108 | Ga0436365_0337108_43_522 | 159 |
| 6 | 3300013104 | Ga0157370_10764905 | Ga0157370_107649052 | 160 |
| 7 | 3300025913 | Ga0207695_10056156 | Ga0207695_100561562 | 160 |
| 8 | 3300028800 | Ga0265338_10067478 | Ga0265338_100674782 | 160 |
| 9 | 3300031247 | Ga0265340_10043777 | Ga0265340_100437772 | 160 |
| 10 | 3300031249 | Ga0265339_10099373 | Ga0265339_100993732 | 160 |
| 11 | 3300031250 | Ga0265331_10037361 | Ga0265331_100373612 | 160 |
| 12 | 3300031344 | Ga0265316_10081358 | Ga0265316_100813582 | 160 |
| 13 | 3300031711 | Ga0265314_10038455 | Ga0265314_100384555 | 160 |
| 14 | 3300031712 | Ga0265342_10273246 | Ga0265342_102732462 | 160 |
| 15 | 3300053119 | Ga0500595_037059 | Ga0500595_037059_502_1023 | 166 |
| 16 | 3300053139 | Ga0500568_0059936 | Ga0500568_0059936_591_1118 | 168 |
| 17 | 3300025904 | Ga0207647_10096804 | Ga0207647_100968041 | 169 |
| 18 | 3300005327 | Ga0070658_10482376 | Ga0070658_104823761 | 170 |
| 19 | 3300005340 | Ga0070689_101563794 | Ga0070689_1015637941 | 170 |
| 20 | 3300006237 | Ga0097621_100105646 | Ga0097621_1001056462 | 170 |
| 21 | 3300006358 | Ga0068871_100417925 | Ga0068871_1004179252 | 170 |
| 22 | 3300009545 | Ga0105237_10372173 | Ga0105237_103721732 | 170 |
| 23 | 3300010375 | Ga0105239_10076054 | Ga0105239_100760543 | 170 |
| 24 | 3300010375 | Ga0105239_10231446 | Ga0105239_102314463 | 170 |
| 25 | 3300025913 | Ga0207695_10038116 | Ga0207695_100381162 | 170 |
| 26 | 3300025935 | Ga0207709_10545088 | Ga0207709_105450882 | 170 |
| 27 | 3300025949 | Ga0207667_10552660 | Ga0207667_105526602 | 170 |
| 28 | 3300026078 | Ga0207702_10915872 | Ga0207702_109158722 | 170 |
| 29 | 3300035113 | Ga0373936_0305889 | Ga0373936_0305889_183_701 | 170 |
| 30 | 3300035724 | Ga0373933_0357559 | Ga0373933_0357559_25_543 | 170 |
| 31 | 3300046557 | Ga0495622_0252443 | Ga0495622_0252443_185_703 | 170 |
| 32 | 3300046648 | Ga0495611_0058869 | Ga0495611_0058869_157_669 | 170 |
| 33 | 3300046809 | Ga0495600_0304019 | Ga0495600_0304019_250_768 | 170 |
| 34 | 3300049570 | Ga0501033_0005160 | Ga0501033_0005160_1103_1624 | 170 |
| 35 | 3300049573 | Ga0501037_0192246 | Ga0501037_0192246_768_1289 | 170 |
| 36 | 3300049581 | Ga0501047_0282947 | Ga0501047_0282947_523_1041 | 170 |
| 37 | 3300049581 | Ga0501047_0488033 | Ga0501047_0488033_431_952 | 170 |
| 38 | 3300049581 | Ga0501047_1223599 | Ga0501047_1223599_39_554 | 170 |
| 39 | 3300005327 | Ga0070658_10005945 | Ga0070658_1000594510 | 171 |
| 40 | 3300005339 | Ga0070660_100009282 | Ga0070660_1000092828 | 171 |
| 41 | 3300005458 | Ga0070681_10177507 | Ga0070681_101775072 | 171 |
| 42 | 3300005530 | Ga0070679_100122151 | Ga0070679_1001221514 | 171 |
| 43 | 3300005548 | Ga0070665_100000571 | Ga0070665_10000057143 | 171 |
| 44 | 3300005577 | Ga0068857_100566733 | Ga0068857_1005667332 | 171 |
| 45 | 3300005617 | Ga0068859_101595303 | Ga0068859_1015953031 | 171 |
| 46 | 3300005842 | Ga0068858_100041586 | Ga0068858_1000415863 | 171 |
| 47 | 3300006931 | Ga0097620_101595396 | Ga0097620_1015953962 | 171 |
| 48 | 3300009545 | Ga0105237_10083944 | Ga0105237_100839442 | 171 |
| 49 | 3300009545 | Ga0105237_10886263 | Ga0105237_108862631 | 171 |
| 50 | 3300010375 | Ga0105239_10469568 | Ga0105239_104695682 | 171 |
| 51 | 3300013105 | Ga0157369_10478863 | Ga0157369_104788631 | 171 |
| 52 | 3300013306 | Ga0163162_10026030 | Ga0163162_100260305 | 171 |
| 53 | 3300013306 | Ga0163162_10402460 | Ga0163162_104024602 | 171 |
| 54 | 3300014325 | Ga0163163_10000180 | Ga0163163_100001808 | 171 |
| 55 | 3300014325 | Ga0163163_10816482 | Ga0163163_108164822 | 171 |
| 56 | 3300014968 | Ga0157379_10001323 | Ga0157379_1000132310 | 171 |
| 57 | 3300014969 | Ga0157376_10792672 | Ga0157376_107926722 | 171 |
| 58 | 3300014969 | Ga0157376_11189091 | Ga0157376_111890912 | 171 |
| 59 | 3300025906 | Ga0207699_10259254 | Ga0207699_102592542 | 171 |
| 60 | 3300025909 | Ga0207705_10001833 | Ga0207705_100018336 | 171 |
| 61 | 3300025912 | Ga0207707_10335477 | Ga0207707_103354772 | 171 |
| 62 | 3300025919 | Ga0207657_10023389 | Ga0207657_100233896 | 171 |
| 63 | 3300025921 | Ga0207652_10015982 | Ga0207652_100159826 | 171 |
| 64 | 3300025937 | Ga0207669_10270830 | Ga0207669_102708302 | 171 |
| 65 | 3300026035 | Ga0207703_10055509 | Ga0207703_100555092 | 171 |
| 66 | 3300028379 | Ga0268266_10001485 | Ga0268266_1000148525 | 171 |
| 67 | 3300044842 | Ga0466957_0056965 | Ga0466957_0056965_1131_1646 | 171 |
| 68 | 3300045976 | Ga0466967_0514725 | Ga0466967_0514725_282_797 | 171 |
| 69 | 3300046529 | Ga0495652_0492369 | Ga0495652_0492369_227_742 | 171 |
| 70 | 3300046694 | Ga0495649_0254034 | Ga0495649_0254034_101_619 | 171 |
| 71 | 3300046809 | Ga0495600_0323931 | Ga0495600_0323931_344_859 | 171 |
| 72 | 3300047470 | Ga0495681_0197760 | Ga0495681_0197760_176_691 | 171 |
| 73 | 3300048924 | Ga0496121_0003678 | Ga0496121_0003678_5518_6039 | 171 |
| 74 | 3300049580 | Ga0501046_0331601 | Ga0501046_0331601_494_1009 | 171 |
| 75 | 3300049822 | Ga0501035_0571560 | Ga0501035_0571560_91_606 | 171 |
| 76 | 3300053103 | Ga0500555_028056 | Ga0500555_028056_748_1263 | 171 |
| 77 | 3300053119 | Ga0500595_002097 | Ga0500595_002097_6664_7182 | 171 |
| 78 | 3300003215 | JGI25153J46596_10000391 | JGI25153J46596_100003917 | 172 |
| 79 | 3300005327 | Ga0070658_10571496 | Ga0070658_105714961 | 172 |
| 80 | 3300005329 | Ga0070683_100367137 | Ga0070683_1003671372 | 172 |
| 81 | 3300005331 | Ga0070670_100116799 | Ga0070670_1001167993 | 172 |
| 82 | 3300005339 | Ga0070660_100208128 | Ga0070660_1002081282 | 172 |
| 83 | 3300005339 | Ga0070660_101183176 | Ga0070660_1011831761 | 172 |
| 84 | 3300005354 | Ga0070675_100634004 | Ga0070675_1006340042 | 172 |
| 85 | 3300005436 | Ga0070713_100356106 | Ga0070713_1003561062 | 172 |
| 86 | 3300005458 | Ga0070681_11641299 | Ga0070681_116412991 | 172 |
| 87 | 3300005530 | Ga0070679_100410880 | Ga0070679_1004108802 | 172 |
| 88 | 3300005539 | Ga0068853_100027964 | Ga0068853_1000279642 | 172 |
| 89 | 3300005539 | Ga0068853_100289464 | Ga0068853_1002894642 | 172 |
| 90 | 3300005539 | Ga0068853_100667879 | Ga0068853_1006678792 | 172 |
| 91 | 3300005539 | Ga0068853_100764907 | Ga0068853_1007649072 | 172 |
| 92 | 3300005548 | Ga0070665_100004008 | Ga0070665_10000400811 | 172 |
| 93 | 3300005548 | Ga0070665_100063383 | Ga0070665_1000633832 | 172 |
| 94 | 3300005548 | Ga0070665_100490583 | Ga0070665_1004905832 | 172 |
| 95 | 3300005563 | Ga0068855_100009112 | Ga0068855_1000091127 | 172 |
| 96 | 3300005563 | Ga0068855_100204271 | Ga0068855_1002042714 | 172 |
| 97 | 3300005563 | Ga0068855_100562225 | Ga0068855_1005622252 | 172 |
| 98 | 3300005577 | Ga0068857_100110896 | Ga0068857_1001108961 | 172 |
| 99 | 3300005578 | Ga0068854_100990513 | Ga0068854_1009905131 | 172 |
| 100 | 3300005616 | Ga0068852_100223731 | Ga0068852_1002237312 | 172 |
| 101 | 3300006038 | Ga0075365_10561668 | Ga0075365_105616682 | 172 |
| 102 | 3300006237 | Ga0097621_100102228 | Ga0097621_1001022284 | 172 |
| 103 | 3300006237 | Ga0097621_100478235 | Ga0097621_1004782352 | 172 |
| 104 | 3300006358 | Ga0068871_100260099 | Ga0068871_1002600992 | 172 |
| 105 | 3300006358 | Ga0068871_100566778 | Ga0068871_1005667782 | 172 |
| 106 | 3300006881 | Ga0068865_100293880 | Ga0068865_1002938802 | 172 |
| 107 | 3300009093 | Ga0105240_10016248 | Ga0105240_1001624810 | 172 |
| 108 | 3300009093 | Ga0105240_10785351 | Ga0105240_107853512 | 172 |
| 109 | 3300009174 | Ga0105241_10076653 | Ga0105241_100766532 | 172 |
| 110 | 3300009174 | Ga0105241_10271143 | Ga0105241_102711432 | 172 |
| 111 | 3300009176 | Ga0105242_10147785 | Ga0105242_101477851 | 172 |
| 112 | 3300009545 | Ga0105237_10154180 | Ga0105237_101541802 | 172 |
| 113 | 3300009545 | Ga0105237_10177556 | Ga0105237_101775563 | 172 |
| 114 | 3300009551 | Ga0105238_10018323 | Ga0105238_1001832310 | 172 |
| 115 | 3300009551 | Ga0105238_10024629 | Ga0105238_100246292 | 172 |
| 116 | 3300009551 | Ga0105238_12209382 | Ga0105238_122093821 | 172 |
| 117 | 3300009553 | Ga0105249_10573519 | Ga0105249_105735192 | 172 |
| 118 | 3300010375 | Ga0105239_10376959 | Ga0105239_103769591 | 172 |
| 119 | 3300010375 | Ga0105239_10396847 | Ga0105239_103968472 | 172 |
| 120 | 3300010375 | Ga0105239_10816939 | Ga0105239_108169392 | 172 |
| 121 | 3300010375 | Ga0105239_10904301 | Ga0105239_109043012 | 172 |
| 122 | 3300014326 | Ga0157380_10331116 | Ga0157380_103311162 | 172 |
| 123 | 3300014969 | Ga0157376_10065383 | Ga0157376_100653832 | 172 |
| 124 | 3300025230 | Ga0209563_115541 | Ga0209563_1155412 | 172 |
| 125 | 3300025297 | Ga0209758_1000185 | Ga0209758_100018577 | 172 |
| 126 | 3300025903 | Ga0207680_10012849 | Ga0207680_100128494 | 172 |
| 127 | 3300025909 | Ga0207705_10058403 | Ga0207705_100584032 | 172 |
| 128 | 3300025911 | Ga0207654_10022056 | Ga0207654_100220563 | 172 |
| 129 | 3300025911 | Ga0207654_10200002 | Ga0207654_102000022 | 172 |
| 130 | 3300025913 | Ga0207695_10037046 | Ga0207695_100370464 | 172 |
| 131 | 3300025913 | Ga0207695_10049637 | Ga0207695_100496371 | 172 |
| 132 | 3300025913 | Ga0207695_10080777 | Ga0207695_100807773 | 172 |
| 133 | 3300025914 | Ga0207671_10026238 | Ga0207671_100262382 | 172 |
| 134 | 3300025914 | Ga0207671_10079205 | Ga0207671_100792052 | 172 |
| 135 | 3300025919 | Ga0207657_10133736 | Ga0207657_101337362 | 172 |
| 136 | 3300025921 | Ga0207652_10045857 | Ga0207652_100458575 | 172 |
| 137 | 3300025921 | Ga0207652_10113969 | Ga0207652_101139693 | 172 |
| 138 | 3300025924 | Ga0207694_10298314 | Ga0207694_102983142 | 172 |
| 139 | 3300025925 | Ga0207650_10226319 | Ga0207650_102263192 | 172 |
| 140 | 3300025938 | Ga0207704_10354185 | Ga0207704_103541852 | 172 |
| 141 | 3300025940 | Ga0207691_10400002 | Ga0207691_104000021 | 172 |
| 142 | 3300025941 | Ga0207711_10971351 | Ga0207711_109713512 | 172 |
| 143 | 3300025949 | Ga0207667_10037381 | Ga0207667_100373816 | 172 |
| 144 | 3300025949 | Ga0207667_10191962 | Ga0207667_101919621 | 172 |
| 145 | 3300025949 | Ga0207667_10471983 | Ga0207667_104719832 | 172 |
| 146 | 3300025961 | Ga0207712_11036208 | Ga0207712_110362081 | 172 |
| 147 | 3300026023 | Ga0207677_11067226 | Ga0207677_110672261 | 172 |
| 148 | 3300026041 | Ga0207639_10089904 | Ga0207639_100899043 | 172 |
| 149 | 3300026041 | Ga0207639_10414927 | Ga0207639_104149272 | 172 |
| 150 | 3300026067 | Ga0207678_10184919 | Ga0207678_101849192 | 172 |
| 151 | 3300026116 | Ga0207674_10020199 | Ga0207674_100201991 | 172 |
| 152 | 3300026142 | Ga0207698_10189594 | Ga0207698_101895942 | 172 |
| 153 | 3300028379 | Ga0268266_10349790 | Ga0268266_103497902 | 172 |
| 154 | 3300028379 | Ga0268266_10449689 | Ga0268266_104496891 | 172 |
| 155 | 3300028379 | Ga0268266_10671955 | Ga0268266_106719552 | 172 |
| 156 | 3300028380 | Ga0268265_10533709 | Ga0268265_105337092 | 172 |
| 157 | 3300031239 | Ga0265328_10064854 | Ga0265328_100648541 | 172 |
| 158 | 3300037312 | Ga0395899_0092312 | Ga0395899_0092312_654_1181 | 172 |
| 159 | 3300037312 | Ga0395899_0268325 | Ga0395899_0268325_47_676 | 172 |
| 160 | 3300037418 | Ga0395900_0125609 | Ga0395900_0125609_1526_2155 | 172 |
| 161 | 3300037466 | Ga0395898_0060118 | Ga0395898_0060118_815_1342 | 172 |
| 162 | 3300037466 | Ga0395898_0111854 | Ga0395898_0111854_716_1345 | 172 |
| 163 | 3300038443 | Ga0395901_0034033 | Ga0395901_0034033_4037_4666 | 172 |
| 164 | 3300045049 | Ga0466959_0409639 | Ga0466959_0409639_333_851 | 172 |
| 165 | 3300046492 | Ga0495585_0140128 | Ga0495585_0140128_90_611 | 172 |
| 166 | 3300046539 | Ga0495621_0156803 | Ga0495621_0156803_191_712 | 172 |
| 167 | 3300048929 | Ga0496126_0100442 | Ga0496126_0100442_488_1012 | 172 |
| 168 | 3300049581 | Ga0501047_0270044 | Ga0501047_0270044_168_692 | 172 |
| 169 | 3300049589 | Ga0501073_0082609 | Ga0501073_0082609_1313_1942 | 172 |
| 170 | 3300049744 | Ga0501083_0499202 | Ga0501083_0499202_101_730 | 172 |
| 171 | 3300053119 | Ga0500595_037265 | Ga0500595_037265_812_1336 | 172 |
| 172 | 3300053130 | Ga0500642_0250172 | Ga0500642_0250172_129_647 | 172 |
| 173 | 3300005328 | Ga0070676_10007422 | Ga0070676_100074227 | 173 |
| 174 | 3300005334 | Ga0068869_100046082 | Ga0068869_1000460824 | 173 |
| 175 | 3300005338 | Ga0068868_100240482 | Ga0068868_1002404822 | 173 |
| 176 | 3300005354 | Ga0070675_100264876 | Ga0070675_1002648762 | 173 |
| 177 | 3300005364 | Ga0070673_100064016 | Ga0070673_1000640162 | 173 |
| 178 | 3300005438 | Ga0070701_10152163 | Ga0070701_101521631 | 173 |
| 179 | 3300005459 | Ga0068867_100033182 | Ga0068867_1000331822 | 173 |
| 180 | 3300005543 | Ga0070672_100303866 | Ga0070672_1003038662 | 173 |
| 181 | 3300009098 | Ga0105245_10021803 | Ga0105245_100218034 | 173 |
| 182 | 3300009176 | Ga0105242_10218740 | Ga0105242_102187402 | 173 |
| 183 | 3300010375 | Ga0105239_10270944 | Ga0105239_102709442 | 173 |
| 184 | 3300013100 | Ga0157373_10075541 | Ga0157373_100755413 | 173 |
| 185 | 3300013308 | Ga0157375_11112976 | Ga0157375_111129761 | 173 |
| 186 | 3300014326 | Ga0157380_11602895 | Ga0157380_116028951 | 173 |
| 187 | 3300025901 | Ga0207688_10101914 | Ga0207688_101019142 | 173 |
| 188 | 3300025907 | Ga0207645_10010321 | Ga0207645_100103211 | 173 |
| 189 | 3300025912 | Ga0207707_10422851 | Ga0207707_104228511 | 173 |
| 190 | 3300025926 | Ga0207659_10209626 | Ga0207659_102096262 | 173 |
| 191 | 3300025927 | Ga0207687_10009766 | Ga0207687_100097665 | 173 |
| 192 | 3300025934 | Ga0207686_10237351 | Ga0207686_102373512 | 173 |
| 193 | 3300025940 | Ga0207691_10254850 | Ga0207691_102548502 | 173 |
| 194 | 3300025942 | Ga0207689_10042016 | Ga0207689_100420165 | 173 |
| 195 | 3300025960 | Ga0207651_10032852 | Ga0207651_100328522 | 173 |
| 196 | 3300026023 | Ga0207677_10795850 | Ga0207677_107958502 | 173 |
| 197 | 3300026089 | Ga0207648_10011044 | Ga0207648_100110445 | 173 |
| 198 | 3300049570 | Ga0501033_0154807 | Ga0501033_0154807_759_1283 | 173 |
| 199 | 3300003214 | JGI25165J46597_1000013 | JGI25165J46597_1000013393 | 174 |
| 200 | 3300005335 | Ga0070666_10237677 | Ga0070666_102376772 | 174 |
| 201 | 3300005367 | Ga0070667_100329284 | Ga0070667_1003292842 | 174 |
| 202 | 3300005548 | Ga0070665_100018597 | Ga0070665_1000185973 | 174 |
| 203 | 3300005548 | Ga0070665_100865516 | Ga0070665_1008655162 | 174 |
| 204 | 3300005617 | Ga0068859_100987000 | Ga0068859_1009870001 | 174 |
| 205 | 3300005842 | Ga0068858_100027112 | Ga0068858_1000271122 | 174 |
| 206 | 3300006931 | Ga0097620_100987038 | Ga0097620_1009870381 | 174 |
| 207 | 3300009174 | Ga0105241_10512018 | Ga0105241_105120182 | 174 |
| 208 | 3300009177 | Ga0105248_10242411 | Ga0105248_102424113 | 174 |
| 209 | 3300010375 | Ga0105239_10348468 | Ga0105239_103484682 | 174 |
| 210 | 3300013296 | Ga0157374_10837846 | Ga0157374_108378461 | 174 |
| 211 | 3300013297 | Ga0157378_10047569 | Ga0157378_100475693 | 174 |
| 212 | 3300013306 | Ga0163162_10526879 | Ga0163162_105268792 | 174 |
| 213 | 3300021441 | Ga0213871_10107133 | Ga0213871_101071331 | 174 |
| 214 | 3300025231 | Ga0207427_104100 | Ga0207427_1041002 | 174 |
| 215 | 3300025261 | Ga0209233_1000013 | Ga0209233_1000013639 | 174 |
| 216 | 3300025261 | Ga0209233_1006408 | Ga0209233_10064086 | 174 |
| 217 | 3300025903 | Ga0207680_10326264 | Ga0207680_103262642 | 174 |
| 218 | 3300025911 | Ga0207654_10207792 | Ga0207654_102077922 | 174 |
| 219 | 3300025913 | Ga0207695_10330070 | Ga0207695_103300702 | 174 |
| 220 | 3300025914 | Ga0207671_10042964 | Ga0207671_100429644 | 174 |
| 221 | 3300025941 | Ga0207711_10023314 | Ga0207711_100233147 | 174 |
| 222 | 3300025961 | Ga0207712_10391431 | Ga0207712_103914312 | 174 |
| 223 | 3300025986 | Ga0207658_10246483 | Ga0207658_102464832 | 174 |
| 224 | 3300026023 | Ga0207677_10760370 | Ga0207677_107603702 | 174 |
| 225 | 3300026035 | Ga0207703_10146184 | Ga0207703_101461842 | 174 |
| 226 | 3300026078 | Ga0207702_10610606 | Ga0207702_106106062 | 174 |
| 227 | 3300026116 | Ga0207674_10325917 | Ga0207674_103259172 | 174 |
| 228 | 3300026118 | Ga0207675_100629500 | Ga0207675_1006295002 | 174 |
| 229 | 3300028379 | Ga0268266_10023999 | Ga0268266_100239992 | 174 |
| 230 | 3300031852 | Ga0307410_11284252 | Ga0307410_112842521 | 174 |
| 231 | 3300049570 | Ga0501033_0021542 | Ga0501033_0021542_1516_2046 | 174 |
| 232 | 3300049571 | Ga0501034_0446564 | Ga0501034_0446564_149_679 | 174 |
| 233 | 3300049572 | Ga0501036_0187611 | Ga0501036_0187611_692_1222 | 174 |
| 234 | 3300049573 | Ga0501037_0045442 | Ga0501037_0045442_2044_2574 | 174 |
| 235 | 3300049580 | Ga0501046_0077403 | Ga0501046_0077403_929_1459 | 174 |
| 236 | 3300049581 | Ga0501047_0102234 | Ga0501047_0102234_927_1457 | 174 |
| 237 | 3300049742 | Ga0501080_0428725 | Ga0501080_0428725_93_623 | 174 |
| 238 | 3300049822 | Ga0501035_0272207 | Ga0501035_0272207_317_847 | 174 |
| 239 | 3300049823 | Ga0501044_0030015 | Ga0501044_0030015_3513_4043 | 174 |
| 240 | 3300053087 | Ga0500643_000021 | Ga0500643_000021_63724_64269 | 174 |
| 241 | 3300054114 | Ga0501084_0851076 | Ga0501084_0851076_104_682 | 174 |
| 242 | 3300060353 | Ga0501082_0643836 | Ga0501082_0643836_272_814 | 174 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dtd-assembly1.cif.gz_G-2 | crystal structure of invasion associated protein b from bartonella henselae | 0.7129 | 30 | 174 |
| 3dtd-assembly1.cif.gz_C-2 | crystal structure of invasion associated protein b from bartonella henselae | 0.7122 | 30 | 173 |
| 3dtd-assembly1.cif.gz_F-1 | crystal structure of invasion associated protein b from bartonella henselae | 0.6977 | 30 | 174 |
| 3dtd-assembly1.cif.gz_G-2 | crystal structure of invasion associated protein b from bartonella henselae | 0.6959 | 30 | 174 |
| 3dtd-assembly1.cif.gz_C-2 | crystal structure of invasion associated protein b from bartonella henselae | 0.6845 | 30 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZKP6_182_276_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.751 | 25 | 56 | 3.30.200.20 |
| 3dtdF00 | Mainly Beta;Sandwich;Immunoglobulin-like;Invasion associated locus B (IalB) protein | 0.6977 | 30 | 174 | 2.60.40.1880 |
| 3dtdF00 | Mainly Beta;Sandwich;Immunoglobulin-like;Invasion associated locus B (IalB) protein | 0.6812 | 30 | 174 | 2.60.40.1880 |
| af_Q53QC7_413_508_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.6575 | 27 | 52 | 3.30.200.20 |
| af_Q2R148_105_188_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.6489 | 20 | 56 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9YUF1-F1-model_v4 | Invasion associated locus B family protein | 0.9502 | 21 | 172 |
|
| AF-A0A2E6W1X7-F1-model_v4 | Uncharacterized protein | 0.9453 | 48 | 174 |
|
| AF-A0A418WER9-F1-model_v4 | Uncharacterized protein | 0.9445 | 29 | 174 |
|
| AF-A0A847JCV2-F1-model_v4 | Invasion associated locus B family protein | 0.944 | 28 | 172 |
|
| AF-A0A537R5T5-F1-model_v4 | Uncharacterized protein | 0.9426 | 48 | 173 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar