F354124

General Info

Members Datasets Scaffolds Average Seq Length
241 189 482 139

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0159566|Ga0501034_0159566_1712_2173
Length 153
Sequence MASIGSTREKEPIMKVLYTAHGSATGGREGKAATDTGNVKLVLNTPKELGGGGGDGTNPEQLFSMGYSACFLGALKFVANKEKVKIPDDAKVSADIGIGPRDDGQGFGIAAKLTVSVPGVDKAVVEDLVKKAHVVCPYSHATRGNIAVETTVA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
92 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
95 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
96 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
133 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
140 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
141 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
144 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
145 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
147 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
148 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
149 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
150 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
151 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
152 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
153 2643221573 Lysobacter sp. Root604 Isolate Unclassified
154 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
155 2643221720 Lysobacter sp. Root916 Isolate Unclassified
156 2643221728 Lysobacter sp. Root983 Isolate Unclassified
157 2643221733 Bosea sp. Root381 Isolate Unclassified
158 2643221734 Bosea sp. Root670 Isolate Unclassified
159 2643221736 Bosea sp. Root483D1 Isolate Unclassified
160 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
161 2818991467 Bosea vestrisii 3192 Isolate Unclassified
162 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
163 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
164 2841760612 Bosea sp. Tri-49 Isolate Nodule
165 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
166 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
167 2844104063 Bosea sp. Tri-39 Isolate Nodule
168 2851182111 Bosea sp. Tri-44 Isolate Nodule
169 2851246043 Bosea sp. Tri-54 Isolate Nodule
170 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
171 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
172 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
173 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
174 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
175 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
176 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
177 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
178 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
179 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
180 2941479691
181 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
182 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
183 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
184 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
185 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
186 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
187 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
188 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
189 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.82
Metatranscriptomes 0
Isolates 16.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.09
Nodule 4.56
Rhizoplane 2.9
Rhizosphere 51.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0159566 3300049571 Bacteria 2227
2 JGI24739J22299_10126803 3300001989 Bacteria 761
3 JGI25159J45721_1006753 3300002987 Bacteria 3381
4 JGI25151J46595_10000028 3300003187 Bacteria 208373
5 JGI25151J46595_10005760 3300003187 Bacteria 6348
6 Ga0055527_1003319 3300003760 Bacteria 2426
7 Ga0055526_1000470 3300003771 Bacteria 32053
8 Ga0055526_1002197 3300003771 Bacteria 13373
9 Ga0055524_1000020 3300003775 Bacteria 227971
10 Ga0055524_1030845 3300003775 Bacteria 1555
11 Ga0065165_1000141 3300005262 Bacteria 125536
12 Ga0070670_100636945 3300005331 Bacteria 956
13 Ga0068869_100303740 3300005334 Bacteria 1289
14 Ga0070666_10059176 3300005335 Bacteria 2591
15 Ga0070680_100249801 3300005336 Bacteria 1499
16 Ga0070668_100105750 3300005347 Bacteria 2235
17 Ga0070669_100942729 3300005353 Bacteria 739
18 Ga0070671_100002433 3300005355 Bacteria 14394
19 Ga0070667_100012297 3300005367 Bacteria 7081
20 Ga0070667_100313797 3300005367 Bacteria 1414
21 Ga0070663_101144963 3300005455 Bacteria 682
22 Ga0070678_100354337 3300005456 Bacteria 1263
23 Ga0070699_101190527 3300005518 Bacteria 699
24 Ga0068853_100126628 3300005539 Bacteria 2282
25 Ga0070696_100134246 3300005546 Bacteria 1803
26 Ga0070665_100141177 3300005548 Bacteria 2412
27 Ga0068854_100433966 3300005578 Bacteria 1094
28 Ga0068859_100000636 3300005617 Bacteria 35103
29 Ga0068864_102002929 3300005618 Bacteria 585
30 Ga0068861_100375224 3300005719 Bacteria 1255
31 Ga0068863_100004385 3300005841 Bacteria 13909
32 Ga0068858_100001214 3300005842 Bacteria 26746
33 Ga0068860_100097124 3300005843 Bacteria 2808
34 Ga0068860_100305727 3300005843 Bacteria 1559
35 Ga0075370_10409511 3300006353 Bacteria 814
36 Ga0097620_100000636 3300006931 Bacteria 35103
37 Ga0105251_10010248 3300009011 Bacteria 5455
38 Ga0105250_10056060 3300009092 Bacteria 1582
39 Ga0105240_10001399 3300009093 Bacteria 41442
40 Ga0105247_10000114 3300009101 Bacteria 80795
41 Ga0105243_11557303 3300009148 Bacteria 686
42 Ga0105248_10320427 3300009177 Bacteria 1746
43 Ga0105249_11849366 3300009553 Bacteria 676
44 Ga0105239_10215924 3300010375 Bacteria 2150
45 Ga0157371_10000003 3300013102 Bacteria 543317
46 Ga0157371_10041091 3300013102 Bacteria 3301
47 Ga0157371_11588225 3300013102 Bacteria 512
48 Ga0171462_1006 3300013250 Bacteria 432986
49 Ga0163162_10877883 3300013306 Bacteria 1011
50 Ga0157372_10791002 3300013307 Bacteria 1102
51 Ga0163163_10087193 3300014325 Bacteria 3131
52 Ga0182008_10053403 3300014497 Bacteria 2000
53 Ga0157379_10096637 3300014968 Bacteria 2651
54 Ga0182006_1006303 3300015261 Bacteria 5529
55 Ga0182007_10022161 3300015262 Bacteria 2247
56 Ga0183365_10006 3300015684 Bacteria 225936
57 Ga0213872_10041682 3300021361 Bacteria 2094
58 Ga0213875_10016995 3300021388 Bacteria 3522
59 Ga0213875_10088768 3300021388 Bacteria 1442
60 Ga0209672_100427 3300025228 Bacteria 24427
61 Ga0209565_1037625 3300025263 Bacteria 915
62 Ga0209673_1014568 3300025273 Bacteria 3037
63 Ga0209130_1000178 3300025284 Bacteria 90293
64 Ga0209675_1001055 3300025291 Bacteria 17091
65 Ga0209676_1037847 3300025292 Bacteria 1386
66 Ga0209025_1000008 3300025294 Bacteria 1130876
67 Ga0209025_1000165 3300025294 Bacteria 164692
68 Ga0209025_1002863 3300025294 Bacteria 17308
69 Ga0209025_1052655 3300025294 Bacteria 1605
70 Ga0209025_1119484 3300025294 Bacteria 790
71 Ga0209564_1000049 3300025295 Bacteria 362075
72 Ga0209564_1000065 3300025295 Bacteria 315205
73 Ga0209758_1111240 3300025297 Bacteria 757
74 Ga0209256_1000014 3300025299 Bacteria 687409
75 Ga0209256_1000208 3300025299 Bacteria 110551
76 Ga0207426_1004064 3300025302 Bacteria 7385
77 Ga0209257_1011963 3300025304 Bacteria 4087
78 Ga0209257_1033627 3300025304 Bacteria 1610
79 Ga0207655_1006526 3300025728 Bacteria 7712
80 Ga0207655_1007392 3300025728 Bacteria 7125
81 Ga0207710_10000211 3300025900 Bacteria 52161
82 Ga0207705_10011846 3300025909 Bacteria 6301
83 Ga0207681_10345356 3300025923 Bacteria 1190
84 Ga0207644_10001130 3300025931 Bacteria 17094
85 Ga0207706_10924434 3300025933 Bacteria 736
86 Ga0207669_10913350 3300025937 Bacteria 734
87 Ga0207711_10223985 3300025941 Bacteria 1721
88 Ga0207651_10450040 3300025960 Bacteria 1105
89 Ga0207712_10232495 3300025961 Bacteria 1481
90 Ga0207668_10412036 3300025972 Bacteria 1145
91 Ga0207658_10022117 3300025986 Bacteria 4423
92 Ga0207658_10315780 3300025986 Bacteria 1351
93 Ga0207703_10000949 3300026035 Bacteria 28057
94 Ga0207639_10031760 3300026041 Bacteria 3883
95 Ga0207641_10010773 3300026088 Bacteria 7497
96 Ga0207676_11495340 3300026095 Bacteria 672
97 Ga0268266_10295049 3300028379 Bacteria 1511
98 Ga0268265_11426700 3300028380 Bacteria 695
99 Ga0268264_10003039 3300028381 Bacteria 14548
100 Ga0307515_10344290 3300028794 Bacteria 1141
101 Ga0307413_10096365 3300031824 Bacteria 1942
102 Ga0307414_11042418 3300032004 Bacteria 754
103 Ga0373925_1292252 3300037068 Bacteria 599
104 Ga0395900_0032184 3300037418 Bacteria 5392
105 Ga0395900_0584769 3300037418 Bacteria 1058
106 Ga0395898_0472360 3300037466 Bacteria 1193
107 Ga0395898_0699947 3300037466 Bacteria 955
108 Ga0436364_0665168 3300037853 Bacteria 2377
109 Ga0436364_1236622 3300037853 Bacteria 9008
110 Ga0436361_1173984 3300039447 Bacteria 1162
111 Ga0439447_037113 3300041407 Bacteria 1202
112 Ga0439437_025702 3300042000 Bacteria 726
113 Ga0439448_0000150 3300042005 Bacteria 13581
114 Ga0439432_044879 3300042006 Bacteria 1392
115 Ga0439458_0144687 3300042157 Bacteria 635
116 Ga0439459_0039188 3300042438 Bacteria 1000
117 Ga0466957_0456805 3300044842 Bacteria 881
118 Ga0451576_0003066 3300045051 Bacteria 23490
119 Ga0451576_0003303 3300045051 Bacteria 22399
120 Ga0451576_0414056 3300045051 Bacteria 1414
121 Ga0466958_0000756 3300045836 Bacteria 14201
122 Ga0495638_0122258 3300046460 Bacteria 1537
123 Ga0495580_0048803 3300046472 Bacteria 2995
124 Ga0495664_0135657 3300046477 Bacteria 1491
125 Ga0495610_0028723 3300046512 Bacteria 2938
126 Ga0495648_0118850 3300046524 Bacteria 1424
127 Ga0495648_0120286 3300046524 Bacteria 1413
128 Ga0495597_0156674 3300046542 Bacteria 931
129 Ga0495661_0353622 3300046665 Bacteria 723
130 Ga0495670_0000033 3300046691 Bacteria 81716
131 Ga0495649_0153275 3300046694 Bacteria 1210
132 Ga0495674_0001762 3300047319 Bacteria 21317
133 Ga0495674_0040361 3300047319 Bacteria 4175
134 Ga0495672_0234526 3300047320 Bacteria 899
135 Ga0495673_0066170 3300047469 Bacteria 1533
136 Ga0495614_0180632 3300048089 Bacteria 949
137 Ga0496102_0828006 3300048905 Bacteria 848
138 Ga0496102_0944200 3300048905 Bacteria 784
139 Ga0496108_0400255 3300048911 Bacteria 1199
140 Ga0496109_1311552 3300048912 Bacteria 660
141 Ga0496112_0036653 3300048915 Bacteria 4785
142 Ga0496113_0622269 3300048916 Bacteria 864
143 Ga0496114_0123870 3300048917 Bacteria 2226
144 Ga0496117_0010881 3300048920 Bacteria 8206
145 Ga0496117_0268137 3300048920 Bacteria 921
146 Ga0496121_0014257 3300048924 Bacteria 8453
147 Ga0496121_0608718 3300048924 Bacteria 673
148 Ga0496122_0004346 3300048925 Bacteria 17714
149 Ga0496122_0019376 3300048925 Bacteria 6219
150 Ga0496122_0080231 3300048925 Bacteria 2276
151 Ga0496122_0291675 3300048925 Bacteria 885
152 Ga0496123_0000103 3300048926 Bacteria 168232
153 Ga0496123_0032940 3300048926 Bacteria 3738
154 Ga0496123_0098045 3300048926 Bacteria 1715
155 Ga0496123_0368811 3300048926 Bacteria 662
156 Ga0496124_0002914 3300048927 Bacteria 21576
157 Ga0496124_0017105 3300048927 Bacteria 6855
158 Ga0496124_0741377 3300048927 Bacteria 617
159 Ga0496125_0003833 3300048928 Bacteria 17846
160 Ga0496125_0010079 3300048928 Bacteria 9588
161 Ga0496125_0077548 3300048928 Bacteria 2561
162 Ga0496125_0350973 3300048928 Bacteria 881
163 Ga0496125_0758992 3300048928 Bacteria 507
164 Ga0496126_0001336 3300048929 Bacteria 39105
165 Ga0496126_0020291 3300048929 Bacteria 6522
166 Ga0496126_0031484 3300048929 Bacteria 5011
167 Ga0496126_0259633 3300048929 Bacteria 1445
168 Ga0496126_0263025 3300048929 Bacteria 1434
169 Ga0501031_0370682 3300049568 Bacteria 926
170 Ga0501033_0200261 3300049570 Bacteria 1426
171 Ga0501034_0441906 3300049571 Bacteria 1219
172 Ga0501034_0701473 3300049571 Bacteria 910
173 Ga0501034_0850899 3300049571 Bacteria 802
174 Ga0501034_1110541 3300049571 Bacteria 671
175 Ga0501036_0046324 3300049572 Bacteria 3682
176 Ga0501037_0023844 3300049573 Bacteria 4525
177 Ga0501037_0197079 3300049573 Bacteria 1424
178 Ga0501038_0045261 3300049574 Bacteria 3821
179 Ga0501043_0149432 3300049579 Bacteria 1828
180 Ga0501208_009803 3300049655 Bacteria 1335
181 Ga0501249_000230 3300049679 Bacteria 16815
182 Ga0501035_0043918 3300049822 Bacteria 4026
183 Ga0501044_0189597 3300049823 Bacteria 2019
184 Ga0501044_1334622 3300049823 Bacteria 583
185 Ga0501045_0357349 3300049824 Bacteria 1087
186 nmdc:mga00v17_162206_c1 3300050491 Bacteria 1439
187 nmdc:mga0k408_271988_c1 3300050493 Bacteria 1011
188 nmdc:mga0sz30_105941_c1 3300050516 Bacteria 1230
189 nmdc:mga0sz30_503314_c1 3300050516 Bacteria 545
190 Ga0500635_0025280 3300053080 Bacteria 1869
191 Ga0500651_0753119 3300053093 Bacteria 517
192 Ga0500562_049698 3300053108 Bacteria 1121
193 Ga0500608_000131 3300053122 Bacteria 30612
194 Ga0500608_193312 3300053122 Bacteria 849
195 Ga0500559_0475341 3300053136 Bacteria 576
196 Ga0500561_0046457 3300053137 Bacteria 1169
197 Ga0500577_0211765 3300053142 Bacteria 838
198 Ga0500616_0010099 3300053153 Bacteria 5671
199 Ga0500616_0025303 3300053153 Bacteria 3293
200 Ga0500627_0116357 3300053158 Bacteria 1204
201 Ga0500636_0018530 3300053177 Bacteria 4116
202 Ga0500637_0120142 3300053178 Bacteria 1524
203 2523469885 2523231067 Bacteria 5230452
204 2643756418 2643221547 Bacteria 4740017
205 2643878275 2643221573 Bacteria 4784121
206 2644362115 2643221665 Bacteria 4699229
207 2644659580 2643221720 Bacteria 4694283
208 2644700671 2643221728 Bacteria 4797149
209 2644732249 2643221733 Bacteria 5690728
210 2644734951 2643221734 Bacteria 5365412
211 2644745360 2643221736 Bacteria 6608466
212 2745160494 2744054655 Bacteria 3552603
213 2819719500 2818991467 Bacteria 5893227
214 2834645242 2834641062 Bacteria 5559922
215 2837652637 2837651117 Bacteria 3772164
216 2841760870 2841760612 Bacteria 6454112
217 2841912865 2841911363 Bacteria 6173697
218 2841918612 2841917233 Bacteria 6173500
219 2844106527 2844104063 Bacteria 6440972
220 2851187519 2851182111 Bacteria 6047226
221 2851246883 2851246043 Bacteria 6439203
222 2891376471 2891373044 Bacteria 5202277
223 2898795440 2898795034 Bacteria 4294459
224 2904694663 2904690495 Bacteria 9412302
225 2908760213 2908756301 Bacteria 8864324
226 2909401540 2909399089 Bacteria 3922598
227 2917558099 2917554339 Bacteria 4987857
228 2917704739 2917699015 Bacteria 7043791
229 2919680033 2919679072 Bacteria 4629602
230 2928519512 2928515477 Bacteria 4448421
231 2929206105 2929199973 Bacteria 7260745
232 2941484167
233 2989355165 2989349275 Bacteria 6349068
234 3003932399 3003930520 Bacteria 5667563
235 642597399 642555112 Bacteria 8676562
236 643391201 643348555 Bacteria 3914947
237 8002746997 8002745576 Bacteria 4840272
238 8003403551 8003400568 Bacteria 5535898
239 8054560069 8054558443 Bacteria 5204801
240 8055912605 8055909800 Bacteria 7278581
241 8057530913 8057529695 Bacteria 6306553
242 Ga0501034_0159566
243 JGI24739J22299_10126803
244 JGI25159J45721_1006753
245 JGI25151J46595_10000028
246 JGI25151J46595_10005760
247 Ga0055527_1003319
248 Ga0055526_1000470
249 Ga0055526_1002197
250 Ga0055524_1000020
251 Ga0055524_1030845
252 Ga0065165_1000141
253 Ga0070670_100636945
254 Ga0068869_100303740
255 Ga0070666_10059176
256 Ga0070680_100249801
257 Ga0070668_100105750
258 Ga0070669_100942729
259 Ga0070671_100002433
260 Ga0070667_100012297
261 Ga0070667_100313797
262 Ga0070663_101144963
263 Ga0070678_100354337
264 Ga0070699_101190527
265 Ga0068853_100126628
266 Ga0070696_100134246
267 Ga0070665_100141177
268 Ga0068854_100433966
269 Ga0068859_100000636
270 Ga0068864_102002929
271 Ga0068861_100375224
272 Ga0068863_100004385
273 Ga0068858_100001214
274 Ga0068860_100097124
275 Ga0068860_100305727
276 Ga0075370_10409511
277 Ga0097620_100000636
278 Ga0105251_10010248
279 Ga0105250_10056060
280 Ga0105240_10001399
281 Ga0105247_10000114
282 Ga0105243_11557303
283 Ga0105248_10320427
284 Ga0105249_11849366
285 Ga0105239_10215924
286 Ga0157371_10000003
287 Ga0157371_10041091
288 Ga0157371_11588225
289 Ga0171462_1006
290 Ga0163162_10877883
291 Ga0157372_10791002
292 Ga0163163_10087193
293 Ga0182008_10053403
294 Ga0157379_10096637
295 Ga0182006_1006303
296 Ga0182007_10022161
297 Ga0183365_10006
298 Ga0213872_10041682
299 Ga0213875_10016995
300 Ga0213875_10088768
301 Ga0209672_100427
302 Ga0209565_1037625
303 Ga0209673_1014568
304 Ga0209130_1000178
305 Ga0209675_1001055
306 Ga0209676_1037847
307 Ga0209025_1000008
308 Ga0209025_1000165
309 Ga0209025_1002863
310 Ga0209025_1052655
311 Ga0209025_1119484
312 Ga0209564_1000049
313 Ga0209564_1000065
314 Ga0209758_1111240
315 Ga0209256_1000014
316 Ga0209256_1000208
317 Ga0207426_1004064
318 Ga0209257_1011963
319 Ga0209257_1033627
320 Ga0207655_1006526
321 Ga0207655_1007392
322 Ga0207710_10000211
323 Ga0207705_10011846
324 Ga0207681_10345356
325 Ga0207644_10001130
326 Ga0207706_10924434
327 Ga0207669_10913350
328 Ga0207711_10223985
329 Ga0207651_10450040
330 Ga0207712_10232495
331 Ga0207668_10412036
332 Ga0207658_10022117
333 Ga0207658_10315780
334 Ga0207703_10000949
335 Ga0207639_10031760
336 Ga0207641_10010773
337 Ga0207676_11495340
338 Ga0268266_10295049
339 Ga0268265_11426700
340 Ga0268264_10003039
341 Ga0307515_10344290
342 Ga0307413_10096365
343 Ga0307414_11042418
344 Ga0373925_1292252
345 Ga0395900_0032184
346 Ga0395900_0584769
347 Ga0395898_0472360
348 Ga0395898_0699947
349 Ga0436364_0665168
350 Ga0436364_1236622
351 Ga0436361_1173984
352 Ga0439447_037113
353 Ga0439437_025702
354 Ga0439448_0000150
355 Ga0439432_044879
356 Ga0439458_0144687
357 Ga0439459_0039188
358 Ga0466957_0456805
359 Ga0451576_0003066
360 Ga0451576_0003303
361 Ga0451576_0414056
362 Ga0466958_0000756
363 Ga0495638_0122258
364 Ga0495580_0048803
365 Ga0495664_0135657
366 Ga0495610_0028723
367 Ga0495648_0118850
368 Ga0495648_0120286
369 Ga0495597_0156674
370 Ga0495661_0353622
371 Ga0495670_0000033
372 Ga0495649_0153275
373 Ga0495674_0001762
374 Ga0495674_0040361
375 Ga0495672_0234526
376 Ga0495673_0066170
377 Ga0495614_0180632
378 Ga0496102_0828006
379 Ga0496102_0944200
380 Ga0496108_0400255
381 Ga0496109_1311552
382 Ga0496112_0036653
383 Ga0496113_0622269
384 Ga0496114_0123870
385 Ga0496117_0010881
386 Ga0496117_0268137
387 Ga0496121_0014257
388 Ga0496121_0608718
389 Ga0496122_0004346
390 Ga0496122_0019376
391 Ga0496122_0080231
392 Ga0496122_0291675
393 Ga0496123_0000103
394 Ga0496123_0032940
395 Ga0496123_0098045
396 Ga0496123_0368811
397 Ga0496124_0002914
398 Ga0496124_0017105
399 Ga0496124_0741377
400 Ga0496125_0003833
401 Ga0496125_0010079
402 Ga0496125_0077548
403 Ga0496125_0350973
404 Ga0496125_0758992
405 Ga0496126_0001336
406 Ga0496126_0020291
407 Ga0496126_0031484
408 Ga0496126_0259633
409 Ga0496126_0263025
410 Ga0501031_0370682
411 Ga0501033_0200261
412 Ga0501034_0441906
413 Ga0501034_0701473
414 Ga0501034_0850899
415 Ga0501034_1110541
416 Ga0501036_0046324
417 Ga0501037_0023844
418 Ga0501037_0197079
419 Ga0501038_0045261
420 Ga0501043_0149432
421 Ga0501208_009803
422 Ga0501249_000230
423 Ga0501035_0043918
424 Ga0501044_0189597
425 Ga0501044_1334622
426 Ga0501045_0357349
427 nmdc:mga00v17_162206_c1
428 nmdc:mga0k408_271988_c1
429 nmdc:mga0sz30_105941_c1
430 nmdc:mga0sz30_503314_c1
431 Ga0500635_0025280
432 Ga0500651_0753119
433 Ga0500562_049698
434 Ga0500608_000131
435 Ga0500608_193312
436 Ga0500559_0475341
437 Ga0500561_0046457
438 Ga0500577_0211765
439 Ga0500616_0010099
440 Ga0500616_0025303
441 Ga0500627_0116357
442 Ga0500636_0018530
443 Ga0500637_0120142
444 2523469885
445 2643756418
446 2643878275
447 2644362115
448 2644659580
449 2644700671
450 2644732249
451 2644734951
452 2644745360
453 2745160494
454 2819719500
455 2834645242
456 2837652637
457 2841760870
458 2841912865
459 2841918612
460 2844106527
461 2851187519
462 2851246883
463 2891376471
464 2898795440
465 2904694663
466 2908760213
467 2909401540
468 2917558099
469 2917704739
470 2919680033
471 2928519512
472 2929206105
473 2941484167
474 2989355165
475 3003932399
476 642597399
477 643391201
478 8002746997
479 8003403551
480 8054560069
481 8055912605
482 8057530913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

52

151

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ecy-assembly1.cif.gz_A ohra (organic hydroperoxide resistance protein) wild type from chromobacterium violaceum 0.9793 2 140
6ebd-assembly2.cif.gz_D ohrb (organic hydroperoxide resistance protein) mutant (c60a) from chromobacterium violaceum, interacting with dihydrolipoamide 0.979 1 140
6ebg-assembly2.cif.gz_C ohr (organic hydroperoxide resistance protein) mutant - c60s interacting with dihydrolipoamide 0.9788 1 140
6ecy-assembly1.cif.gz_B ohra (organic hydroperoxide resistance protein) wild type from chromobacterium violaceum 0.9769 2 140
6ebc-assembly2.cif.gz_D ohrb (organic hydroperoxide resistance protein) wild type from chromobacterium violaceum and reduced by dtt 0.9737 2 140
ID Description Score Start End Superfamily
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9639 45 140 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9579 45 140 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9539 45 140 3.30.300.20
1uspA01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9523 3 44 2.20.25.10
1uspA01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9312 3 44 2.20.25.10
ID Description Score Start End GO Terms
AF-A0A2U1UZZ9-F1-model_v4 Organic hydroperoxide resistance protein 0.998 42 140 GO:0006979
AF-A0A0P9ULJ2-F1-model_v4 Organic hydroperoxide resistance protein 0.9901 43 140 GO:0006979
AF-A0A426SWX4-F1-model_v4 deleted 0.9891 47 140
AF-A0A2J1D5D5-F1-model_v4 deleted 0.9857 66 140
AF-A0A839ZGG4-F1-model_v4 Ohr subfamily peroxiredoxin 0.9847 1 140 GO:0006979

Map