F354225

General Info

Members Datasets Scaffolds Average Seq Length
241 183 482 331

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2928510474|2928514376
Length 323
Sequence IVDITIIGGGPTGLFASFYAGMREMSVKIIDSLPQLGGQLIELYPDKDIYDVGGFPKILAKDFVANLVTQAHYSKPEILLGETAMSATRDGDHFILKTDKGVHLTRTILLTAGIGAFQPRKIGLPEEVLFEGNTLHYSIKDLTIFKDKNVLVCGGGDSAVDWSLMLEDIASTVTLVHRRERFTAHETSVNQLMESKVDVKTSRAVKVIEGEDGKVSSIVLAEKDGTEERLDVDHLIVNYGNISSLGPLKDWGLEMDRNSIMVNTRMETNIEGIYAAGDVTNYEGKVKLIAVGLGEAPIAVNHAKAYVDPKARLQPLHSTSIFS

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
24 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
29 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
39 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
40 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
41 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
42 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
43 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
46 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
47 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
48 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
49 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
50 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
51 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
52 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
53 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
54 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
55 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
56 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
57 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
58 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
59 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
60 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
61 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
62 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
63 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
64 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
65 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
66 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
67 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
70 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
71 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
72 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
73 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
78 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
79 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
80 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
81 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
82 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
83 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
84 2554235283 Bacillus safensis VK Isolate Rhizosphere
85 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
86 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
87 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
88 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
89 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
90 2643221729 Bacillus sp. Root11 Isolate Unclassified
91 2643221730 Bacillus sp. Root131 Isolate Unclassified
92 2643221731 Bacillus sp. Root147 Isolate Unclassified
93 2643221732 Bacillus sp. Root239 Isolate Unclassified
94 2643221735 Bacillus sp. Root920 Isolate Unclassified
95 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
96 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
97 2684622632 Bacillus cereus 905 Isolate Unclassified
98 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
99 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
100 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
101 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
102 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
103 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
104 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
105 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
106 2738541358 Bacillus sp. OV752 Isolate Unclassified
107 2738543006 Bacillus sp. OK077 Isolate Unclassified
108 2738543010 Bacillus sp. YR335 Isolate Unclassified
109 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
110 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
111 2811994870 Bacillus sp. JB4 Isolate Unclassified
112 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
113 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
114 2818991441 Niallia circulans 3243 Isolate Rhizosphere
115 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
116 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
117 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
118 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
119 2842682962 Bacillus sp. R-72492 Isolate Unclassified
120 2842882022 Bacillus sp. R-71893 Isolate Unclassified
121 2849139964 Bacillus sp. R-71875 Isolate Unclassified
122 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
123 2857581216 Bacillus sp. R-71922 Isolate Unclassified
124 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
125 2860837431 Bacillus sp. WR11 Isolate Unclassified
126 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
127 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
128 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
129 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
130 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
131 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
132 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
133 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
134 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
135 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
136 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
137 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
138 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
139 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
140 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
141 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
142 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
143 2919720352 Priestia megaterium 4340 Isolate Unclassified
144 2919726948 Bacillus pumilus 4489 Isolate Unclassified
145 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
146 2929004312 Priestia megaterium 1104 Isolate Unclassified
147 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
148 2938917290 Bacillus sp. CR71 Isolate Unclassified
149 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
150 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
151 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
152 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
153 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
154 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
155 2965761152 Bacillus sp. COPE52 Isolate Unclassified
156 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
157 2969141011 Bacillus velezensis MH25 Isolate Unclassified
158 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
159 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
160 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
161 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
162 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
163 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
164 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
165 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
166 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
167 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
168 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
169 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
170 8022653035 Bacillus sp. Rc4 Isolate Unclassified
171 8022792930 Bacillus sp. Xin Isolate Rhizosphere
172 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
173 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
174 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
175 8023438354 Bacillus sp. BH2 Isolate Unclassified
176 8023444577 Bacillus sp. BH32 Isolate Unclassified
177 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
178 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
179 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
180 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
181 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
182 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
183 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 46.89
Metatranscriptomes 2.9
Isolates 50.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.2
Nodule 0.41
Rhizoplane 9.54
Rhizosphere 40.66
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1008081 3300002987 Bacteria 2930
2 JGI25151J46595_10000037 3300003187 Bacteria 183297
3 JGI25151J46595_10000392 3300003187 Bacteria 45488
4 JGI25151J46595_10001363 3300003187 Bacteria 16891
5 JGI25151J46595_10004287 3300003187 Bacteria 7580
6 JGI25151J46595_10011553 3300003187 Bacteria 4055
7 JGI25151J46595_10022587 3300003187 Bacteria 2608
8 JGI25151J46595_10024232 3300003187 Bacteria 2485
9 rootH1_10001505 3300003316 Bacteria 52069
10 rootH2_10121538 3300003320 Bacteria 8696
11 rootL2_10010347 3300003322 Bacteria 37669
12 rootH1_10205988 3300003323 Bacteria 1838
13 Ga0006562J51391_1001695 3300003578 Bacteria 7890
14 Ga0006562J51391_1001709 3300003578 Bacteria 2040
15 Ga0006562J51391_1005267 3300003578 Bacteria 1150
16 Ga0055528_1002688 3300003790 Bacteria 9381
17 Ga0055541_1000999 3300003841 Bacteria 6606
18 Ga0070676_10170580 3300005328 Bacteria 1407
19 Ga0070670_100141855 3300005331 Bacteria 2078
20 Ga0105251_10014473 3300009011 Bacteria 4357
21 Ga0105244_10006865 3300009036 Bacteria 7309
22 Ga0105244_10036136 3300009036 Bacteria 2590
23 Ga0105250_10003880 3300009092 Bacteria 7004
24 Ga0105250_10004759 3300009092 Bacteria 6190
25 Ga0105245_10149795 3300009098 Bacteria 2205
26 Ga0105247_10011593 3300009101 Bacteria 5310
27 Ga0105243_10000533 3300009148 Bacteria 38676
28 Ga0105242_10001446 3300009176 Bacteria 18676
29 Ga0105239_10395374 3300010375 Bacteria 1564
30 Ga0105246_10003828 3300011119 Bacteria 9121
31 Ga0157371_10055619 3300013102 Bacteria 2808
32 Ga0157378_10019915 3300013297 Bacteria 5899
33 Ga0157377_10019693 3300014745 Bacteria 3528
34 Ga0209566_100363 3300025225 Bacteria 38102
35 Ga0209147_100382 3300025229 Bacteria 30814
36 Ga0209147_101612 3300025229 Bacteria 7569
37 Ga0209673_1007905 3300025273 Bacteria 4807
38 Ga0209130_1002819 3300025284 Bacteria 8093
39 Ga0209130_1003938 3300025284 Bacteria 5947
40 Ga0209130_1007593 3300025284 Bacteria 3323
41 Ga0209130_1020415 3300025284 Bacteria 1516
42 Ga0209025_1000011 3300025294 Bacteria 976387
43 Ga0209025_1000716 3300025294 Bacteria 56399
44 Ga0209025_1000740 3300025294 Bacteria 55057
45 Ga0209025_1000826 3300025294 Bacteria 49373
46 Ga0209025_1001931 3300025294 Bacteria 24018
47 Ga0209025_1004443 3300025294 Bacteria 12184
48 Ga0209025_1010005 3300025294 Bacteria 6497
49 Ga0209025_1026053 3300025294 Bacteria 2950
50 Ga0209025_1038055 3300025294 Bacteria 2123
51 Ga0207696_1004121 3300025711 Bacteria 6357
52 Ga0207696_1008018 3300025711 Bacteria 4081
53 Ga0207696_1008612 3300025711 Bacteria 3878
54 Ga0207696_1015199 3300025711 Bacteria 2615
55 Ga0207655_1000756 3300025728 Bacteria 36259
56 Ga0207655_1000884 3300025728 Bacteria 31761
57 Ga0207713_1000472 3300025735 Bacteria 41917
58 Ga0207713_1005058 3300025735 Bacteria 8378
59 Ga0207645_10238215 3300025907 Bacteria 1202
60 Ga0207650_10223103 3300025925 Bacteria 1517
61 Ga0207686_10007482 3300025934 Bacteria 5878
62 Ga0207709_10100430 3300025935 Bacteria 1912
63 Ga0237817_10164 3300030083 Bacteria 19270
64 Ga0307408_100020380 3300031548 Bacteria 4475
65 Ga0237819_00273 3300038705 Bacteria 18935
66 Ga0237819_04060 3300038705 Bacteria 2472
67 Ga0439439_0000236 3300041406 Bacteria 8657
68 Ga0439433_0000314 3300041999 Bacteria 8431
69 Ga0439462_0000443 3300042015 Bacteria 8108
70 Ga0466961_0060372 3300044693 Bacteria 2411
71 Ga0466968_0008183 3300044735 Bacteria 4000
72 Ga0466959_0003973 3300045049 Bacteria 9831
73 Ga0466967_0000069 3300045976 Bacteria 37776
74 Ga0495585_0106320 3300046492 Bacteria 1496
75 Ga0495606_0169263 3300046507 Bacteria 1269
76 Ga0495683_0007447 3300047323 Bacteria 5916
77 Ga0496100_0215624 3300048903 Bacteria 1406
78 Ga0496101_0141241 3300048904 Bacteria 1835
79 Ga0496101_0162845 3300048904 Bacteria 1712
80 Ga0496102_0000798 3300048905 Bacteria 30585
81 Ga0496102_0011971 3300048905 Bacteria 7492
82 Ga0496103_0000766 3300048906 Bacteria 23709
83 Ga0496104_0012958 3300048907 Bacteria 7506
84 Ga0496104_0065402 3300048907 Bacteria 3451
85 Ga0496105_0000841 3300048908 Bacteria 20902
86 Ga0496106_0001468 3300048909 Bacteria 17731
87 Ga0496107_0000385 3300048910 Bacteria 24002
88 Ga0496108_0014194 3300048911 Bacteria 6499
89 Ga0496109_0003067 3300048912 Bacteria 13926
90 Ga0496110_0010277 3300048913 Bacteria 7606
91 Ga0496110_0159367 3300048913 Bacteria 2045
92 Ga0496110_0164332 3300048913 Bacteria 2012
93 Ga0496110_0203396 3300048913 Bacteria 1799
94 Ga0496111_0012519 3300048914 Bacteria 5746
95 Ga0496111_0047241 3300048914 Bacteria 3100
96 Ga0496112_0120589 3300048915 Bacteria 2592
97 Ga0496112_0152697 3300048915 Bacteria 2277
98 Ga0496113_0054748 3300048916 Bacteria 2987
99 Ga0496116_0008960 3300048919 Bacteria 8603
100 Ga0496116_0032796 3300048919 Bacteria 3696
101 Ga0496116_0043110 3300048919 Bacteria 3077
102 Ga0496117_0035562 3300048920 Bacteria 3737
103 Ga0496119_0001639 3300048922 Bacteria 26359
104 Ga0496119_0146402 3300048922 Unclassified 1270
105 Ga0496120_0124124 3300048923 Unclassified 1331
106 Ga0496121_0101828 3300048924 Bacteria 2214
107 Ga0496122_0005811 3300048925 Bacteria 14503
108 Ga0496122_0026582 3300048925 Bacteria 4981
109 Ga0496122_0095230 3300048925 Bacteria 2012
110 Ga0496123_0004407 3300048926 Bacteria 14836
111 Ga0496123_0038027 3300048926 Bacteria 3389
112 Ga0496124_0000998 3300048927 Bacteria 44860
113 Ga0496125_0000620 3300048928 Bacteria 59641
114 Ga0496125_0003495 3300048928 Bacteria 18980
115 Ga0496125_0026878 3300048928 Bacteria 5227
116 Ga0496126_0187478 3300048929 Bacteria 1753
117 Ga0501306_000745 3300049127 Bacteria 2707
118 Ga0501309_000759 3300049129 Bacteria 2822
119 Ga0501305_000975 3300049161 Bacteria 2634
120 Ga0587079_000243 3300059647 Bacteria 4215
121 2928514376 2928510474 Bacteria 4815308
122 2511700919 2511231119 Bacteria 4019861
123 2512730635 2512564039 Bacteria 8739048
124 2524191845 2524023129 Bacteria 6762600
125 2540608119 2540341094 Bacteria 4061186
126 2545559114 2545555800 Bacteria 4222588
127 2553396895 2551306519 Bacteria 5465154
128 2555468122 2554235283 Bacteria 3683090
129 2573037995 2571042588 Bacteria 5045676
130 2578933568 2576861599 Bacteria 4217202
131 2580933618 2579778775 Bacteria 5360914
132 2601640732 2600255286 Bacteria 5390125
133 2621276157 2619619294 Bacteria 5575484
134 2644703326 2643221729 Bacteria 6621700
135 2644712048 2643221730 Bacteria 6523787
136 2644720249 2643221731 Bacteria 5623886
137 2644726671 2643221732 Bacteria 5756404
138 2644739056 2643221735 Bacteria 3676263
139 2651530539 2648501850 Bacteria 3975476
140 2674422147 2671180844 Bacteria 4164150
141 2685152902 2684622632 Bacteria 5380049
142 2686998287 2684623153 Bacteria 3878815
143 2687499562 2687453109 Bacteria 3860091
144 2695628880 2695420354 Bacteria 3922431
145 2698320283 2695420987 Bacteria 6152737
146 2705996834 2703719227 Bacteria 5631989
147 2717915433 2716884898 Bacteria 3928789
148 2721508053 2718218445 Bacteria 5113413
149 2738837789 2738541299 Bacteria 4020721
150 2739157316 2738541358 Bacteria 5932299
151 2739208934 2738543006 Bacteria 5904091
152 2739232127 2738543010 Bacteria 5583595
153 2739233165 2738543010 Bacteria 5583595
154 2793185137 2791355222 Bacteria 5898266
155 2809053248 2808606399 Bacteria 4021018
156 2812317411 2811994870 Bacteria 3776934
157 2816863194 2816332186 Bacteria 5331395
158 2816865043 2816332186 Bacteria 5331395
159 2817481507 2816332295 Bacteria 4352468
160 2819570583 2818991441 Bacteria 5062707
161 2819584326 2818991443 Bacteria 6598732
162 2819711256 2818991465 Bacteria 5388835
163 2819722470 2818991468 Bacteria 3723169
164 2823529378 2823526263 Bacteria 3765752
165 2842683906 2842682962 Bacteria 5589973
166 2842687867 2842682962 Bacteria 5589973
167 2842886185 2842882022 Bacteria 6158489
168 2849140064 2849139964 Bacteria 5613304
169 2849142456 2849139964 Bacteria 5613304
170 2852675922 2852673933 Bacteria 3347676
171 2852676040 2852673933 Bacteria 3347676
172 2852676500 2852673933 Bacteria 3347676
173 2857581967 2857581216 Bacteria 5522813
174 2857586219 2857581216 Bacteria 5522813
175 2857606763 2857604169 Bacteria 5111450
176 2860840909 2860837431 Bacteria 4202080
177 2865001294 2864997549 Bacteria 5139696
178 2865005653 2865002811 Bacteria 6333767
179 2877771802 2877768649 Bacteria 3957164
180 2880172644 2880169592 Bacteria 3900066
181 2881641241 2881636855 Bacteria 5205297
182 2881646500 2881644220 Bacteria 5302661
183 2881646546 2881644220 Bacteria 5302661
184 2881646843 2881644220 Bacteria 5302661
185 2881646957 2881644220 Bacteria 5302661
186 2881649467 2881644220 Bacteria 5302661
187 2888580570 2888578766 Bacteria 6743310
188 2889050776 2889049205 Bacteria 7524325
189 2897112916 2897109615 Bacteria 4009619
190 2904115903 2904113452 Bacteria 7796941
191 2904116616 2904113452 Bacteria 7796941
192 2904118886 2904113452 Bacteria 7796941
193 2904528599 2904524088 Bacteria 5887454
194 2904563788 2904560550 Bacteria 4029838
195 2908666750 2908665501 Bacteria 3678115
196 2919095232 2919093281 Bacteria 3660974
197 2919148230 2919143609 Bacteria 6219228
198 2919428602 2919425241 Bacteria 8055701
199 2919522003 2919517244 Bacteria 5858162
200 2919725137 2919720352 Bacteria 5986006
201 2919725435 2919720352 Bacteria 5986006
202 2919727797 2919726948 Bacteria 3696050
203 2928098431 2928093941 Bacteria 5965005
204 2929007861 2929004312 Bacteria 5678476
205 2929238618 2929233124 Bacteria 5948380
206 2938922815 2938917290 Bacteria 5914775
207 2947431692 2947426588 Bacteria 5357194
208 2954777081 2954773129 Bacteria 3741715
209 2956899661 2956897341 Bacteria 5447711
210 2960321163 2960319331 Bacteria 5502575
211 2960378412 2960375949 Bacteria 5361395
212 2962294136 2962290636 Bacteria 4072939
213 2965766228 2965761152 Bacteria 5806513
214 2969140117 2969136845 Bacteria 3923176
215 2969144356 2969141011 Bacteria 4118468
216 2969769123 2969765954 Bacteria 4216713
217 2969771437 2969770375 Bacteria 4271280
218 2971413485 2971410472 Bacteria 8311090
219 2971896468 2971893375 Bacteria 3929648
220 2979088609 2979083700 Bacteria 5894929
221 2980185942 2980182181 Bacteria 9454109
222 2980495904 2980492589 Bacteria 4072961
223 3006830727 3006826541 Bacteria 4678913
224 3006861933 3006858327 Bacteria 4317835
225 3006882629 3006879489 Bacteria 4064221
226 8022626385 8022621104 Bacteria 5241040
227 8022633067 8022630665 Bacteria 3886130
228 8022655784 8022653035 Bacteria 4035078
229 8022798970 8022792930 Bacteria 5693794
230 8022894213 8022893055 Bacteria 5300455
231 8022918676 8022914991 Bacteria 5584517
232 8022953545 8022948649 Bacteria 5366783
233 8023441013 8023438354 Bacteria 5779374
234 8023448598 8023444577 Bacteria 5661597
235 8051954579 8051952484 Bacteria 3926774
236 8052175334 8052174270 Bacteria 3881265
237 8054282504 8054280661 Bacteria 4232245
238 8054797974 8054795415 Bacteria 9785225
239 8057477372 8057473075 Bacteria 5892720
240 8057587370 8057582654 Bacteria 5218944
241 8057978061 8057977335 Bacteria 5694872
242 JGI25159J45721_1008081
243 JGI25151J46595_10000037
244 JGI25151J46595_10000392
245 JGI25151J46595_10001363
246 JGI25151J46595_10004287
247 JGI25151J46595_10011553
248 JGI25151J46595_10022587
249 JGI25151J46595_10024232
250 rootH1_10001505
251 rootH2_10121538
252 rootL2_10010347
253 rootH1_10205988
254 Ga0006562J51391_1001695
255 Ga0006562J51391_1001709
256 Ga0006562J51391_1005267
257 Ga0055528_1002688
258 Ga0055541_1000999
259 Ga0070676_10170580
260 Ga0070670_100141855
261 Ga0105251_10014473
262 Ga0105244_10006865
263 Ga0105244_10036136
264 Ga0105250_10003880
265 Ga0105250_10004759
266 Ga0105245_10149795
267 Ga0105247_10011593
268 Ga0105243_10000533
269 Ga0105242_10001446
270 Ga0105239_10395374
271 Ga0105246_10003828
272 Ga0157371_10055619
273 Ga0157378_10019915
274 Ga0157377_10019693
275 Ga0209566_100363
276 Ga0209147_100382
277 Ga0209147_101612
278 Ga0209673_1007905
279 Ga0209130_1002819
280 Ga0209130_1003938
281 Ga0209130_1007593
282 Ga0209130_1020415
283 Ga0209025_1000011
284 Ga0209025_1000716
285 Ga0209025_1000740
286 Ga0209025_1000826
287 Ga0209025_1001931
288 Ga0209025_1004443
289 Ga0209025_1010005
290 Ga0209025_1026053
291 Ga0209025_1038055
292 Ga0207696_1004121
293 Ga0207696_1008018
294 Ga0207696_1008612
295 Ga0207696_1015199
296 Ga0207655_1000756
297 Ga0207655_1000884
298 Ga0207713_1000472
299 Ga0207713_1005058
300 Ga0207645_10238215
301 Ga0207650_10223103
302 Ga0207686_10007482
303 Ga0207709_10100430
304 Ga0237817_10164
305 Ga0307408_100020380
306 Ga0237819_00273
307 Ga0237819_04060
308 Ga0439439_0000236
309 Ga0439433_0000314
310 Ga0439462_0000443
311 Ga0466961_0060372
312 Ga0466968_0008183
313 Ga0466959_0003973
314 Ga0466967_0000069
315 Ga0495585_0106320
316 Ga0495606_0169263
317 Ga0495683_0007447
318 Ga0496100_0215624
319 Ga0496101_0141241
320 Ga0496101_0162845
321 Ga0496102_0000798
322 Ga0496102_0011971
323 Ga0496103_0000766
324 Ga0496104_0012958
325 Ga0496104_0065402
326 Ga0496105_0000841
327 Ga0496106_0001468
328 Ga0496107_0000385
329 Ga0496108_0014194
330 Ga0496109_0003067
331 Ga0496110_0010277
332 Ga0496110_0159367
333 Ga0496110_0164332
334 Ga0496110_0203396
335 Ga0496111_0012519
336 Ga0496111_0047241
337 Ga0496112_0120589
338 Ga0496112_0152697
339 Ga0496113_0054748
340 Ga0496116_0008960
341 Ga0496116_0032796
342 Ga0496116_0043110
343 Ga0496117_0035562
344 Ga0496119_0001639
345 Ga0496119_0146402
346 Ga0496120_0124124
347 Ga0496121_0101828
348 Ga0496122_0005811
349 Ga0496122_0026582
350 Ga0496122_0095230
351 Ga0496123_0004407
352 Ga0496123_0038027
353 Ga0496124_0000998
354 Ga0496125_0000620
355 Ga0496125_0003495
356 Ga0496125_0026878
357 Ga0496126_0187478
358 Ga0501306_000745
359 Ga0501309_000759
360 Ga0501305_000975
361 Ga0587079_000243
362 2928514376
363 2511700919
364 2512730635
365 2524191845
366 2540608119
367 2545559114
368 2553396895
369 2555468122
370 2573037995
371 2578933568
372 2580933618
373 2601640732
374 2621276157
375 2644703326
376 2644712048
377 2644720249
378 2644726671
379 2644739056
380 2651530539
381 2674422147
382 2685152902
383 2686998287
384 2687499562
385 2695628880
386 2698320283
387 2705996834
388 2717915433
389 2721508053
390 2738837789
391 2739157316
392 2739208934
393 2739232127
394 2739233165
395 2793185137
396 2809053248
397 2812317411
398 2816863194
399 2816865043
400 2817481507
401 2819570583
402 2819584326
403 2819711256
404 2819722470
405 2823529378
406 2842683906
407 2842687867
408 2842886185
409 2849140064
410 2849142456
411 2852675922
412 2852676040
413 2852676500
414 2857581967
415 2857586219
416 2857606763
417 2860840909
418 2865001294
419 2865005653
420 2877771802
421 2880172644
422 2881641241
423 2881646500
424 2881646546
425 2881646843
426 2881646957
427 2881649467
428 2888580570
429 2889050776
430 2897112916
431 2904115903
432 2904116616
433 2904118886
434 2904528599
435 2904563788
436 2908666750
437 2919095232
438 2919148230
439 2919428602
440 2919522003
441 2919725137
442 2919725435
443 2919727797
444 2928098431
445 2929007861
446 2929238618
447 2938922815
448 2947431692
449 2954777081
450 2956899661
451 2960321163
452 2960378412
453 2962294136
454 2965766228
455 2969140117
456 2969144356
457 2969769123
458 2969771437
459 2971413485
460 2971896468
461 2979088609
462 2980185942
463 2980495904
464 3006830727
465 3006861933
466 3006882629
467 8022626385
468 8022633067
469 8022655784
470 8022798970
471 8022894213
472 8022918676
473 8022953545
474 8023441013
475 8023448598
476 8051954579
477 8052175334
478 8054282504
479 8054797974
480 8057477372
481 8057587370
482 8057978061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

149

225

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

2

303

0.8

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

58

277

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v0j-assembly2.cif.gz_D udp-galactopyranose mutase from mycobacterium tuberculosis 0.9584 8 44
4mig-assembly1.cif.gz_A pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9499 8 39
4mig-assembly1.cif.gz_C pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9481 8 39
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9474 8 39
5br7-assembly1.cif.gz_A structure of udp-galactopyranose mutase from corynebacterium diphtheriae in complex with citrate ion 0.9337 6 44
ID Description Score Start End Superfamily
3lzwA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9911 128 246 3.50.50.60
3lzwA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9829 128 246 3.50.50.60
4zn0C02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9528 127 247 3.50.50.60
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9521 127 247 3.50.50.60
2zbwB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9516 128 245 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A5C4S950-F1-model_v4 Thioredoxin-disulfide reductase 0.9625 148 247 GO:0016491
AF-A0A7C1RWM3-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9158 6 117 GO:0016491
AF-A0A435E010-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.91 4 121 GO:0016491
AF-A0A4Q3E5I8-F1-model_v4 deleted 0.9037 4 105
AF-A0A4Q3TSJ4-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9016 5 101 GO:0016020
GO:0016491

Map