F354094

General Info

Members Datasets Scaffolds Average Seq Length
241 152 480 467

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0027720|Ga0496112_0027720_170_1684
Length 504
Sequence MSGVPREVASQLFLSMTRTAKLYLLITSIAVLGIFGLVHLGSELPAPVPAAGETTQLAQPAVGHAPIAGNGSFFANAASALFQNSASGLGRLFLQLFVILVACAIVAGLFTRLGQPAVVGEMMAGILLGPSLFGWLAPHAFGFLFAPSTLEPLRLLSQIGVCLFMFAVGMELDVAHLRRQVQTAILVSHSSIVIPYLLGVAFALFVYSALAKAGASFTAFALFMGISMSITAFPVLVRILKDRRLFNTSLGATATACAAVDDVTAWTILAFVVAIARAANLSAATFSFALVLIFVGLMLTLVRPAIYRLIGQPAMEEPEPNRRTLGIVVAIVLASSFSTETIGIHALFGAFLAGVIMPRTNDFREKLAIRVENISSVLFLPVFFAFTGLRTQIGLLNTGYDWAVCGIIIGIATLGKLGGSALAARLTGLNGRSSLQLGALMNTRGLMELIALNIGYDLGILSQRIFAMLVIMALVTTTLTGPLLTLFGSRAPALARPGEEPIYS

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
124 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
125 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
126 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
149 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
150 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
151 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
152 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 4.98
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 15.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0027720 3300048915 Bacteria 5463
2 JGI24746J21847_1000094 3300001977 Bacteria 9909
3 rootH2_10025496 3300003320 Bacteria 13537
4 rootH2_10044540 3300003320 Bacteria 6384
5 rootH1_10092342 3300003323 Bacteria 14909
6 Ga0065704_10112932 3300005289 Unclassified 1923
7 Ga0070658_10012058 3300005327 Bacteria 6941
8 Ga0070658_10045129 3300005327 Bacteria 3563
9 Ga0070676_10011602 3300005328 Bacteria 4793
10 Ga0070676_10038659 3300005328 Bacteria 2757
11 Ga0070690_100129517 3300005330 Unclassified 1702
12 Ga0070670_100004476 3300005331 Bacteria 11707
13 Ga0070670_100006380 3300005331 Bacteria 9982
14 Ga0070670_100036237 3300005331 Bacteria 4245
15 Ga0070677_10004713 3300005333 Bacteria 4465
16 Ga0068869_100069308 3300005334 Bacteria 2607
17 Ga0070666_10125606 3300005335 Bacteria 1781
18 Ga0070680_100002980 3300005336 Bacteria 12582
19 Ga0068868_100035757 3300005338 Unclassified 3841
20 Ga0068868_100037979 3300005338 Bacteria 3736
21 Ga0070660_100005821 3300005339 Bacteria 8534
22 Ga0070689_100003005 3300005340 Bacteria 11096
23 Ga0070689_100010861 3300005340 Bacteria 6509
24 Ga0070689_100014180 3300005340 Bacteria 5785
25 Ga0070689_100027708 3300005340 Bacteria 4273
26 Ga0070689_100032484 3300005340 Bacteria 3970
27 Ga0070687_100000690 3300005343 Bacteria 11280
28 Ga0070668_100006835 3300005347 Bacteria 8454
29 Ga0070668_100013133 3300005347 Bacteria 6174
30 Ga0070668_100050700 3300005347 Bacteria 3196
31 Ga0070668_100078623 3300005347 Unclassified 2580
32 Ga0070669_100009700 3300005353 Bacteria 6858
33 Ga0070669_100011861 3300005353 Bacteria 6182
34 Ga0070669_100050724 3300005353 Bacteria 3031
35 Ga0070675_100006633 3300005354 Bacteria 8898
36 Ga0070675_100014831 3300005354 Bacteria 6151
37 Ga0070675_100037223 3300005354 Bacteria 3962
38 Ga0070675_100085163 3300005354 Bacteria 2640
39 Ga0070671_100036728 3300005355 Unclassified 4063
40 Ga0070671_100150863 3300005355 Bacteria 1962
41 Ga0070674_100085378 3300005356 Unclassified 2265
42 Ga0070673_100004914 3300005364 Bacteria 8512
43 Ga0070673_100099012 3300005364 Bacteria 2397
44 Ga0070673_100197730 3300005364 Unclassified 1730
45 Ga0070688_100002536 3300005365 Bacteria 9243
46 Ga0070688_100015849 3300005365 Bacteria 4297
47 Ga0070688_100029246 3300005365 Bacteria 3298
48 Ga0070659_100022548 3300005366 Bacteria 4808
49 Ga0070667_100018123 3300005367 Bacteria 5838
50 Ga0070667_100071570 3300005367 Bacteria 2953
51 Ga0070667_100081809 3300005367 Bacteria 2764
52 Ga0070667_100107165 3300005367 Unclassified 2419
53 Ga0070703_10001287 3300005406 Bacteria 7607
54 Ga0070713_100029325 3300005436 Unclassified 4356
55 Ga0070701_10103537 3300005438 Bacteria 1580
56 Ga0070694_100007452 3300005444 Bacteria 6672
57 Ga0070708_100005541 3300005445 Bacteria 10005
58 Ga0070663_100027191 3300005455 Bacteria 3882
59 Ga0070663_100147544 3300005455 Bacteria 1801
60 Ga0070662_100011697 3300005457 Bacteria 5792
61 Ga0070681_10000373 3300005458 Bacteria 36140
62 Ga0068867_100000015 3300005459 Bacteria 108965
63 Ga0068867_100044630 3300005459 Bacteria 3248
64 Ga0070706_100017825 3300005467 Bacteria 6551
65 Ga0070706_100115098 3300005467 Unclassified 2504
66 Ga0070706_100131698 3300005467 Unclassified 2333
67 Ga0070679_100000755 3300005530 Bacteria 28011
68 Ga0070679_100007517 3300005530 Bacteria 10191
69 Ga0070679_100018690 3300005530 Bacteria 6728
70 Ga0070679_100106228 3300005530 Bacteria 2793
71 Ga0070697_100001813 3300005536 Bacteria 16317
72 Ga0070672_100008055 3300005543 Bacteria 7199
73 Ga0070672_100018057 3300005543 Bacteria 5091
74 Ga0070695_100110264 3300005545 Bacteria 1866
75 Ga0070696_100016810 3300005546 Bacteria 4935
76 Ga0070693_100001809 3300005547 Bacteria 9753
77 Ga0070665_100150966 3300005548 Bacteria 2326
78 Ga0070704_100003738 3300005549 Bacteria 8761
79 Ga0068855_100001770 3300005563 Bacteria 26988
80 Ga0070664_100000767 3300005564 Bacteria 24760
81 Ga0070664_100024614 3300005564 Bacteria 4982
82 Ga0068856_100048026 3300005614 Bacteria 4205
83 Ga0068863_100215689 3300005841 Unclassified 1848
84 Ga0068860_100003130 3300005843 Bacteria 17095
85 Ga0068860_100010145 3300005843 Bacteria 9332
86 Ga0068860_100101316 3300005843 Bacteria 2748
87 Ga0068862_100075854 3300005844 Bacteria 2909
88 Ga0081455_10000805 3300005937 Bacteria 40380
89 Ga0081539_10037390 3300005985 Unclassified 2892
90 Ga0070717_10122378 3300006028 Unclassified 2230
91 Ga0070717_10171892 3300006028 Bacteria 1885
92 Ga0097621_100085656 3300006237 Unclassified 2628
93 Ga0068871_100006354 3300006358 Bacteria 8353
94 Ga0075428_100261948 3300006844 Bacteria 1861
95 Ga0075434_100016936 3300006871 Bacteria 7011
96 Ga0068865_100110124 3300006881 Bacteria 2030
97 Ga0075436_100116398 3300006914 Unclassified 1868
98 Ga0075435_100156589 3300007076 Bacteria 1917
99 Ga0105240_10001023 3300009093 Bacteria 49771
100 Ga0105245_10027053 3300009098 Bacteria 5052
101 Ga0114129_10004827 3300009147 Bacteria 19042
102 Ga0105243_10000014 3300009148 Bacteria 264650
103 Ga0105243_10049058 3300009148 Bacteria 3330
104 Ga0105242_10006715 3300009176 Bacteria 8875
105 Ga0105237_10169644 3300009545 Unclassified 2182
106 Ga0105249_10000028 3300009553 Bacteria 230039
107 Ga0105249_10006729 3300009553 Bacteria 10013
108 Ga0105239_10014203 3300010375 Bacteria 8839
109 Ga0105239_10033951 3300010375 Bacteria 5602
110 Ga0105246_10023364 3300011119 Unclassified 4000
111 Ga0157374_10023058 3300013296 Bacteria 5561
112 Ga0157374_10070706 3300013296 Unclassified 3289
113 Ga0157374_10091620 3300013296 Bacteria 2899
114 Ga0157378_10022266 3300013297 Bacteria 5578
115 Ga0157378_10022611 3300013297 Bacteria 5533
116 Ga0157378_10058630 3300013297 Bacteria 3434
117 Ga0157378_10068197 3300013297 Bacteria 3189
118 Ga0157378_10198913 3300013297 Unclassified 1895
119 Ga0157378_10227665 3300013297 Bacteria 1775
120 Ga0163162_10000027 3300013306 Bacteria 178451
121 Ga0163162_10008311 3300013306 Bacteria 10127
122 Ga0163162_10081979 3300013306 Unclassified 3297
123 Ga0157375_10004354 3300013308 Bacteria 12290
124 Ga0157375_10006727 3300013308 Bacteria 10013
125 Ga0157380_10018784 3300014326 Bacteria 5140
126 Ga0157376_10069202 3300014969 Bacteria 2991
127 Ga0157376_10069875 3300014969 Bacteria 2979
128 Ga0207697_10000150 3300025315 Bacteria 34215
129 Ga0207697_10001112 3300025315 Bacteria 14823
130 Ga0207697_10007209 3300025315 Unclassified 4969
131 Ga0207697_10025630 3300025315 Unclassified 2410
132 Ga0207653_10001515 3300025885 Bacteria 7519
133 Ga0207682_10022774 3300025893 Bacteria 2471
134 Ga0207680_10002534 3300025903 Bacteria 8515
135 Ga0207680_10014381 3300025903 Bacteria 4093
136 Ga0207645_10001841 3300025907 Bacteria 17079
137 Ga0207645_10010146 3300025907 Bacteria 6478
138 Ga0207645_10013414 3300025907 Bacteria 5522
139 Ga0207645_10045134 3300025907 Bacteria 2817
140 Ga0207705_10012508 3300025909 Bacteria 6129
141 Ga0207684_10014382 3300025910 Bacteria 6824
142 Ga0207707_10000053 3300025912 Bacteria 116823
143 Ga0207695_10006316 3300025913 Bacteria 15416
144 Ga0207693_10082748 3300025915 Bacteria 2514
145 Ga0207657_10006849 3300025919 Bacteria 11756
146 Ga0207652_10000069 3300025921 Bacteria 109874
147 Ga0207652_10044653 3300025921 Bacteria 3776
148 Ga0207652_10063590 3300025921 Bacteria 3191
149 Ga0207681_10029926 3300025923 Bacteria 3544
150 Ga0207681_10100914 3300025923 Bacteria 2081
151 Ga0207650_10022729 3300025925 Bacteria 4442
152 Ga0207650_10065469 3300025925 Unclassified 2724
153 Ga0207659_10005384 3300025926 Bacteria 7755
154 Ga0207659_10016810 3300025926 Bacteria 4770
155 Ga0207659_10024602 3300025926 Bacteria 4037
156 Ga0207690_10134222 3300025932 Bacteria 1815
157 Ga0207706_10002125 3300025933 Bacteria 19402
158 Ga0207709_10000046 3300025935 Bacteria 240294
159 Ga0207670_10008738 3300025936 Bacteria 5736
160 Ga0207670_10019370 3300025936 Bacteria 4156
161 Ga0207670_10039895 3300025936 Bacteria 3078
162 Ga0207665_10141002 3300025939 Unclassified 1719
163 Ga0207691_10000995 3300025940 Bacteria 28158
164 Ga0207691_10029768 3300025940 Bacteria 5106
165 Ga0207661_10152310 3300025944 Bacteria 2000
166 Ga0207679_10007007 3300025945 Bacteria 7144
167 Ga0207651_10021072 3300025960 Bacteria 3951
168 Ga0207651_10037471 3300025960 Unclassified 3177
169 Ga0207651_10105728 3300025960 Unclassified 2100
170 Ga0207712_10000110 3300025961 Bacteria 89234
171 Ga0207712_10016417 3300025961 Bacteria 4794
172 Ga0207658_10003039 3300025986 Bacteria 11992
173 Ga0207658_10016332 3300025986 Bacteria 5105
174 Ga0207677_10022865 3300026023 Unclassified 3851
175 Ga0207677_10074338 3300026023 Bacteria 2411
176 Ga0207648_10000033 3300026089 Bacteria 126264
177 Ga0207648_10009927 3300026089 Bacteria 9075
178 Ga0207648_10018960 3300026089 Bacteria 6213
179 Ga0207683_10007758 3300026121 Bacteria 9186
180 Ga0268266_10008303 3300028379 Bacteria 9248
181 Ga0268266_10033681 3300028379 Bacteria 4354
182 Ga0268266_10053111 3300028379 Unclassified 3480
183 Ga0268264_10001045 3300028381 Bacteria 27605
184 Ga0268264_10006712 3300028381 Bacteria 9671
185 Ga0307515_10020633 3300028794 Bacteria 11737
186 Ga0265338_10008242 3300028800 Bacteria 12693
187 Ga0307511_10000386 3300030521 Bacteria 47126
188 Ga0265332_10020032 3300031238 Bacteria 2954
189 Ga0265327_10000009 3300031251 Bacteria 616360
190 Ga0307408_100000479 3300031548 Bacteria 34953
191 Ga0307408_100003300 3300031548 Bacteria 11096
192 Ga0307408_100063228 3300031548 Bacteria 2707
193 Ga0265313_10023094 3300031595 Bacteria 3357
194 Ga0265313_10034070 3300031595 Bacteria 2579
195 Ga0265314_10000400 3300031711 Bacteria 58830
196 Ga0307405_10023966 3300031731 Bacteria 3479
197 Ga0307406_10004474 3300031901 Bacteria 7607
198 Ga0307412_10000076 3300031911 Bacteria 96464
199 Ga0307416_100093063 3300032002 Bacteria 2595
200 Ga0307414_10000023 3300032004 Bacteria 208037
201 Ga0373955_0035809 3300035172 Bacteria 2631
202 Ga0373937_0076651 3300036401 Bacteria 3088
203 Ga0373937_0135191 3300036401 Viruses 2305
204 Ga0395901_0249861 3300038443 Bacteria 1848
205 Ga0439453_0002718 3300041408 Bacteria 2469
206 Ga0450890_000028 3300042127 Bacteria 34869
207 Ga0450892_000625 3300042130 Bacteria 3992
208 Ga0450893_0003681 3300042532 Bacteria 2422
209 Ga0495592_0111813 3300046454 Bacteria 1932
210 Ga0495651_0027155 3300046462 Bacteria 4459
211 Ga0495580_0126684 3300046472 Bacteria 1772
212 Ga0495630_0050180 3300046517 Bacteria 3123
213 Ga0495632_0111067 3300046519 Bacteria 1287
214 Ga0495652_0050723 3300046529 Bacteria 3547
215 Ga0495652_0071157 3300046529 Bacteria 2905
216 Ga0495613_0080971 3300046689 Bacteria 2360
217 Ga0496102_0123532 3300048905 Unclassified 2419
218 Ga0496103_0069597 3300048906 Unclassified 2200
219 Ga0496104_0148811 3300048907 Unclassified 2248
220 Ga0496106_0119013 3300048909 Unclassified 2063
221 Ga0496108_0149793 3300048911 Bacteria 2013
222 Ga0496109_0077417 3300048912 Bacteria 3061
223 Ga0496112_0029252 3300048915 Bacteria 5327
224 Ga0496112_0292302 3300048915 Bacteria 1575
225 Ga0496114_0000001 3300048917 Bacteria 893286
226 Ga0496114_0173321 3300048917 Bacteria 1881
227 Ga0496115_0045432 3300048918 Bacteria 3506
228 nmdc:mga05p37_38005_c1 3300050507 Bacteria 5904
229 nmdc:mga0n895_3103_c1 3300050512 Bacteria 11836
230 nmdc:mga0rr50_235382_c1 3300050513 Unclassified 1516
231 nmdc:mga08x19_110104_c1 3300050514 Unclassified 1836
232 nmdc:mga08x19_57872_c1 3300050514 Unclassified 2506
233 nmdc:mga08x19_74_c1 3300050514 Bacteria 96389
234 nmdc:mga0a205_331715_c1 3300050515 Unclassified 1391
235 Ga0495601_0136969 3300053077 Bacteria 1596
236 Ga0495595_0018477 3300053084 Bacteria 3013
237 Ga0500555_000015 3300053103 Bacteria 230204
238 Ga0500556_0003671 3300053104 Bacteria 4467
239 Ga0500622_0002789 3300053156 Bacteria 12278
240 2643794890 2643221555 Bacteria 3749717
241 Ga0496112_0027720
242 JGI24746J21847_1000094
243 rootH2_10025496
244 rootH2_10044540
245 rootH1_10092342
246 Ga0065704_10112932
247 Ga0070658_10012058
248 Ga0070658_10045129
249 Ga0070676_10011602
250 Ga0070676_10038659
251 Ga0070690_100129517
252 Ga0070670_100004476
253 Ga0070670_100006380
254 Ga0070670_100036237
255 Ga0070677_10004713
256 Ga0068869_100069308
257 Ga0070666_10125606
258 Ga0070680_100002980
259 Ga0068868_100035757
260 Ga0068868_100037979
261 Ga0070660_100005821
262 Ga0070689_100003005
263 Ga0070689_100010861
264 Ga0070689_100014180
265 Ga0070689_100027708
266 Ga0070689_100032484
267 Ga0070687_100000690
268 Ga0070668_100006835
269 Ga0070668_100013133
270 Ga0070668_100050700
271 Ga0070668_100078623
272 Ga0070669_100009700
273 Ga0070669_100011861
274 Ga0070669_100050724
275 Ga0070675_100006633
276 Ga0070675_100014831
277 Ga0070675_100037223
278 Ga0070675_100085163
279 Ga0070671_100036728
280 Ga0070671_100150863
281 Ga0070674_100085378
282 Ga0070673_100004914
283 Ga0070673_100099012
284 Ga0070673_100197730
285 Ga0070688_100002536
286 Ga0070688_100015849
287 Ga0070688_100029246
288 Ga0070659_100022548
289 Ga0070667_100018123
290 Ga0070667_100071570
291 Ga0070667_100081809
292 Ga0070667_100107165
293 Ga0070703_10001287
294 Ga0070713_100029325
295 Ga0070701_10103537
296 Ga0070694_100007452
297 Ga0070708_100005541
298 Ga0070663_100027191
299 Ga0070663_100147544
300 Ga0070662_100011697
301 Ga0070681_10000373
302 Ga0068867_100000015
303 Ga0068867_100044630
304 Ga0070706_100017825
305 Ga0070706_100115098
306 Ga0070706_100131698
307 Ga0070679_100000755
308 Ga0070679_100007517
309 Ga0070679_100018690
310 Ga0070679_100106228
311 Ga0070697_100001813
312 Ga0070672_100008055
313 Ga0070672_100018057
314 Ga0070695_100110264
315 Ga0070696_100016810
316 Ga0070693_100001809
317 Ga0070665_100150966
318 Ga0070704_100003738
319 Ga0068855_100001770
320 Ga0070664_100000767
321 Ga0070664_100024614
322 Ga0068856_100048026
323 Ga0068863_100215689
324 Ga0068860_100003130
325 Ga0068860_100010145
326 Ga0068860_100101316
327 Ga0068862_100075854
328 Ga0081455_10000805
329 Ga0081539_10037390
330 Ga0070717_10122378
331 Ga0070717_10171892
332 Ga0097621_100085656
333 Ga0068871_100006354
334 Ga0075428_100261948
335 Ga0075434_100016936
336 Ga0068865_100110124
337 Ga0075436_100116398
338 Ga0075435_100156589
339 Ga0105240_10001023
340 Ga0105245_10027053
341 Ga0114129_10004827
342 Ga0105243_10000014
343 Ga0105243_10049058
344 Ga0105242_10006715
345 Ga0105237_10169644
346 Ga0105249_10000028
347 Ga0105249_10006729
348 Ga0105239_10014203
349 Ga0105239_10033951
350 Ga0105246_10023364
351 Ga0157374_10023058
352 Ga0157374_10070706
353 Ga0157374_10091620
354 Ga0157378_10022266
355 Ga0157378_10022611
356 Ga0157378_10058630
357 Ga0157378_10068197
358 Ga0157378_10198913
359 Ga0157378_10227665
360 Ga0163162_10000027
361 Ga0163162_10008311
362 Ga0163162_10081979
363 Ga0157375_10004354
364 Ga0157375_10006727
365 Ga0157380_10018784
366 Ga0157376_10069202
367 Ga0157376_10069875
368 Ga0207697_10000150
369 Ga0207697_10001112
370 Ga0207697_10007209
371 Ga0207697_10025630
372 Ga0207653_10001515
373 Ga0207682_10022774
374 Ga0207680_10002534
375 Ga0207680_10014381
376 Ga0207645_10001841
377 Ga0207645_10010146
378 Ga0207645_10013414
379 Ga0207645_10045134
380 Ga0207705_10012508
381 Ga0207684_10014382
382 Ga0207707_10000053
383 Ga0207695_10006316
384 Ga0207693_10082748
385 Ga0207657_10006849
386 Ga0207652_10000069
387 Ga0207652_10044653
388 Ga0207652_10063590
389 Ga0207681_10029926
390 Ga0207681_10100914
391 Ga0207650_10022729
392 Ga0207650_10065469
393 Ga0207659_10005384
394 Ga0207659_10016810
395 Ga0207659_10024602
396 Ga0207690_10134222
397 Ga0207706_10002125
398 Ga0207709_10000046
399 Ga0207670_10008738
400 Ga0207670_10019370
401 Ga0207670_10039895
402 Ga0207665_10141002
403 Ga0207691_10000995
404 Ga0207691_10029768
405 Ga0207661_10152310
406 Ga0207679_10007007
407 Ga0207651_10021072
408 Ga0207651_10037471
409 Ga0207651_10105728
410 Ga0207712_10000110
411 Ga0207712_10016417
412 Ga0207658_10003039
413 Ga0207658_10016332
414 Ga0207677_10022865
415 Ga0207677_10074338
416 Ga0207648_10000033
417 Ga0207648_10009927
418 Ga0207648_10018960
419 Ga0207683_10007758
420 Ga0268266_10008303
421 Ga0268266_10033681
422 Ga0268266_10053111
423 Ga0268264_10001045
424 Ga0268264_10006712
425 Ga0307515_10020633
426 Ga0265338_10008242
427 Ga0307511_10000386
428 Ga0265332_10020032
429 Ga0265327_10000009
430 Ga0307408_100000479
431 Ga0307408_100003300
432 Ga0307408_100063228
433 Ga0265313_10023094
434 Ga0265313_10034070
435 Ga0265314_10000400
436 Ga0307405_10023966
437 Ga0307406_10004474
438 Ga0307412_10000076
439 Ga0307416_100093063
440 Ga0307414_10000023
441 Ga0373955_0035809
442 Ga0373937_0076651
443 Ga0373937_0135191
444 Ga0395901_0249861
445 Ga0439453_0002718
446 Ga0450890_000028
447 Ga0450892_000625
448 Ga0450893_0003681
449 Ga0495592_0111813
450 Ga0495651_0027155
451 Ga0495580_0126684
452 Ga0495630_0050180
453 Ga0495632_0111067
454 Ga0495652_0050723
455 Ga0495652_0071157
456 Ga0495613_0080971
457 Ga0496102_0123532
458 Ga0496103_0069597
459 Ga0496104_0148811
460 Ga0496106_0119013
461 Ga0496108_0149793
462 Ga0496109_0077417
463 Ga0496112_0029252
464 Ga0496112_0292302
465 Ga0496114_0000001
466 Ga0496114_0173321
467 Ga0496115_0045432
468 nmdc:mga05p37_38005_c1
469 nmdc:mga0n895_3103_c1
470 nmdc:mga0rr50_235382_c1
471 nmdc:mga08x19_110104_c1
472 nmdc:mga08x19_57872_c1
473 nmdc:mga08x19_74_c1
474 nmdc:mga0a205_331715_c1
475 Ga0495601_0136969
476 Ga0495595_0018477
477 Ga0500555_000015
478 Ga0500556_0003671
479 Ga0500622_0002789
480 2643794890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

97

489

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.8317 68 448
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.8036 68 448
4bwz-assembly1.cif.gz_A crystal structure of the sodium proton antiporter, napa 0.7851 68 448
4bwz-assembly1.cif.gz_A crystal structure of the sodium proton antiporter, napa 0.7596 68 448
8bxg-assembly1.cif.gz_A structure of the k/h exchanger kefc. 0.7435 68 449
ID Description Score Start End Superfamily
af_P40309_24_434_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9391 69 451 1.20.1530.20
af_Q9P7I1_23_428_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9388 70 448 1.20.1530.20
af_Q54CP6_19_438_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9285 69 448 1.20.1530.20
af_I1LYU2_28_437_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9075 70 448 1.20.1530.20
af_I1ME88_42_441_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9051 71 454 1.20.1530.20
ID Description Score Start End GO Terms
AF-M5C3X5-F1-model_v4 K(+)/H(+) antiporter 1 0.9727 287 448 GO:0015297
GO:0016020
GO:1902600
AF-A0A4Q3F1B1-F1-model_v4 Cation/H+ exchanger transmembrane domain-containing protein 0.9586 63 449 GO:0015297
GO:0016020
GO:1902600
AF-A0A6I0T3W2-F1-model_v4 deleted 0.9443 277 449
AF-A0A7V9RS20-F1-model_v4 Cation:proton antiporter 0.9397 64 451 GO:0015297
GO:0016020
GO:1902600
AF-P40309-F1-model_v4 K(+)/H(+) antiporter 1 0.9385 64 451 GO:0005739
GO:0005783
GO:0005794
GO:0015386
GO:0016020
GO:0098662

Map