F354036

General Info

Members Datasets Scaffolds Average Seq Length
241 147 482 367

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0059918|Ga0495580_0059918_352_1671
Length 439
Sequence MTWDNRRILPLEGTQLPQKRRTIYATEIHRKIDPLHRSSYVTADFPRGIARQEDNSPNMAIFTDIDRKLERWAAADVIDAATAERIRRFESESRRGSDVLVRLALALGGIMVAAGVLLFVAAHWDALSPSQRFLLVLILTGGFHVAGAFFAERMHTLSITMHALGTAALGAGIFLAGQIFNLQEHWPGGVMLWAIGAVAAWYVLRHSVQAVFAALLIPFWLGGEWIVRASEKPGTGIVLAVFVAMLALTYLTVPSVGFREGLRRSLHVLGGVVFVPACIAVIFLRGELYYSAYYSQTQVAPATMMMGWILAIGLPLLLAAGLRRAGAIYNVVAAVWLIVVAQLNYHDEITQLKIYALCAVASIGLIAWGLREVQKNYINVGVVGFALTVIFFYFSNVMDKLGRSFALITGGILFLVGGYFLERLRRKLVKQLAIQGGVA

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
83 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
84 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
85 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
86 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 97.51
Stem 0
Stem Tuber 0
Unclassified 22.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0059918 3300046472 Bacteria 2675
2 Ga0070683_100021111 3300005329 Archaea 5807
3 Ga0068869_100037478 3300005334 Bacteria 3447
4 Ga0068868_100018865 3300005338 Bacteria 5162
5 Ga0070689_100157656 3300005340 Unclassified 1833
6 Ga0070713_100212517 3300005436 Bacteria 1752
7 Ga0070713_100235171 3300005436 Unclassified 1667
8 Ga0070708_100026195 3300005445 Unclassified 4989
9 Ga0070681_10060720 3300005458 Bacteria 3756
10 Ga0070681_10087687 3300005458 Unclassified 3064
11 Ga0070707_100027089 3300005468 Bacteria 5449
12 Ga0070699_100112152 3300005518 Unclassified 2395
13 Ga0070699_100117817 3300005518 Unclassified 2334
14 Ga0070679_100292597 3300005530 Bacteria 1580
15 Ga0068853_100065298 3300005539 Unclassified 3158
16 Ga0070695_100002287 3300005545 Bacteria 10975
17 Ga0070696_100049366 3300005546 Unclassified 2923
18 Ga0070665_100288900 3300005548 Unclassified 1642
19 Ga0070704_100001113 3300005549 Bacteria 13981
20 Ga0070704_100092858 3300005549 Bacteria 2254
21 Ga0070704_100131071 3300005549 Unclassified 1943
22 Ga0068855_100020927 3300005563 Bacteria 7844
23 Ga0068852_100032714 3300005616 Unclassified 4309
24 Ga0068859_100214303 3300005617 Unclassified 2013
25 Ga0068858_100001080 3300005842 Bacteria 28247
26 Ga0068858_100141566 3300005842 Unclassified 2258
27 Ga0068860_100074801 3300005843 Bacteria 3221
28 Ga0081455_10013330 3300005937 Bacteria 8133
29 Ga0070717_10081700 3300006028 Bacteria 2714
30 Ga0097621_100138198 3300006237 Unclassified 2080
31 Ga0068871_100210130 3300006358 Unclassified 1683
32 Ga0075428_100011423 3300006844 Bacteria 9879
33 Ga0075430_100003625 3300006846 Bacteria 12948
34 Ga0075430_100024147 3300006846 Bacteria 5176
35 Ga0075430_100128495 3300006846 Bacteria 2112
36 Ga0075431_100027823 3300006847 Bacteria 5802
37 Ga0075431_100032025 3300006847 Bacteria 5418
38 Ga0075431_100050610 3300006847 Bacteria 4283
39 Ga0075431_100125736 3300006847 Bacteria 2645
40 Ga0075433_10004566 3300006852 Bacteria 10800
41 Ga0075433_10007024 3300006852 Bacteria 8920
42 Ga0075433_10007368 3300006852 Bacteria 8731
43 Ga0075433_10179078 3300006852 Bacteria 1886
44 Ga0075434_100005439 3300006871 Bacteria 11598
45 Ga0075434_100020253 3300006871 Bacteria 6448
46 Ga0075434_100067669 3300006871 Bacteria 3557
47 Ga0075434_100206750 3300006871 Bacteria 1983
48 Ga0075429_100023347 3300006880 Bacteria 5366
49 Ga0068865_100010683 3300006881 Bacteria 5722
50 Ga0068865_100123823 3300006881 Bacteria 1927
51 Ga0097620_100214305 3300006931 Unclassified 2013
52 Ga0075435_100001681 3300007076 Bacteria 14367
53 Ga0105240_10084454 3300009093 Bacteria 3893
54 Ga0105240_10251917 3300009093 Unclassified 2042
55 Ga0111539_10001000 3300009094 Bacteria 37020
56 Ga0111539_10135300 3300009094 Bacteria 2886
57 Ga0111539_10306965 3300009094 Unclassified 1846
58 Ga0111539_10400254 3300009094 Unclassified 1599
59 Ga0105245_10016641 3300009098 Bacteria 6420
60 Ga0114129_10000310 3300009147 Bacteria 56894
61 Ga0114129_10000464 3300009147 Bacteria 48646
62 Ga0114129_10000642 3300009147 Bacteria 43644
63 Ga0114129_10021237 3300009147 Bacteria 9219
64 Ga0114129_10053325 3300009147 Bacteria 5672
65 Ga0114129_10061668 3300009147 Bacteria 5241
66 Ga0114129_10136605 3300009147 Bacteria 3364
67 Ga0114129_10238961 3300009147 Bacteria 2442
68 Ga0105248_10331452 3300009177 Unclassified 1714
69 Ga0105237_10048609 3300009545 Unclassified 4264
70 Ga0105237_10053210 3300009545 Unclassified 4061
71 Ga0105237_10386810 3300009545 Bacteria 1404
72 Ga0105030_100112 3300009987 Bacteria 6225
73 Ga0157373_10036745 3300013100 Unclassified 3513
74 Ga0157370_10191545 3300013104 Unclassified 1898
75 Ga0157369_10109767 3300013105 Unclassified 2933
76 Ga0157369_10191092 3300013105 Unclassified 2151
77 Ga0157374_10058868 3300013296 Unclassified 3591
78 Ga0163162_10329746 3300013306 Unclassified 1659
79 Ga0157372_10022620 3300013307 Bacteria 6804
80 Ga0157372_10205437 3300013307 Unclassified 2282
81 Ga0163163_10018476 3300014325 Bacteria 6528
82 Ga0157380_10023653 3300014326 Bacteria 4637
83 Ga0157376_10266807 3300014969 Bacteria 1606
84 Ga0207692_10136247 3300025898 Bacteria 1392
85 Ga0207647_10003215 3300025904 Bacteria 12256
86 Ga0207707_10016498 3300025912 Bacteria 6440
87 Ga0207707_10046643 3300025912 Unclassified 3774
88 Ga0207695_10020367 3300025913 Bacteria 7601
89 Ga0207671_10119136 3300025914 Unclassified 2016
90 Ga0207660_10213303 3300025917 Bacteria 1512
91 Ga0207652_10167017 3300025921 Bacteria 1973
92 Ga0207700_10047484 3300025928 Bacteria 3183
93 Ga0207700_10217525 3300025928 Unclassified 1618
94 Ga0207706_10291613 3300025933 Bacteria 1422
95 Ga0207704_10058640 3300025938 Unclassified 2371
96 Ga0207661_10006786 3300025944 Bacteria 8109
97 Ga0207667_10071264 3300025949 Bacteria 3614
98 Ga0207667_10226091 3300025949 Unclassified 1917
99 Ga0207667_10385628 3300025949 Bacteria 1427
100 Ga0207677_10025510 3300026023 Bacteria 3689
101 Ga0207703_10032081 3300026035 Bacteria 4157
102 Ga0207703_10108138 3300026035 Bacteria 2368
103 Ga0207641_10086323 3300026088 Unclassified 2736
104 Ga0207428_10003478 3300027907 Bacteria 15276
105 Ga0268265_10045128 3300028380 Bacteria 3287
106 Ga0268264_10026189 3300028381 Bacteria 4763
107 Ga0307408_100030952 3300031548 Bacteria 3721
108 Ga0307408_100032038 3300031548 Bacteria 3664
109 Ga0307408_100076609 3300031548 Bacteria 2488
110 Ga0307408_100115592 3300031548 Bacteria 2069
111 Ga0307408_100186129 3300031548 Bacteria 1669
112 Ga0307405_10040610 3300031731 Bacteria 2819
113 Ga0307413_10045986 3300031824 Unclassified 2592
114 Ga0307410_10162501 3300031852 Bacteria 1675
115 Ga0307406_10022222 3300031901 Bacteria 3761
116 Ga0307412_10037738 3300031911 Bacteria 3106
117 Ga0307409_100022291 3300031995 Bacteria 4363
118 Ga0307416_100010784 3300032002 Bacteria 6054
119 Ga0307416_100071914 3300032002 Bacteria 2876
120 Ga0307416_100267325 3300032002 Bacteria 1676
121 Ga0307416_100340988 3300032002 Bacteria 1511
122 Ga0307411_10111680 3300032005 Bacteria 1957
123 Ga0307411_10118921 3300032005 Unclassified 1907
124 Ga0373925_0003402 3300037068 Bacteria 12325
125 Ga0373925_0009772 3300037068 Bacteria 6967
126 Ga0395898_0368977 3300037466 Bacteria 1369
127 Ga0395905_0030656 3300037471 Bacteria 5065
128 Ga0436363_0882239 3300039450 Bacteria 1760
129 Ga0439450_005284 3300042008 Unclassified 2264
130 Ga0450920_001108 3300042122 Bacteria 4402
131 Ga0450896_007223 3300042133 Unclassified 1530
132 Ga0439464_0002640 3300042439 Bacteria 4438
133 Ga0450918_003719 3300042531 Bacteria 2823
134 Ga0451577_0045679 3300042876 Bacteria 3920
135 Ga0451577_0055429 3300042876 Bacteria 3537
136 Ga0453684_0050738 3300044712 Bacteria 5453
137 Ga0453684_0346107 3300044712 Bacteria 1677
138 Ga0495592_0224759 3300046454 Unclassified 1253
139 Ga0495651_0012737 3300046462 Bacteria 6492
140 Ga0495580_0000345 3300046472 Bacteria 37884
141 Ga0495580_0015702 3300046472 Bacteria 5706
142 Ga0495580_0050996 3300046472 Unclassified 2925
143 Ga0495594_0029410 3300046499 Bacteria 2969
144 Ga0495594_0046047 3300046499 Bacteria 2395
145 Ga0495665_0114064 3300046531 Unclassified 1416
146 Ga0495640_0026717 3300046533 Bacteria 4167
147 Ga0495667_0013837 3300046559 Bacteria 5449
148 Ga0495635_0059903 3300046663 Bacteria 2618
149 Ga0495659_0003983 3300046664 Bacteria 4676
150 Ga0495623_0032718 3300046679 Bacteria 3341
151 Ga0495623_0148451 3300046679 Bacteria 1388
152 Ga0495669_0016484 3300046684 Bacteria 3165
153 Ga0495674_0017737 3300047319 Bacteria 6627
154 Ga0495684_0013455 3300047471 Bacteria 6297
155 Ga0495684_0050831 3300047471 Bacteria 3164
156 Ga0496111_0001184 3300048914 Bacteria 14519
157 Ga0496112_0002004 3300048915 Bacteria 16104
158 Ga0496112_0221146 3300048915 Unclassified 1850
159 Ga0496115_0108445 3300048918 Bacteria 2280
160 Ga0496126_0000012 3300048929 Bacteria 727789
161 Ga0501299_002169 3300049522 Bacteria 2689
162 Ga0501033_0075474 3300049570 Bacteria 2474
163 Ga0501033_0227957 3300049570 Bacteria 1324
164 Ga0501034_0136034 3300049571 Bacteria 2438
165 Ga0501036_0089402 3300049572 Bacteria 2602
166 Ga0501036_0201918 3300049572 Bacteria 1672
167 Ga0501037_0083699 3300049573 Bacteria 2311
168 Ga0501038_0009308 3300049574 Bacteria 9011
169 Ga0501039_0007596 3300049575 Bacteria 8280
170 Ga0501040_0005267 3300049576 Bacteria 8361
171 Ga0501040_0012082 3300049576 Bacteria 5653
172 Ga0501040_0020305 3300049576 Bacteria 4426
173 Ga0501041_0004337 3300049577 Bacteria 8202
174 Ga0501041_0019652 3300049577 Bacteria 4035
175 Ga0501041_0081740 3300049577 Unclassified 1990
176 Ga0501042_0215933 3300049578 Bacteria 1383
177 Ga0501043_0024962 3300049579 Unclassified 4690
178 Ga0501046_0022800 3300049580 Bacteria 5156
179 Ga0501047_0080415 3300049581 Unclassified 3132
180 Ga0501048_0138341 3300049582 Bacteria 1721
181 Ga0501048_0234125 3300049582 Unclassified 1303
182 Ga0501067_0012374 3300049583 Bacteria 4732
183 Ga0501068_0178267 3300049584 Bacteria 1343
184 Ga0501070_0019670 3300049586 Bacteria 5662
185 Ga0501071_0023516 3300049587 Bacteria 4305
186 Ga0501071_0153556 3300049587 Bacteria 1718
187 Ga0501072_0006042 3300049588 Bacteria 9237
188 Ga0501072_0011689 3300049588 Bacteria 6708
189 Ga0501073_0051182 3300049589 Bacteria 2894
190 Ga0501073_0060800 3300049589 Bacteria 2636
191 Ga0501073_0101591 3300049589 Unclassified 1997
192 Ga0501074_0015317 3300049590 Bacteria 5574
193 Ga0501075_0010354 3300049591 Bacteria 6551
194 Ga0501075_0105983 3300049591 Bacteria 2136
195 Ga0501076_0001334 3300049592 Bacteria 16497
196 Ga0501077_0023638 3300049593 Bacteria 3896
197 Ga0501077_0131483 3300049593 Unclassified 1587
198 Ga0501233_008996 3300049668 Bacteria 1940
199 Ga0501079_0006452 3300049741 Bacteria 8811
200 Ga0501079_0039666 3300049741 Bacteria 3632
201 Ga0501079_0054271 3300049741 Bacteria 3091
202 Ga0501079_0086406 3300049741 Bacteria 2427
203 Ga0501080_0009592 3300049742 Bacteria 8839
204 Ga0501080_0016752 3300049742 Bacteria 6768
205 Ga0501080_0348975 3300049742 Unclassified 1336
206 Ga0501081_0005130 3300049743 Bacteria 8430
207 Ga0501081_0328198 3300049743 Bacteria 1125
208 Ga0501083_0106511 3300049744 Unclassified 1846
209 Ga0501035_0063512 3300049822 Bacteria 3284
210 Ga0501035_0201525 3300049822 Viruses 1706
211 Ga0501044_0108603 3300049823 Bacteria 2784
212 Ga0501044_0389988 3300049823 Bacteria 1307
213 Ga0501045_0018650 3300049824 Bacteria 4938
214 nmdc:mga05p37_1071_c1 3300050507 Bacteria 31318
215 nmdc:mga05p37_1989_c1 3300050507 Bacteria 23847
216 nmdc:mga05p37_435248_c1 3300050507 Bacteria 1523
217 nmdc:mga05p37_58122_c1 3300050507 Bacteria 4763
218 nmdc:mga05p37_65032_c1 3300050507 Bacteria 4488
219 nmdc:mga09592_10188_c1 3300050508 Bacteria 7651
220 nmdc:mga09592_246321_c1 3300050508 Unclassified 1549
221 nmdc:mga0qj67_114783_c1 3300050509 Bacteria 2175
222 nmdc:mga0qj67_7142_c1 3300050509 Bacteria 8239
223 nmdc:mga06r32_31636_c1 3300050510 Bacteria 4971
224 nmdc:mga06r32_94406_c1 3300050510 Bacteria 2927
225 nmdc:mga08y16_126344_c1 3300050511 Bacteria 2660
226 nmdc:mga08y16_294241_c1 3300050511 Unclassified 1674
227 nmdc:mga08y16_3027_c1 3300050511 Bacteria 17354
228 nmdc:mga08y16_514630_c1 3300050511 Bacteria 1214
229 nmdc:mga0n895_13978_c1 3300050512 Bacteria 7271
230 nmdc:mga0n895_14287_c1 3300050512 Bacteria 7205
231 nmdc:mga0n895_20396_c1 3300050512 Bacteria 6181
232 nmdc:mga0n895_96030_c1 3300050512 Unclassified 2969
233 nmdc:mga0rr50_5932_c1 3300050513 Bacteria 7355
234 nmdc:mga0a205_1243_c1 3300050515 Bacteria 21359
235 nmdc:mga0a205_14614_c1 3300050515 Bacteria 7326
236 nmdc:mga0a205_3084_c2 3300050515 Bacteria 10707
237 Ga0501084_0032140 3300054114 Bacteria 4389
238 Ga0501084_0045535 3300054114 Bacteria 3673
239 Ga0501084_0114290 3300054114 Bacteria 2269
240 Ga0501082_0081958 3300060353 Bacteria 2784
241 Ga0530510_0002884 3300061734 Bacteria 11800
242 Ga0495580_0059918
243 Ga0070683_100021111
244 Ga0068869_100037478
245 Ga0068868_100018865
246 Ga0070689_100157656
247 Ga0070713_100212517
248 Ga0070713_100235171
249 Ga0070708_100026195
250 Ga0070681_10060720
251 Ga0070681_10087687
252 Ga0070707_100027089
253 Ga0070699_100112152
254 Ga0070699_100117817
255 Ga0070679_100292597
256 Ga0068853_100065298
257 Ga0070695_100002287
258 Ga0070696_100049366
259 Ga0070665_100288900
260 Ga0070704_100001113
261 Ga0070704_100092858
262 Ga0070704_100131071
263 Ga0068855_100020927
264 Ga0068852_100032714
265 Ga0068859_100214303
266 Ga0068858_100001080
267 Ga0068858_100141566
268 Ga0068860_100074801
269 Ga0081455_10013330
270 Ga0070717_10081700
271 Ga0097621_100138198
272 Ga0068871_100210130
273 Ga0075428_100011423
274 Ga0075430_100003625
275 Ga0075430_100024147
276 Ga0075430_100128495
277 Ga0075431_100027823
278 Ga0075431_100032025
279 Ga0075431_100050610
280 Ga0075431_100125736
281 Ga0075433_10004566
282 Ga0075433_10007024
283 Ga0075433_10007368
284 Ga0075433_10179078
285 Ga0075434_100005439
286 Ga0075434_100020253
287 Ga0075434_100067669
288 Ga0075434_100206750
289 Ga0075429_100023347
290 Ga0068865_100010683
291 Ga0068865_100123823
292 Ga0097620_100214305
293 Ga0075435_100001681
294 Ga0105240_10084454
295 Ga0105240_10251917
296 Ga0111539_10001000
297 Ga0111539_10135300
298 Ga0111539_10306965
299 Ga0111539_10400254
300 Ga0105245_10016641
301 Ga0114129_10000310
302 Ga0114129_10000464
303 Ga0114129_10000642
304 Ga0114129_10021237
305 Ga0114129_10053325
306 Ga0114129_10061668
307 Ga0114129_10136605
308 Ga0114129_10238961
309 Ga0105248_10331452
310 Ga0105237_10048609
311 Ga0105237_10053210
312 Ga0105237_10386810
313 Ga0105030_100112
314 Ga0157373_10036745
315 Ga0157370_10191545
316 Ga0157369_10109767
317 Ga0157369_10191092
318 Ga0157374_10058868
319 Ga0163162_10329746
320 Ga0157372_10022620
321 Ga0157372_10205437
322 Ga0163163_10018476
323 Ga0157380_10023653
324 Ga0157376_10266807
325 Ga0207692_10136247
326 Ga0207647_10003215
327 Ga0207707_10016498
328 Ga0207707_10046643
329 Ga0207695_10020367
330 Ga0207671_10119136
331 Ga0207660_10213303
332 Ga0207652_10167017
333 Ga0207700_10047484
334 Ga0207700_10217525
335 Ga0207706_10291613
336 Ga0207704_10058640
337 Ga0207661_10006786
338 Ga0207667_10071264
339 Ga0207667_10226091
340 Ga0207667_10385628
341 Ga0207677_10025510
342 Ga0207703_10032081
343 Ga0207703_10108138
344 Ga0207641_10086323
345 Ga0207428_10003478
346 Ga0268265_10045128
347 Ga0268264_10026189
348 Ga0307408_100030952
349 Ga0307408_100032038
350 Ga0307408_100076609
351 Ga0307408_100115592
352 Ga0307408_100186129
353 Ga0307405_10040610
354 Ga0307413_10045986
355 Ga0307410_10162501
356 Ga0307406_10022222
357 Ga0307412_10037738
358 Ga0307409_100022291
359 Ga0307416_100010784
360 Ga0307416_100071914
361 Ga0307416_100267325
362 Ga0307416_100340988
363 Ga0307411_10111680
364 Ga0307411_10118921
365 Ga0373925_0003402
366 Ga0373925_0009772
367 Ga0395898_0368977
368 Ga0395905_0030656
369 Ga0436363_0882239
370 Ga0439450_005284
371 Ga0450920_001108
372 Ga0450896_007223
373 Ga0439464_0002640
374 Ga0450918_003719
375 Ga0451577_0045679
376 Ga0451577_0055429
377 Ga0453684_0050738
378 Ga0453684_0346107
379 Ga0495592_0224759
380 Ga0495651_0012737
381 Ga0495580_0000345
382 Ga0495580_0015702
383 Ga0495580_0050996
384 Ga0495594_0029410
385 Ga0495594_0046047
386 Ga0495665_0114064
387 Ga0495640_0026717
388 Ga0495667_0013837
389 Ga0495635_0059903
390 Ga0495659_0003983
391 Ga0495623_0032718
392 Ga0495623_0148451
393 Ga0495669_0016484
394 Ga0495674_0017737
395 Ga0495684_0013455
396 Ga0495684_0050831
397 Ga0496111_0001184
398 Ga0496112_0002004
399 Ga0496112_0221146
400 Ga0496115_0108445
401 Ga0496126_0000012
402 Ga0501299_002169
403 Ga0501033_0075474
404 Ga0501033_0227957
405 Ga0501034_0136034
406 Ga0501036_0089402
407 Ga0501036_0201918
408 Ga0501037_0083699
409 Ga0501038_0009308
410 Ga0501039_0007596
411 Ga0501040_0005267
412 Ga0501040_0012082
413 Ga0501040_0020305
414 Ga0501041_0004337
415 Ga0501041_0019652
416 Ga0501041_0081740
417 Ga0501042_0215933
418 Ga0501043_0024962
419 Ga0501046_0022800
420 Ga0501047_0080415
421 Ga0501048_0138341
422 Ga0501048_0234125
423 Ga0501067_0012374
424 Ga0501068_0178267
425 Ga0501070_0019670
426 Ga0501071_0023516
427 Ga0501071_0153556
428 Ga0501072_0006042
429 Ga0501072_0011689
430 Ga0501073_0051182
431 Ga0501073_0060800
432 Ga0501073_0101591
433 Ga0501074_0015317
434 Ga0501075_0010354
435 Ga0501075_0105983
436 Ga0501076_0001334
437 Ga0501077_0023638
438 Ga0501077_0131483
439 Ga0501233_008996
440 Ga0501079_0006452
441 Ga0501079_0039666
442 Ga0501079_0054271
443 Ga0501079_0086406
444 Ga0501080_0009592
445 Ga0501080_0016752
446 Ga0501080_0348975
447 Ga0501081_0005130
448 Ga0501081_0328198
449 Ga0501083_0106511
450 Ga0501035_0063512
451 Ga0501035_0201525
452 Ga0501044_0108603
453 Ga0501044_0389988
454 Ga0501045_0018650
455 nmdc:mga05p37_1071_c1
456 nmdc:mga05p37_1989_c1
457 nmdc:mga05p37_435248_c1
458 nmdc:mga05p37_58122_c1
459 nmdc:mga05p37_65032_c1
460 nmdc:mga09592_10188_c1
461 nmdc:mga09592_246321_c1
462 nmdc:mga0qj67_114783_c1
463 nmdc:mga0qj67_7142_c1
464 nmdc:mga06r32_31636_c1
465 nmdc:mga06r32_94406_c1
466 nmdc:mga08y16_126344_c1
467 nmdc:mga08y16_294241_c1
468 nmdc:mga08y16_3027_c1
469 nmdc:mga08y16_514630_c1
470 nmdc:mga0n895_13978_c1
471 nmdc:mga0n895_14287_c1
472 nmdc:mga0n895_20396_c1
473 nmdc:mga0n895_96030_c1
474 nmdc:mga0rr50_5932_c1
475 nmdc:mga0a205_1243_c1
476 nmdc:mga0a205_14614_c1
477 nmdc:mga0a205_3084_c2
478 Ga0501084_0032140
479 Ga0501084_0045535
480 Ga0501084_0114290
481 Ga0501082_0081958
482 Ga0530510_0002884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09925

DUF2157

Predicted membrane protein (DUF2157)

70

210

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7np7-assembly1.cif.gz_D6 structure of an intact esx-5 inner membrane complex, composite c1 model 0.4093 16 313
6sgx-assembly1.cif.gz_B structure of protomer 1 of the esx-3 core complex 0.3839 16 374
6sgw-assembly1.cif.gz_E structure of the esx-3 core complex 0.3762 24 374
6e9z-assembly1.cif.gz_B dhf119 filament 0.3701 68 287
8e12-assembly1.cif.gz_C homotrimeric variant of tctrp9, bgl14 0.3679 74 222
ID Description Score Start End Superfamily
af_O82587_129_217_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4871 240 343 1.20.1280.290
af_O82587_129_217_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4825 240 343 1.20.1280.290
2a2fX02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dsl1p vesicle tethering complex, Tip20p subunit, domain D 0.4485 43 137 1.20.58.670
af_Q9DC37_260_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4254 7 217 1.20.1250.20
af_G3V7P1_15_140_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.3902 171 286 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A1W9LZJ5-F1-model_v4 DUF2157 domain-containing protein 0.9118 132 373 GO:0016020
AF-A0A2V9BIY2-F1-model_v4 DUF2157 domain-containing protein 0.8972 1 380 GO:0016020
AF-A0A1W9LZJ5-F1-model_v4 DUF2157 domain-containing protein 0.8904 132 373 GO:0016020
AF-A0A357ZFW5-F1-model_v4 DUF2157 domain-containing protein 0.8762 171 375 GO:0016020
AF-A0A2V9NSV9-F1-model_v4 DUF2157 domain-containing protein 0.8475 3 377 GO:0016020

Map