F354195

General Info

Members Datasets Scaffolds Average Seq Length
241 156 482 278

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2545555834|2545673042
Length 316
Sequence HLHPRAAEIAESRLDRMIPDEAEITAGTRIEPGRSYGFFTDTTVCIGCKACEVACKEWNNLPADNLGLSGHSFDNTGALSANTWRHVSFVEKSGPGGVRDSLQTPFQSGWLMMSDVCKHCHNAPCLEACPTGALFKTEFDTVVVQQDICNGCGYCVPACPFGVVDVSTVDGKAHKCTLCYDRLKGGLEPACAKSCPTDSIQFGELGDLHEKARARVETLHGRGVPGAYLYGVPGSPGATGDLGHLNAFFLLTDRPEVYNLPAAPTRPANRVAPSLATGLTAVAGLALAAALLLGGAGSRGGRRGPDQRGAGRQERA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
150 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
151 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
152 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
153 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
154 2902330777 Methylobacterium sp. 2A Isolate Unclassified
155 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
156 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.02
Metatranscriptomes 1.66
Isolates 3.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.24
Rhizoplane 4.98
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10091673 3300005293 Bacteria 5609
2 Ga0070658_10021172 3300005327 Bacteria 5209
3 Ga0070683_100000311 3300005329 Bacteria 33501
4 Ga0070683_100176210 3300005329 Bacteria 2030
5 Ga0070670_100010379 3300005331 Bacteria 7948
6 Ga0070677_10061548 3300005333 Bacteria 1550
7 Ga0068869_100112236 3300005334 Bacteria 2075
8 Ga0070680_100071329 3300005336 Bacteria 2854
9 Ga0070680_100147747 3300005336 Bacteria 1973
10 Ga0068868_100106022 3300005338 Bacteria 2279
11 Ga0070660_100179548 3300005339 Bacteria 1713
12 Ga0070660_100224640 3300005339 Bacteria 1527
13 Ga0070691_10013589 3300005341 Bacteria 3730
14 Ga0070661_100045977 3300005344 Bacteria 3192
15 Ga0070661_100185575 3300005344 Unclassified 1584
16 Ga0070669_100007683 3300005353 Bacteria 7709
17 Ga0070674_100124361 3300005356 Bacteria 1913
18 Ga0070688_100376784 3300005365 Bacteria 1045
19 Ga0070709_10045390 3300005434 Bacteria 2727
20 Ga0070714_100170883 3300005435 Bacteria 1972
21 Ga0070713_100010298 3300005436 Bacteria 6750
22 Ga0070713_100037626 3300005436 Bacteria 3913
23 Ga0070713_100058121 3300005436 Bacteria 3224
24 Ga0070713_100161603 3300005436 Bacteria 2000
25 Ga0070713_100191699 3300005436 Bacteria 1842
26 Ga0070705_100066499 3300005440 Bacteria 2162
27 Ga0070663_100095214 3300005455 Bacteria 2213
28 Ga0070663_100349558 3300005455 Bacteria 1197
29 Ga0070681_10101501 3300005458 Bacteria 2822
30 Ga0070681_10135387 3300005458 Bacteria 2394
31 Ga0070685_10283691 3300005466 Bacteria 1110
32 Ga0070679_100005194 3300005530 Bacteria 12049
33 Ga0070679_100138997 3300005530 Bacteria 2409
34 Ga0070684_100000083 3300005535 Bacteria 61611
35 Ga0070684_100043211 3300005535 Bacteria 3891
36 Ga0070672_100317420 3300005543 Bacteria 1324
37 Ga0070686_100039985 3300005544 Bacteria 2924
38 Ga0070695_100058287 3300005545 Bacteria 2497
39 Ga0070693_100051828 3300005547 Bacteria 2351
40 Ga0068855_100007231 3300005563 Bacteria 13472
41 Ga0068855_100015216 3300005563 Bacteria 9263
42 Ga0068855_100066753 3300005563 Bacteria 4194
43 Ga0070664_100009777 3300005564 Bacteria 7771
44 Ga0068854_100000079 3300005578 Bacteria 69412
45 Ga0068854_100028299 3300005578 Bacteria 3871
46 Ga0068856_100009798 3300005614 Bacteria 9309
47 Ga0068856_100039889 3300005614 Bacteria 4610
48 Ga0068856_100091131 3300005614 Bacteria 3033
49 Ga0068856_100103881 3300005614 Bacteria 2834
50 Ga0068856_100192462 3300005614 Bacteria 2053
51 Ga0068852_100006924 3300005616 Bacteria 8245
52 Ga0068852_100094689 3300005616 Bacteria 2680
53 Ga0068852_100511325 3300005616 Bacteria 1197
54 Ga0068851_10083502 3300005834 Bacteria 1672
55 Ga0081455_10103693 3300005937 Bacteria 2277
56 Ga0070717_10074697 3300006028 Bacteria 2834
57 Ga0075433_10081288 3300006852 Bacteria 2857
58 Ga0075434_100014842 3300006871 Bacteria 7452
59 Ga0075434_100038802 3300006871 Bacteria 4719
60 Ga0075434_100162393 3300006871 Bacteria 2254
61 Ga0075436_100002056 3300006914 Bacteria 13872
62 Ga0075435_100044378 3300007076 Bacteria 3561
63 Ga0075435_100188340 3300007076 Bacteria 1746
64 Ga0075435_100390671 3300007076 Bacteria 1196
65 Ga0111539_10165838 3300009094 Bacteria 2583
66 Ga0105245_10228739 3300009098 Bacteria 1798
67 Ga0114129_10099178 3300009147 Bacteria 4032
68 Ga0105241_10190960 3300009174 Bacteria 1705
69 Ga0105242_10081788 3300009176 Bacteria 2701
70 Ga0105248_10093774 3300009177 Bacteria 3381
71 Ga0105239_10118060 3300010375 Bacteria 2944
72 Ga0157373_10238718 3300013100 Bacteria 1285
73 Ga0157370_10431117 3300013104 Bacteria 1212
74 Ga0157369_10033613 3300013105 Bacteria 5635
75 Ga0157369_10470903 3300013105 Bacteria 1300
76 Ga0157374_10001531 3300013296 Bacteria 19467
77 Ga0157374_10033280 3300013296 Bacteria 4703
78 Ga0157374_10180209 3300013296 Bacteria 2063
79 Ga0157374_10729936 3300013296 Bacteria 1005
80 Ga0157378_10143377 3300013297 Bacteria 2220
81 Ga0157372_10235247 3300013307 Bacteria 2125
82 Ga0157375_10335922 3300013308 Bacteria 1676
83 Ga0157376_10065426 3300014969 Bacteria 3070
84 Ga0157376_10333518 3300014969 Bacteria 1446
85 Ga0163161_10132913 3300017792 Bacteria 1879
86 Ga0206356_11236937 3300020070 Bacteria 4430
87 Ga0213876_10033275 3300021384 Bacteria 2718
88 Ga0213876_10043282 3300021384 Bacteria 2380
89 Ga0213875_10001491 3300021388 Bacteria 15046
90 Ga0213875_10003305 3300021388 Bacteria 9220
91 Ga0213875_10005869 3300021388 Bacteria 6526
92 Ga0213875_10007860 3300021388 Bacteria 5481
93 Ga0213871_10029438 3300021441 Bacteria 1424
94 Ga0224712_10036312 3300022467 Bacteria 1825
95 Ga0207656_10110206 3300025321 Bacteria 1271
96 Ga0207682_10056135 3300025893 Bacteria 1639
97 Ga0207688_10047721 3300025901 Bacteria 2391
98 Ga0207699_10040242 3300025906 Bacteria 2692
99 Ga0207645_10042114 3300025907 Bacteria 2922
100 Ga0207705_10017958 3300025909 Bacteria 5059
101 Ga0207654_10179271 3300025911 Bacteria 1381
102 Ga0207707_10000536 3300025912 Bacteria 38752
103 Ga0207707_10194102 3300025912 Bacteria 1771
104 Ga0207695_10164513 3300025913 Bacteria 2147
105 Ga0207695_10305356 3300025913 Bacteria 1482
106 Ga0207660_10069555 3300025917 Bacteria 2557
107 Ga0207660_10090925 3300025917 Bacteria 2262
108 Ga0207657_10055072 3300025919 Bacteria 3437
109 Ga0207657_10203317 3300025919 Bacteria 1592
110 Ga0207649_10081610 3300025920 Bacteria 2094
111 Ga0207652_10156221 3300025921 Bacteria 2044
112 Ga0207650_10014364 3300025925 Bacteria 5504
113 Ga0207687_10354583 3300025927 Bacteria 1196
114 Ga0207700_10000021 3300025928 Bacteria 168335
115 Ga0207700_10072748 3300025928 Bacteria 2652
116 Ga0207700_10151630 3300025928 Bacteria 1916
117 Ga0207664_10091116 3300025929 Bacteria 2499
118 Ga0207690_10097964 3300025932 Bacteria 2088
119 Ga0207690_10356214 3300025932 Bacteria 1158
120 Ga0207706_10010175 3300025933 Bacteria 8608
121 Ga0207665_10007859 3300025939 Bacteria 7044
122 Ga0207691_10012112 3300025940 Bacteria 8267
123 Ga0207689_10194272 3300025942 Bacteria 1675
124 Ga0207661_10000054 3300025944 Bacteria 88056
125 Ga0207679_10287447 3300025945 Bacteria 1412
126 Ga0207667_10006004 3300025949 Bacteria 14776
127 Ga0207667_10007166 3300025949 Bacteria 13458
128 Ga0207667_10023116 3300025949 Bacteria 6848
129 Ga0207667_10100008 3300025949 Bacteria 2992
130 Ga0207667_10384962 3300025949 Bacteria 1429
131 Ga0207640_10000008 3300025981 Bacteria 290578
132 Ga0207677_10056783 3300026023 Bacteria 2684
133 Ga0207639_10179289 3300026041 Bacteria 1801
134 Ga0207678_10133045 3300026067 Bacteria 2122
135 Ga0207678_10163295 3300026067 Bacteria 1902
136 Ga0207702_10081824 3300026078 Bacteria 2805
137 Ga0207702_10103597 3300026078 Bacteria 2517
138 Ga0207702_10207018 3300026078 Bacteria 1822
139 Ga0207648_10137212 3300026089 Bacteria 2155
140 Ga0207683_10032540 3300026121 Bacteria 4530
141 Ga0207698_10014541 3300026142 Bacteria 5236
142 Ga0207698_10326041 3300026142 Bacteria 1440
143 Ga0207428_10190013 3300027907 Bacteria 1548
144 Ga0268266_10273911 3300028379 Bacteria 1568
145 Ga0265327_10019415 3300031251 Bacteria 4178
146 Ga0265316_10177290 3300031344 Bacteria 1588
147 Ga0307406_10197739 3300031901 Bacteria 1477
148 Ga0373953_0013582 3300035117 Bacteria 2911
149 Ga0373954_0012884 3300035118 Bacteria 3723
150 Ga0373956_0071624 3300035119 Bacteria 1582
151 Ga0373957_0008307 3300035120 Bacteria 3357
152 Ga0373961_0052506 3300035241 Bacteria 1214
153 Ga0373935_0020497 3300035692 Bacteria 4041
154 Ga0373933_0019325 3300035724 Bacteria 3846
155 Ga0373937_0010355 3300036401 Bacteria 8142
156 Ga0395899_0000016 3300037312 Bacteria 468322
157 Ga0395898_0037526 3300037466 Bacteria 4805
158 Ga0395898_0186570 3300037466 Bacteria 1982
159 Ga0395905_0050620 3300037471 Bacteria 3891
160 Ga0436364_0064095 3300037853 Bacteria 1635
161 Ga0436364_0094686 3300037853 Bacteria 72452
162 Ga0436364_0160944 3300037853 Bacteria 2597
163 Ga0436364_0166409 3300037853 Bacteria 19850
164 Ga0436364_0248337 3300037853 Bacteria 33675
165 Ga0436364_0383382 3300037853 Bacteria 3217
166 Ga0436364_0830211 3300037853 Bacteria 1102
167 Ga0436364_1164383 3300037853 Bacteria 4213
168 Ga0436364_1179706 3300037853 Bacteria 3255
169 Ga0436364_1240134 3300037853 Bacteria 27720
170 Ga0436364_1352268 3300037853 Bacteria 3749
171 Ga0395901_0604319 3300038443 Bacteria 1106
172 Ga0436365_0134845 3300039437 Bacteria 1489
173 Ga0436365_0688452 3300039437 Bacteria 7048
174 Ga0436365_1418489 3300039437 Bacteria 3545
175 Ga0436365_1734642 3300039437 Bacteria 2788
176 Ga0436360_0156165 3300039438 Bacteria 1145
177 Ga0436360_0792075 3300039438 Bacteria 1482
178 Ga0436361_0363184 3300039447 Bacteria 7728
179 Ga0436361_0612693 3300039447 Bacteria 2896
180 Ga0436361_0791255 3300039447 Bacteria 1293
181 Ga0436361_1163230 3300039447 Bacteria 2118
182 Ga0436363_0213753 3300039450 Bacteria 1260
183 Ga0436362_0395329 3300039453 Bacteria 3692
184 Ga0436362_1283942 3300039453 Bacteria 3061
185 Ga0451577_0350450 3300042876 Bacteria 1339
186 Ga0466957_0214099 3300044842 Bacteria 1270
187 Ga0466960_0238599 3300044901 Bacteria 1006
188 Ga0451576_0159514 3300045051 Bacteria 2353
189 Ga0466967_0007616 3300045976 Bacteria 7833
190 Ga0466967_0212121 3300045976 Bacteria 1837
191 Ga0466967_0229840 3300045976 Bacteria 1766
192 Ga0466967_0314186 3300045976 Bacteria 1510
193 Ga0495664_0013547 3300046477 Bacteria 4625
194 Ga0495664_0055191 3300046477 Bacteria 2364
195 Ga0495640_0042265 3300046533 Bacteria 3182
196 Ga0495600_0191571 3300046809 Bacteria 1315
197 Ga0495674_0163555 3300047319 Bacteria 1861
198 Ga0495684_0068696 3300047471 Bacteria 2694
199 Ga0496104_0498297 3300048907 Bacteria 1129
200 Ga0496106_0093319 3300048909 Bacteria 2326
201 Ga0496110_0162153 3300048913 Bacteria 2027
202 Ga0496110_0171835 3300048913 Bacteria 1966
203 Ga0496110_0514619 3300048913 Bacteria 1089
204 Ga0496111_0337640 3300048914 Bacteria 1115
205 Ga0496111_0436898 3300048914 Bacteria 966
206 Ga0496112_0042173 3300048915 Bacteria 4464
207 Ga0496112_0343721 3300048915 Bacteria 1435
208 Ga0496112_0540873 3300048915 Bacteria 1099
209 Ga0496113_0424107 3300048916 Bacteria 1068
210 Ga0496115_0009942 3300048918 Bacteria 7088
211 Ga0501298_013555 3300049521 Bacteria 1445
212 Ga0501034_0002234 3300049571 Bacteria 23834
213 Ga0501077_0075118 3300049593 Bacteria 2140
214 Ga0501045_0240387 3300049824 Bacteria 1348
215 nmdc:mga05p37_212685_c1 3300050507 Bacteria 2337
216 nmdc:mga08y16_133573_c1 3300050511 Bacteria 2579
217 nmdc:mga0n895_513251_c1 3300050512 Bacteria 1207
218 nmdc:mga0n895_653929_c1 3300050512 Bacteria 1050
219 nmdc:mga0n895_7520_c1 3300050512 Bacteria 9358
220 nmdc:mga0n895_95683_c1 3300050512 Bacteria 2975
221 nmdc:mga0rr50_129738_c1 3300050513 Unclassified 2017
222 nmdc:mga0rr50_212824_c1 3300050513 Bacteria 1593
223 nmdc:mga0rr50_314908_c1 3300050513 Bacteria 1311
224 nmdc:mga0rr50_46740_c1 3300050513 Bacteria 3188
225 nmdc:mga08x19_189640_c1 3300050514 Bacteria 1406
226 nmdc:mga08x19_223336_c1 3300050514 Bacteria 1295
227 nmdc:mga08x19_5369_c1 3300050514 Bacteria 7574
228 nmdc:mga0a205_162978_c1 3300050515 Bacteria 2125
229 Ga0495612_0050215 3300053078 Bacteria 1713
230 Ga0495619_0069741 3300053085 Bacteria 2350
231 Ga0501084_0282942 3300054114 Unclassified 1401
232 Ga0587128_017830 3300059630 Bacteria 1056
233 Ga0587076_011553 3300059645 Bacteria 1301
234 2545673042 2545555834 Bacteria 8130841
235 2523104247 2522572158 Bacteria 6514390
236 2671692151 2671180139 Bacteria 4196045
237 2842334571 2842333319 Bacteria 8899485
238 2868089516 2868088558 Bacteria 7609351
239 2902331454 2902330777 Bacteria 6395352
240 3000405866 3000405567 Bacteria 3779330
241 641645934 641522639 Bacteria 7737025
242 Ga0065715_10091673
243 Ga0070658_10021172
244 Ga0070683_100000311
245 Ga0070683_100176210
246 Ga0070670_100010379
247 Ga0070677_10061548
248 Ga0068869_100112236
249 Ga0070680_100071329
250 Ga0070680_100147747
251 Ga0068868_100106022
252 Ga0070660_100179548
253 Ga0070660_100224640
254 Ga0070691_10013589
255 Ga0070661_100045977
256 Ga0070661_100185575
257 Ga0070669_100007683
258 Ga0070674_100124361
259 Ga0070688_100376784
260 Ga0070709_10045390
261 Ga0070714_100170883
262 Ga0070713_100010298
263 Ga0070713_100037626
264 Ga0070713_100058121
265 Ga0070713_100161603
266 Ga0070713_100191699
267 Ga0070705_100066499
268 Ga0070663_100095214
269 Ga0070663_100349558
270 Ga0070681_10101501
271 Ga0070681_10135387
272 Ga0070685_10283691
273 Ga0070679_100005194
274 Ga0070679_100138997
275 Ga0070684_100000083
276 Ga0070684_100043211
277 Ga0070672_100317420
278 Ga0070686_100039985
279 Ga0070695_100058287
280 Ga0070693_100051828
281 Ga0068855_100007231
282 Ga0068855_100015216
283 Ga0068855_100066753
284 Ga0070664_100009777
285 Ga0068854_100000079
286 Ga0068854_100028299
287 Ga0068856_100009798
288 Ga0068856_100039889
289 Ga0068856_100091131
290 Ga0068856_100103881
291 Ga0068856_100192462
292 Ga0068852_100006924
293 Ga0068852_100094689
294 Ga0068852_100511325
295 Ga0068851_10083502
296 Ga0081455_10103693
297 Ga0070717_10074697
298 Ga0075433_10081288
299 Ga0075434_100014842
300 Ga0075434_100038802
301 Ga0075434_100162393
302 Ga0075436_100002056
303 Ga0075435_100044378
304 Ga0075435_100188340
305 Ga0075435_100390671
306 Ga0111539_10165838
307 Ga0105245_10228739
308 Ga0114129_10099178
309 Ga0105241_10190960
310 Ga0105242_10081788
311 Ga0105248_10093774
312 Ga0105239_10118060
313 Ga0157373_10238718
314 Ga0157370_10431117
315 Ga0157369_10033613
316 Ga0157369_10470903
317 Ga0157374_10001531
318 Ga0157374_10033280
319 Ga0157374_10180209
320 Ga0157374_10729936
321 Ga0157378_10143377
322 Ga0157372_10235247
323 Ga0157375_10335922
324 Ga0157376_10065426
325 Ga0157376_10333518
326 Ga0163161_10132913
327 Ga0206356_11236937
328 Ga0213876_10033275
329 Ga0213876_10043282
330 Ga0213875_10001491
331 Ga0213875_10003305
332 Ga0213875_10005869
333 Ga0213875_10007860
334 Ga0213871_10029438
335 Ga0224712_10036312
336 Ga0207656_10110206
337 Ga0207682_10056135
338 Ga0207688_10047721
339 Ga0207699_10040242
340 Ga0207645_10042114
341 Ga0207705_10017958
342 Ga0207654_10179271
343 Ga0207707_10000536
344 Ga0207707_10194102
345 Ga0207695_10164513
346 Ga0207695_10305356
347 Ga0207660_10069555
348 Ga0207660_10090925
349 Ga0207657_10055072
350 Ga0207657_10203317
351 Ga0207649_10081610
352 Ga0207652_10156221
353 Ga0207650_10014364
354 Ga0207687_10354583
355 Ga0207700_10000021
356 Ga0207700_10072748
357 Ga0207700_10151630
358 Ga0207664_10091116
359 Ga0207690_10097964
360 Ga0207690_10356214
361 Ga0207706_10010175
362 Ga0207665_10007859
363 Ga0207691_10012112
364 Ga0207689_10194272
365 Ga0207661_10000054
366 Ga0207679_10287447
367 Ga0207667_10006004
368 Ga0207667_10007166
369 Ga0207667_10023116
370 Ga0207667_10100008
371 Ga0207667_10384962
372 Ga0207640_10000008
373 Ga0207677_10056783
374 Ga0207639_10179289
375 Ga0207678_10133045
376 Ga0207678_10163295
377 Ga0207702_10081824
378 Ga0207702_10103597
379 Ga0207702_10207018
380 Ga0207648_10137212
381 Ga0207683_10032540
382 Ga0207698_10014541
383 Ga0207698_10326041
384 Ga0207428_10190013
385 Ga0268266_10273911
386 Ga0265327_10019415
387 Ga0265316_10177290
388 Ga0307406_10197739
389 Ga0373953_0013582
390 Ga0373954_0012884
391 Ga0373956_0071624
392 Ga0373957_0008307
393 Ga0373961_0052506
394 Ga0373935_0020497
395 Ga0373933_0019325
396 Ga0373937_0010355
397 Ga0395899_0000016
398 Ga0395898_0037526
399 Ga0395898_0186570
400 Ga0395905_0050620
401 Ga0436364_0064095
402 Ga0436364_0094686
403 Ga0436364_0160944
404 Ga0436364_0166409
405 Ga0436364_0248337
406 Ga0436364_0383382
407 Ga0436364_0830211
408 Ga0436364_1164383
409 Ga0436364_1179706
410 Ga0436364_1240134
411 Ga0436364_1352268
412 Ga0395901_0604319
413 Ga0436365_0134845
414 Ga0436365_0688452
415 Ga0436365_1418489
416 Ga0436365_1734642
417 Ga0436360_0156165
418 Ga0436360_0792075
419 Ga0436361_0363184
420 Ga0436361_0612693
421 Ga0436361_0791255
422 Ga0436361_1163230
423 Ga0436363_0213753
424 Ga0436362_0395329
425 Ga0436362_1283942
426 Ga0451577_0350450
427 Ga0466957_0214099
428 Ga0466960_0238599
429 Ga0451576_0159514
430 Ga0466967_0007616
431 Ga0466967_0212121
432 Ga0466967_0229840
433 Ga0466967_0314186
434 Ga0495664_0013547
435 Ga0495664_0055191
436 Ga0495640_0042265
437 Ga0495600_0191571
438 Ga0495674_0163555
439 Ga0495684_0068696
440 Ga0496104_0498297
441 Ga0496106_0093319
442 Ga0496110_0162153
443 Ga0496110_0171835
444 Ga0496110_0514619
445 Ga0496111_0337640
446 Ga0496111_0436898
447 Ga0496112_0042173
448 Ga0496112_0343721
449 Ga0496112_0540873
450 Ga0496113_0424107
451 Ga0496115_0009942
452 Ga0501298_013555
453 Ga0501034_0002234
454 Ga0501077_0075118
455 Ga0501045_0240387
456 nmdc:mga05p37_212685_c1
457 nmdc:mga08y16_133573_c1
458 nmdc:mga0n895_513251_c1
459 nmdc:mga0n895_653929_c1
460 nmdc:mga0n895_7520_c1
461 nmdc:mga0n895_95683_c1
462 nmdc:mga0rr50_129738_c1
463 nmdc:mga0rr50_212824_c1
464 nmdc:mga0rr50_314908_c1
465 nmdc:mga0rr50_46740_c1
466 nmdc:mga08x19_189640_c1
467 nmdc:mga08x19_223336_c1
468 nmdc:mga08x19_5369_c1
469 nmdc:mga0a205_162978_c1
470 Ga0495612_0050215
471 Ga0495619_0069741
472 Ga0501084_0282942
473 Ga0587128_017830
474 Ga0587076_011553
475 2545673042
476 2523104247
477 2671692151
478 2842334571
479 2868089516
480 2902331454
481 3000405866
482 641645934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13247

Fer4_11

4Fe-4S dicluster domain

108

205

0.96

PF12837

Fer4_6

4Fe-4S binding domain

141

164

0.94

PF12838

Fer4_7

4Fe-4S dicluster domain

116

163

0.93

PF00037

Fer4

4Fe-4S binding domain

142

165

0.9

PF12838

Fer4_7

4Fe-4S dicluster domain

44

133

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kqf-assembly1.cif.gz_B formate dehydrogenase n from e. coli 0.8436 32 261
7z0s-assembly1.cif.gz_F structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) 0.8067 121 160
8bqk-assembly1.cif.gz_B w-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 22 min 0.7891 33 257
2vpw-assembly1.cif.gz_F polysulfide reductase with bound menaquinone 0.7674 32 250
8bqk-assembly1.cif.gz_B w-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 22 min 0.7665 33 257
ID Description Score Start End Superfamily
af_O06560_187_241_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8705 118 171 3.30.70.20
1kqgB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8647 116 177 3.30.70.20
af_O06560_187_241_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8433 118 171 3.30.70.20
2vpwB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8301 123 174 3.30.70.20
1vldX02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8272 118 175 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A534S9T3-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.9317 109 263 GO:0016020
GO:0030313
GO:0046872
GO:0051539
AF-A0A535J9L7-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.9183 110 266 GO:0016020
GO:0046872
GO:0051539
AF-X1GQM6-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.918 119 197 GO:0051539
AF-A0A0N0TK96-F1-model_v4 deleted 0.9147 109 264
AF-A0A7W1I727-F1-model_v4 4Fe-4S dicluster domain-containing protein 0.9085 84 263 GO:0016020
GO:0030313
GO:0046872
GO:0051539

Map