F354354

General Info

Members Datasets Scaffolds Average Seq Length
242 140 484 227

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10014293|Ga0070677_100142933
Length 245
Sequence MFCQVGVRRNRRHNPASMFTLEQVVPWGRSFDEYCRMFSLSDDDLSRRILGCGDGPAGFNAEATRRGTAVISCDPIYQWDSSQIQSRIAATYDTVLDQARRNADEFVWDSITSVEELGAVRMAAMEKFLADYSSGTAEGRYLTAALPALPFTDGSFDLALCSHLLFLYSVQLDEHFHDRSIRELCRVAREVRIFPLLALGGQPSPYVDRVVEGMRAAGHGVSIERVPYEFQRGGNEMMRIQAPRQ

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
116 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
136 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
137 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
138 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 0.41
Rhizosphere 97.52
Stem 0
Stem Tuber 0
Unclassified 21.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10014293 3300005333 Bacteria 2793
2 Ga0065704_10130798 3300005289 Bacteria 1615
3 Ga0065704_10236292 3300005289 Unclassified 1028
4 Ga0065712_10234390 3300005290 Unclassified 1002
5 Ga0065715_10167979 3300005293 Unclassified 1565
6 Ga0065715_10397678 3300005293 Unclassified 876
7 Ga0065707_10306444 3300005295 Unclassified 993
8 Ga0070676_10030572 3300005328 Bacteria 3072
9 Ga0070690_100005844 3300005330 Bacteria 6933
10 Ga0070690_100047885 3300005330 Bacteria 2720
11 Ga0070670_100041118 3300005331 Unclassified 3973
12 Ga0070677_10030306 3300005333 Bacteria 2059
13 Ga0070677_10030850 3300005333 Bacteria 2043
14 Ga0070677_10251704 3300005333 Unclassified 877
15 Ga0068869_100000281 3300005334 Bacteria 26976
16 Ga0068869_100092622 3300005334 Unclassified 2275
17 Ga0068869_100138477 3300005334 Unclassified 1877
18 Ga0068869_100228876 3300005334 Bacteria 1476
19 Ga0070666_10082025 3300005335 Bacteria 2205
20 Ga0068868_100597152 3300005338 Unclassified 978
21 Ga0070689_100537581 3300005340 Unclassified 1005
22 Ga0070687_100169988 3300005343 Unclassified 1297
23 Ga0070661_100363933 3300005344 Unclassified 1137
24 Ga0070669_100008116 3300005353 Bacteria 7500
25 Ga0070669_100044451 3300005353 Bacteria 3237
26 Ga0070669_100087518 3300005353 Bacteria 2329
27 Ga0070675_100000746 3300005354 Bacteria 22610
28 Ga0070675_100010631 3300005354 Bacteria 7193
29 Ga0070675_100446243 3300005354 Unclassified 1160
30 Ga0070671_100053392 3300005355 Bacteria 3360
31 Ga0070671_100625883 3300005355 Unclassified 931
32 Ga0070674_100073904 3300005356 Bacteria 2418
33 Ga0070674_100110961 3300005356 Unclassified 2013
34 Ga0070674_100143708 3300005356 Unclassified 1794
35 Ga0070674_100521249 3300005356 Bacteria 993
36 Ga0070673_100011885 3300005364 Bacteria 5961
37 Ga0070673_100019141 3300005364 Bacteria 4911
38 Ga0070673_100034496 3300005364 Bacteria 3830
39 Ga0070688_100081808 3300005365 Bacteria 2092
40 Ga0070688_100540246 3300005365 Unclassified 885
41 Ga0070667_100050466 3300005367 Bacteria 3507
42 Ga0070701_10005715 3300005438 Bacteria 5169
43 Ga0070711_100105991 3300005439 Bacteria 2054
44 Ga0070705_100228276 3300005440 Bacteria 1293
45 Ga0070700_100013478 3300005441 Bacteria 4592
46 Ga0070694_100033366 3300005444 Bacteria 3387
47 Ga0070694_100058678 3300005444 Bacteria 2619
48 Ga0070663_100488643 3300005455 Bacteria 1020
49 Ga0070663_100538974 3300005455 Unclassified 974
50 Ga0070678_100042469 3300005456 Bacteria 3232
51 Ga0070678_100137518 3300005456 Bacteria 1950
52 Ga0070662_100088621 3300005457 Bacteria 2319
53 Ga0070662_100336247 3300005457 Unclassified 1234
54 Ga0068867_100013375 3300005459 Bacteria 5814
55 Ga0068867_100051529 3300005459 Bacteria 3036
56 Ga0070685_10312303 3300005466 Unclassified 1063
57 Ga0070697_100277312 3300005536 Bacteria 1438
58 Ga0070672_100006741 3300005543 Bacteria 7745
59 Ga0070672_100066633 3300005543 Bacteria 2851
60 Ga0070672_100076875 3300005543 Bacteria 2668
61 Ga0070686_100604210 3300005544 Unclassified 865
62 Ga0070695_100003922 3300005545 Bacteria 8691
63 Ga0070696_100048376 3300005546 Bacteria 2952
64 Ga0070704_100000676 3300005549 Bacteria 16554
65 Ga0070664_100006355 3300005564 Bacteria 9534
66 Ga0070664_100008718 3300005564 Bacteria 8211
67 Ga0070664_100261149 3300005564 Bacteria 1558
68 Ga0068857_100113181 3300005577 Unclassified 2440
69 Ga0068854_100251927 3300005578 Bacteria 1410
70 Ga0068854_100456475 3300005578 Unclassified 1068
71 Ga0070702_100240701 3300005615 Bacteria 1221
72 Ga0068859_100210069 3300005617 Bacteria 2032
73 Ga0068859_100216097 3300005617 Bacteria 2005
74 Ga0068859_100286182 3300005617 Unclassified 1741
75 Ga0068864_100044825 3300005618 Bacteria 3793
76 Ga0068866_10131727 3300005718 Bacteria 1423
77 Ga0068861_100021149 3300005719 Bacteria 4675
78 Ga0068861_100033854 3300005719 Bacteria 3773
79 Ga0068861_100040372 3300005719 Bacteria 3490
80 Ga0068861_100086794 3300005719 Bacteria 2461
81 Ga0068861_100261973 3300005719 Bacteria 1480
82 Ga0068861_100822677 3300005719 Unclassified 873
83 Ga0068870_10011088 3300005840 Unclassified 4165
84 Ga0068863_100353277 3300005841 Bacteria 1432
85 Ga0068863_100402156 3300005841 Bacteria 1340
86 Ga0068858_100091158 3300005842 Unclassified 2837
87 Ga0068860_100243880 3300005843 Bacteria 1748
88 Ga0081455_10072596 3300005937 Bacteria 2848
89 Ga0081538_10033144 3300005981 Bacteria 3445
90 Ga0097621_100000826 3300006237 Bacteria 21900
91 Ga0097621_100132577 3300006237 Unclassified 2122
92 Ga0097621_100253054 3300006237 Bacteria 1543
93 Ga0097621_100414399 3300006237 Bacteria 1208
94 Ga0068871_100042584 3300006358 Bacteria 3646
95 Ga0068871_100131882 3300006358 Bacteria 2119
96 Ga0068871_100641481 3300006358 Bacteria 969
97 Ga0075428_100006537 3300006844 Bacteria 12961
98 Ga0075428_100424121 3300006844 Bacteria 1425
99 Ga0075430_100467962 3300006846 Bacteria 1040
100 Ga0075433_10204870 3300006852 Bacteria 1753
101 Ga0075434_100028323 3300006871 Bacteria 5502
102 Ga0075429_100666767 3300006880 Unclassified 911
103 Ga0068865_100260785 3300006881 Bacteria 1372
104 Ga0097620_100210064 3300006931 Bacteria 2032
105 Ga0097620_100216093 3300006931 Bacteria 2005
106 Ga0097620_100286174 3300006931 Unclassified 1741
107 Ga0075435_100030923 3300007076 Bacteria 4214
108 Ga0111539_10016998 3300009094 Bacteria 9003
109 Ga0111539_10025517 3300009094 Bacteria 7246
110 Ga0111539_10151344 3300009094 Unclassified 2716
111 Ga0114129_10018426 3300009147 Bacteria 9943
112 Ga0105243_10034127 3300009148 Bacteria 3938
113 Ga0105243_10598768 3300009148 Bacteria 1061
114 Ga0105243_10617031 3300009148 Bacteria 1046
115 Ga0105242_10024667 3300009176 Bacteria 4751
116 Ga0105242_10205720 3300009176 Bacteria 1751
117 Ga0105248_10141061 3300009177 Bacteria 2718
118 Ga0105248_10293602 3300009177 Bacteria 1830
119 Ga0105248_11194993 3300009177 Bacteria 860
120 Ga0105249_10056047 3300009553 Bacteria 3608
121 Ga0105249_10181542 3300009553 Bacteria 2048
122 Ga0105249_10586523 3300009553 Bacteria 1168
123 Ga0105249_10939981 3300009553 Bacteria 932
124 Ga0105246_10007006 3300011119 Bacteria 6898
125 Ga0157375_10034956 3300013308 Unclassified 4792
126 Ga0163163_10023050 3300014325 Bacteria 5903
127 Ga0157380_10001010 3300014326 Bacteria 17895
128 Ga0157380_10002610 3300014326 Bacteria 12193
129 Ga0157380_10127650 3300014326 Bacteria 2164
130 Ga0157380_10328859 3300014326 Bacteria 1420
131 Ga0157380_10427283 3300014326 Unclassified 1265
132 Ga0157377_10495150 3300014745 Unclassified 853
133 Ga0157379_10097964 3300014968 Bacteria 2633
134 Ga0157376_10025478 3300014969 Bacteria 4659
135 Ga0157376_10237581 3300014969 Bacteria 1696
136 Ga0157376_10572100 3300014969 Unclassified 1121
137 Ga0163161_10070709 3300017792 Bacteria 2552
138 Ga0207697_10000992 3300025315 Bacteria 15867
139 Ga0207682_10001013 3300025893 Bacteria 13038
140 Ga0207682_10012572 3300025893 Bacteria 3304
141 Ga0207680_10016589 3300025903 Bacteria 3871
142 Ga0207680_10284355 3300025903 Bacteria 1150
143 Ga0207645_10000745 3300025907 Bacteria 27111
144 Ga0207645_10001958 3300025907 Bacteria 16571
145 Ga0207643_10000265 3300025908 Bacteria 36501
146 Ga0207643_10008562 3300025908 Bacteria 5487
147 Ga0207643_10020914 3300025908 Unclassified 3592
148 Ga0207643_10363475 3300025908 Bacteria 910
149 Ga0207662_10278155 3300025918 Bacteria 1107
150 Ga0207649_10184340 3300025920 Unclassified 1463
151 Ga0207681_10018525 3300025923 Unclassified 4387
152 Ga0207681_10027532 3300025923 Bacteria 3676
153 Ga0207681_10134559 3300025923 Bacteria 1832
154 Ga0207681_10177812 3300025923 Bacteria 1618
155 Ga0207650_10052040 3300025925 Unclassified 3032
156 Ga0207650_10208138 3300025925 Unclassified 1570
157 Ga0207659_10009300 3300025926 Bacteria 6136
158 Ga0207659_10018694 3300025926 Bacteria 4547
159 Ga0207659_10185827 3300025926 Unclassified 1650
160 Ga0207706_10047681 3300025933 Bacteria 3790
161 Ga0207706_10727453 3300025933 Unclassified 847
162 Ga0207686_10019452 3300025934 Bacteria 3863
163 Ga0207709_10007437 3300025935 Bacteria 6099
164 Ga0207709_10419267 3300025935 Bacteria 1028
165 Ga0207670_10108945 3300025936 Unclassified 1992
166 Ga0207669_10026004 3300025937 Bacteria 3175
167 Ga0207669_10039012 3300025937 Bacteria 2740
168 Ga0207669_10053378 3300025937 Bacteria 2434
169 Ga0207669_10238857 3300025937 Unclassified 1345
170 Ga0207704_10263528 3300025938 Bacteria 1301
171 Ga0207691_10011448 3300025940 Bacteria 8512
172 Ga0207691_10080342 3300025940 Bacteria 2933
173 Ga0207691_10094352 3300025940 Bacteria 2678
174 Ga0207711_10479148 3300025941 Bacteria 1159
175 Ga0207689_10000569 3300025942 Bacteria 35278
176 Ga0207689_10006167 3300025942 Bacteria 10608
177 Ga0207689_10046797 3300025942 Bacteria 3574
178 Ga0207689_10091287 3300025942 Unclassified 2502
179 Ga0207679_10042348 3300025945 Unclassified 3272
180 Ga0207651_10016043 3300025960 Bacteria 4374
181 Ga0207651_10041672 3300025960 Bacteria 3049
182 Ga0207651_10044730 3300025960 Bacteria 2965
183 Ga0207668_10179839 3300025972 Bacteria 1667
184 Ga0207640_10104163 3300025981 Bacteria 1997
185 Ga0207677_10310878 3300026023 Bacteria 1306
186 Ga0207703_10056097 3300026035 Bacteria 3207
187 Ga0207703_10286960 3300026035 Bacteria 1497
188 Ga0207708_10025776 3300026075 Bacteria 4449
189 Ga0207641_10163884 3300026088 Bacteria 2023
190 Ga0207641_10976586 3300026088 Bacteria 843
191 Ga0207648_10004794 3300026089 Bacteria 13810
192 Ga0207648_10028594 3300026089 Bacteria 4942
193 Ga0207676_10023527 3300026095 Bacteria 4547
194 Ga0207674_10122214 3300026116 Bacteria 2570
195 Ga0207675_100003010 3300026118 Bacteria 16526
196 Ga0207675_100033821 3300026118 Bacteria 4763
197 Ga0207675_100063582 3300026118 Bacteria 3448
198 Ga0207675_100066653 3300026118 Bacteria 3365
199 Ga0207675_100256906 3300026118 Bacteria 1692
200 Ga0207675_100353061 3300026118 Unclassified 1441
201 Ga0207683_10012627 3300026121 Bacteria 7206
202 Ga0207683_10057299 3300026121 Bacteria 3420
203 Ga0268265_10982034 3300028380 Bacteria 833
204 Ga0268264_10209728 3300028381 Bacteria 1788
205 Ga0373932_0074061 3300035112 Bacteria 1062
206 Ga0373931_0085140 3300035691 Bacteria 1752
207 Ga0400490_00690 3300038726 Bacteria 1590
208 Ga0451853_0666233 3300041512 Bacteria 1204
209 Ga0439435_0006708 3300042436 Bacteria 2598
210 Ga0439435_0036880 3300042436 Bacteria 1353
211 Ga0439444_0059719 3300042437 Bacteria 793
212 Ga0439464_0075998 3300042439 Bacteria 998
213 Ga0451577_0806326 3300042876 Unclassified 848
214 Ga0453684_0003883 3300044712 Bacteria 32868
215 Ga0453684_0036782 3300044712 Bacteria 6738
216 Ga0453684_0043158 3300044712 Bacteria 6065
217 Ga0451576_0003434 3300045051 Bacteria 21780
218 Ga0451576_0004279 3300045051 Bacteria 18699
219 Ga0451576_0017910 3300045051 Bacteria 7778
220 Ga0496106_0701382 3300048909 Unclassified 807
221 Ga0501031_0060389 3300049568 Bacteria 2471
222 Ga0501034_0135817 3300049571 Bacteria 2440
223 Ga0501036_0199112 3300049572 Bacteria 1685
224 Ga0501041_0038087 3300049577 Bacteria 2915
225 Ga0501042_0136708 3300049578 Bacteria 1767
226 Ga0501048_0060857 3300049582 Bacteria 2675
227 Ga0501072_0321971 3300049588 Bacteria 1229
228 Ga0501076_0702009 3300049592 Bacteria 835
229 Ga0501081_0259939 3300049743 Bacteria 1268
230 nmdc:mga00v17_277023_c1 3300050491 Bacteria 1089
231 nmdc:mga05p37_44750_c1 3300050507 Bacteria 5446
232 nmdc:mga0n895_74843_c1 3300050512 Bacteria 3365
233 nmdc:mga0rr50_23587_c1 3300050513 Bacteria 4245
234 nmdc:mga0rr50_644334_c1 3300050513 Unclassified 904
235 nmdc:mga0a205_26649_c1 3300050515 Bacteria 5514
236 nmdc:mga0a205_27165_c1 3300050515 Bacteria 5465
237 Ga0500641_0000813 3300053096 Bacteria 11261
238 Ga0590071_001214 3300059421 Bacteria 6961
239 Ga0590075_001407 3300059424 Bacteria 6040
240 Ga0590077_036557 3300059426 Bacteria 1084
241 Ga0501082_0092385 3300060353 Bacteria 2614
242 8001523606 8001522603 Bacteria 4726425
243 Ga0070677_10014293
244 Ga0065704_10130798
245 Ga0065704_10236292
246 Ga0065712_10234390
247 Ga0065715_10167979
248 Ga0065715_10397678
249 Ga0065707_10306444
250 Ga0070676_10030572
251 Ga0070690_100005844
252 Ga0070690_100047885
253 Ga0070670_100041118
254 Ga0070677_10030306
255 Ga0070677_10030850
256 Ga0070677_10251704
257 Ga0068869_100000281
258 Ga0068869_100092622
259 Ga0068869_100138477
260 Ga0068869_100228876
261 Ga0070666_10082025
262 Ga0068868_100597152
263 Ga0070689_100537581
264 Ga0070687_100169988
265 Ga0070661_100363933
266 Ga0070669_100008116
267 Ga0070669_100044451
268 Ga0070669_100087518
269 Ga0070675_100000746
270 Ga0070675_100010631
271 Ga0070675_100446243
272 Ga0070671_100053392
273 Ga0070671_100625883
274 Ga0070674_100073904
275 Ga0070674_100110961
276 Ga0070674_100143708
277 Ga0070674_100521249
278 Ga0070673_100011885
279 Ga0070673_100019141
280 Ga0070673_100034496
281 Ga0070688_100081808
282 Ga0070688_100540246
283 Ga0070667_100050466
284 Ga0070701_10005715
285 Ga0070711_100105991
286 Ga0070705_100228276
287 Ga0070700_100013478
288 Ga0070694_100033366
289 Ga0070694_100058678
290 Ga0070663_100488643
291 Ga0070663_100538974
292 Ga0070678_100042469
293 Ga0070678_100137518
294 Ga0070662_100088621
295 Ga0070662_100336247
296 Ga0068867_100013375
297 Ga0068867_100051529
298 Ga0070685_10312303
299 Ga0070697_100277312
300 Ga0070672_100006741
301 Ga0070672_100066633
302 Ga0070672_100076875
303 Ga0070686_100604210
304 Ga0070695_100003922
305 Ga0070696_100048376
306 Ga0070704_100000676
307 Ga0070664_100006355
308 Ga0070664_100008718
309 Ga0070664_100261149
310 Ga0068857_100113181
311 Ga0068854_100251927
312 Ga0068854_100456475
313 Ga0070702_100240701
314 Ga0068859_100210069
315 Ga0068859_100216097
316 Ga0068859_100286182
317 Ga0068864_100044825
318 Ga0068866_10131727
319 Ga0068861_100021149
320 Ga0068861_100033854
321 Ga0068861_100040372
322 Ga0068861_100086794
323 Ga0068861_100261973
324 Ga0068861_100822677
325 Ga0068870_10011088
326 Ga0068863_100353277
327 Ga0068863_100402156
328 Ga0068858_100091158
329 Ga0068860_100243880
330 Ga0081455_10072596
331 Ga0081538_10033144
332 Ga0097621_100000826
333 Ga0097621_100132577
334 Ga0097621_100253054
335 Ga0097621_100414399
336 Ga0068871_100042584
337 Ga0068871_100131882
338 Ga0068871_100641481
339 Ga0075428_100006537
340 Ga0075428_100424121
341 Ga0075430_100467962
342 Ga0075433_10204870
343 Ga0075434_100028323
344 Ga0075429_100666767
345 Ga0068865_100260785
346 Ga0097620_100210064
347 Ga0097620_100216093
348 Ga0097620_100286174
349 Ga0075435_100030923
350 Ga0111539_10016998
351 Ga0111539_10025517
352 Ga0111539_10151344
353 Ga0114129_10018426
354 Ga0105243_10034127
355 Ga0105243_10598768
356 Ga0105243_10617031
357 Ga0105242_10024667
358 Ga0105242_10205720
359 Ga0105248_10141061
360 Ga0105248_10293602
361 Ga0105248_11194993
362 Ga0105249_10056047
363 Ga0105249_10181542
364 Ga0105249_10586523
365 Ga0105249_10939981
366 Ga0105246_10007006
367 Ga0157375_10034956
368 Ga0163163_10023050
369 Ga0157380_10001010
370 Ga0157380_10002610
371 Ga0157380_10127650
372 Ga0157380_10328859
373 Ga0157380_10427283
374 Ga0157377_10495150
375 Ga0157379_10097964
376 Ga0157376_10025478
377 Ga0157376_10237581
378 Ga0157376_10572100
379 Ga0163161_10070709
380 Ga0207697_10000992
381 Ga0207682_10001013
382 Ga0207682_10012572
383 Ga0207680_10016589
384 Ga0207680_10284355
385 Ga0207645_10000745
386 Ga0207645_10001958
387 Ga0207643_10000265
388 Ga0207643_10008562
389 Ga0207643_10020914
390 Ga0207643_10363475
391 Ga0207662_10278155
392 Ga0207649_10184340
393 Ga0207681_10018525
394 Ga0207681_10027532
395 Ga0207681_10134559
396 Ga0207681_10177812
397 Ga0207650_10052040
398 Ga0207650_10208138
399 Ga0207659_10009300
400 Ga0207659_10018694
401 Ga0207659_10185827
402 Ga0207706_10047681
403 Ga0207706_10727453
404 Ga0207686_10019452
405 Ga0207709_10007437
406 Ga0207709_10419267
407 Ga0207670_10108945
408 Ga0207669_10026004
409 Ga0207669_10039012
410 Ga0207669_10053378
411 Ga0207669_10238857
412 Ga0207704_10263528
413 Ga0207691_10011448
414 Ga0207691_10080342
415 Ga0207691_10094352
416 Ga0207711_10479148
417 Ga0207689_10000569
418 Ga0207689_10006167
419 Ga0207689_10046797
420 Ga0207689_10091287
421 Ga0207679_10042348
422 Ga0207651_10016043
423 Ga0207651_10041672
424 Ga0207651_10044730
425 Ga0207668_10179839
426 Ga0207640_10104163
427 Ga0207677_10310878
428 Ga0207703_10056097
429 Ga0207703_10286960
430 Ga0207708_10025776
431 Ga0207641_10163884
432 Ga0207641_10976586
433 Ga0207648_10004794
434 Ga0207648_10028594
435 Ga0207676_10023527
436 Ga0207674_10122214
437 Ga0207675_100003010
438 Ga0207675_100033821
439 Ga0207675_100063582
440 Ga0207675_100066653
441 Ga0207675_100256906
442 Ga0207675_100353061
443 Ga0207683_10012627
444 Ga0207683_10057299
445 Ga0268265_10982034
446 Ga0268264_10209728
447 Ga0373932_0074061
448 Ga0373931_0085140
449 Ga0400490_00690
450 Ga0451853_0666233
451 Ga0439435_0006708
452 Ga0439435_0036880
453 Ga0439444_0059719
454 Ga0439464_0075998
455 Ga0451577_0806326
456 Ga0453684_0003883
457 Ga0453684_0036782
458 Ga0453684_0043158
459 Ga0451576_0003434
460 Ga0451576_0004279
461 Ga0451576_0017910
462 Ga0496106_0701382
463 Ga0501031_0060389
464 Ga0501034_0135817
465 Ga0501036_0199112
466 Ga0501041_0038087
467 Ga0501042_0136708
468 Ga0501048_0060857
469 Ga0501072_0321971
470 Ga0501076_0702009
471 Ga0501081_0259939
472 nmdc:mga00v17_277023_c1
473 nmdc:mga05p37_44750_c1
474 nmdc:mga0n895_74843_c1
475 nmdc:mga0rr50_23587_c1
476 nmdc:mga0rr50_644334_c1
477 nmdc:mga0a205_26649_c1
478 nmdc:mga0a205_27165_c1
479 Ga0500641_0000813
480 Ga0590071_001214
481 Ga0590075_001407
482 Ga0590077_036557
483 Ga0501082_0092385
484 8001523606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ymv-assembly1.cif.gz_A structure of reduced m smegmatis 5246, a homologue of m.tuberculosis acg 0.7037 190 226
6wlf-assembly2.cif.gz_B phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.688 14 178
6wlf-assembly1.cif.gz_A phosphoethanolamine methyltransferase from the pine wilt nematode bursaphelenchus xylophilus 0.6861 14 178
2pxx-assembly1.cif.gz_A human putative methyltransferase mgc2408 0.6654 5 224
4qdj-assembly1.cif.gz_A crystal structure of magnesium protoporphyrin ix methyltransferase (chlm) from synechocystis pcc 6803 with bound sam 0.6648 29 228
ID Description Score Start End Superfamily
af_Q60353_7_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.957 6 225 3.40.50.150
af_Q60353_7_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.944 6 225 3.40.50.150
af_A2APY7_47_247_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8211 125 172 3.40.50.150
af_Q7K1S1_72_273_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.753 125 172 3.40.50.150
af_A0A1D6IAK3_2_136_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7436 125 172 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A5C9BGN4-F1-model_v4 SAM-dependent methyltransferase 0.9952 20 226
AF-J9ZAJ5-F1-model_v4 SAM-dependent methyltransferase 0.9946 2 226 GO:0008168
GO:0032259
AF-U7FST5-F1-model_v4 SAM-dependent methyltransferase 0.9944 20 225 GO:0008168
GO:0032259
AF-A0A1Q4R902-F1-model_v4 SAM-dependent methyltransferase 0.9936 2 226 GO:0008168
GO:0032259
AF-A0A0E3PG04-F1-model_v4 SAM-dependent methyltransferase 0.9935 6 224 GO:0016020

Map