F354035

General Info

Members Datasets Scaffolds Average Seq Length
241 132 482 185

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0056592|Ga0495580_0056592_91_714
Length 207
Sequence MTQTTFGNDMMFPMDSLATHYLDEIRRQLRGHKRLSEGALAQLKDEDFFVTLDPESNSIAILIKHISGNMRSRFTDFLTSDGEKPDRHRDGEFELSDKTTRAELMNWWEEGWKVVFGALDSLTPDDVMRTVQIRQEPHTVMQALNRALAHYATHLGQIVFLAKHFRSSEWKTLSIPRGKSEELNRMSLQERRRSGSPMATLQSSKKD

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
41 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
42 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
43 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
44 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
73 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
128 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
129 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
130 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
131 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
132 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.02
Metatranscriptomes 2.49
Isolates 2.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 3.32
Rhizosphere 93.36
Stem 0
Stem Tuber 0
Unclassified 24.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0056592 3300046472 Bacteria 2761
2 LJNas_1000976 3300000546 Bacteria 4560
3 Ga0055532_1000004 3300003758 Bacteria 471824
4 Ga0068868_100088264 3300005338 Unclassified 2495
5 Ga0070709_10000940 3300005434 Bacteria 16192
6 Ga0070709_10004694 3300005434 Bacteria 7379
7 Ga0070714_100000051 3300005435 Bacteria 110289
8 Ga0070714_100149698 3300005435 Unclassified 2102
9 Ga0070714_100810667 3300005435 Unclassified 907
10 Ga0070714_100904744 3300005435 Unclassified 857
11 Ga0070713_100000057 3300005436 Bacteria 70266
12 Ga0070713_100000433 3300005436 Bacteria 26754
13 Ga0070713_100005135 3300005436 Bacteria 8910
14 Ga0070713_100297918 3300005436 Bacteria 1484
15 Ga0070713_100437680 3300005436 Bacteria 1226
16 Ga0070713_100597289 3300005436 Unclassified 1048
17 Ga0070713_100620497 3300005436 Bacteria 1028
18 Ga0070710_10002500 3300005437 Bacteria 8714
19 Ga0070710_10053096 3300005437 Bacteria 2282
20 Ga0070710_10079689 3300005437 Bacteria 1909
21 Ga0070710_10227314 3300005437 Unclassified 1190
22 Ga0070710_10476605 3300005437 Unclassified 850
23 Ga0070711_100001210 3300005439 Bacteria 13929
24 Ga0070711_100003381 3300005439 Bacteria 9297
25 Ga0070711_100024369 3300005439 Bacteria 3946
26 Ga0070711_100030362 3300005439 Bacteria 3576
27 Ga0070711_100047310 3300005439 Unclassified 2936
28 Ga0070711_100070181 3300005439 Bacteria 2466
29 Ga0070711_100075120 3300005439 Unclassified 2392
30 Ga0070711_100614589 3300005439 Unclassified 908
31 Ga0070708_100051658 3300005445 Bacteria 3642
32 Ga0070685_10366679 3300005466 Bacteria 989
33 Ga0070706_100052641 3300005467 Bacteria 3757
34 Ga0070707_100201412 3300005468 Bacteria 1940
35 Ga0070707_100225491 3300005468 Unclassified 1825
36 Ga0070707_100484902 3300005468 Unclassified 1198
37 Ga0070698_100143061 3300005471 Unclassified 2342
38 Ga0070698_100677094 3300005471 Bacteria 973
39 Ga0070699_100157674 3300005518 Unclassified 2008
40 Ga0070679_100619117 3300005530 Unclassified 1026
41 Ga0070704_100254428 3300005549 Bacteria 1444
42 Ga0070664_100311152 3300005564 Bacteria 1425
43 Ga0068856_100538663 3300005614 Bacteria 1189
44 Ga0068859_100147196 3300005617 Bacteria 2430
45 Ga0068863_100655210 3300005841 Bacteria 1041
46 Ga0070717_10002025 3300006028 Bacteria 14189
47 Ga0070717_10076106 3300006028 Unclassified 2808
48 Ga0070717_10166429 3300006028 Bacteria 1915
49 Ga0070717_10240525 3300006028 Bacteria 1596
50 Ga0070717_10359385 3300006028 Bacteria 1303
51 Ga0070717_10394062 3300006028 Bacteria 1243
52 Ga0070717_10395677 3300006028 Bacteria 1240
53 Ga0070717_10628033 3300006028 Bacteria 975
54 Ga0070715_10002810 3300006163 Bacteria 5418
55 Ga0070715_10066556 3300006163 Bacteria 1598
56 Ga0070715_10191228 3300006163 Bacteria 1033
57 Ga0070716_100000719 3300006173 Bacteria 14140
58 Ga0070716_100029581 3300006173 Unclassified 2963
59 Ga0070716_100075012 3300006173 Bacteria 2000
60 Ga0070716_100607948 3300006173 Bacteria 823
61 Ga0070712_100000095 3300006175 Bacteria 44846
62 Ga0070712_100000125 3300006175 Bacteria 40774
63 Ga0070712_100001176 3300006175 Bacteria 15816
64 Ga0070712_100002110 3300006175 Bacteria 12215
65 Ga0070712_100031734 3300006175 Bacteria 3561
66 Ga0070712_100213301 3300006175 Bacteria 1524
67 Ga0097621_100213581 3300006237 Bacteria 1679
68 Ga0075430_100185068 3300006846 Bacteria 1732
69 Ga0075430_100505710 3300006846 Bacteria 997
70 Ga0075433_10046536 3300006852 Bacteria 3774
71 Ga0075434_100008625 3300006871 Bacteria 9494
72 Ga0097620_100147189 3300006931 Bacteria 2430
73 Ga0105240_10018699 3300009093 Bacteria 9285
74 Ga0111539_10322891 3300009094 Bacteria 1796
75 Ga0105237_10146000 3300009545 Bacteria 2360
76 Ga0105237_11743462 3300009545 Unclassified 630
77 Ga0105249_10029436 3300009553 Bacteria 4959
78 Ga0105239_11552976 3300010375 Unclassified 765
79 Ga0157374_10039669 3300013296 Bacteria 4334
80 Ga0157374_10398267 3300013296 Unclassified 1373
81 Ga0157374_10561149 3300013296 Bacteria 1150
82 Ga0157374_11457047 3300013296 Unclassified 708
83 Ga0163162_10172972 3300013306 Bacteria 2284
84 Ga0163162_10291472 3300013306 Bacteria 1764
85 Ga0157372_10009551 3300013307 Bacteria 10312
86 Ga0157379_10675617 3300014968 Unclassified 968
87 Ga0182005_1022049 3300015265 Bacteria 1745
88 Ga0224571_101966 3300022734 Bacteria 1300
89 Ga0224572_1018996 3300024225 Unclassified 1321
90 Ga0228598_1000002 3300024227 Bacteria 37716
91 Ga0228598_1003089 3300024227 Bacteria 3607
92 Ga0209147_100010 3300025229 Bacteria 741391
93 Ga0209025_1072999 3300025294 Bacteria 1206
94 Ga0207692_10002880 3300025898 Bacteria 6660
95 Ga0207692_10033197 3300025898 Bacteria 2488
96 Ga0207692_10049019 3300025898 Bacteria 2129
97 Ga0207685_10002862 3300025905 Bacteria 4065
98 Ga0207685_10038431 3300025905 Bacteria 1769
99 Ga0207685_10229643 3300025905 Unclassified 887
100 Ga0207699_10000512 3300025906 Bacteria 19259
101 Ga0207699_10005690 3300025906 Bacteria 5990
102 Ga0207684_10028613 3300025910 Bacteria 4749
103 Ga0207684_10076708 3300025910 Unclassified 2841
104 Ga0207684_10077814 3300025910 Bacteria 2821
105 Ga0207707_10020023 3300025912 Bacteria 5837
106 Ga0207671_10633949 3300025914 Unclassified 851
107 Ga0207693_10000005 3300025915 Bacteria 186314
108 Ga0207693_10000016 3300025915 Bacteria 145892
109 Ga0207693_10001919 3300025915 Bacteria 18194
110 Ga0207693_10015535 3300025915 Bacteria 6107
111 Ga0207693_10021038 3300025915 Bacteria 5184
112 Ga0207693_10086234 3300025915 Unclassified 2460
113 Ga0207663_10002214 3300025916 Bacteria 9308
114 Ga0207663_10120143 3300025916 Bacteria 1798
115 Ga0207663_10335457 3300025916 Unclassified 1140
116 Ga0207652_10997582 3300025921 Unclassified 736
117 Ga0207646_10200750 3300025922 Bacteria 1801
118 Ga0207646_10333752 3300025922 Unclassified 1370
119 Ga0207650_10045720 3300025925 Bacteria 3221
120 Ga0207700_10000425 3300025928 Bacteria 24855
121 Ga0207700_10002374 3300025928 Bacteria 10823
122 Ga0207700_10514554 3300025928 Bacteria 1060
123 Ga0207664_10000029 3300025929 Bacteria 183815
124 Ga0207664_10112729 3300025929 Unclassified 2264
125 Ga0207664_10500075 3300025929 Unclassified 1088
126 Ga0207665_10000107 3300025939 Bacteria 54377
127 Ga0207665_10002111 3300025939 Bacteria 13441
128 Ga0207665_10003836 3300025939 Bacteria 10047
129 Ga0207665_10021554 3300025939 Bacteria 4238
130 Ga0207665_10050347 3300025939 Bacteria 2801
131 Ga0207665_10513356 3300025939 Unclassified 927
132 Ga0207712_10173952 3300025961 Bacteria 1685
133 Ga0207677_10060065 3300026023 Unclassified 2626
134 Ga0265356_1000003 3300028017 Bacteria 43423
135 Ga0265338_10105897 3300028800 Bacteria 2278
136 Ga0265762_1000792 3300030760 Bacteria 5650
137 Ga0265762_1000946 3300030760 Bacteria 5205
138 Ga0265762_1003136 3300030760 Bacteria 2952
139 Ga0265770_1024299 3300030878 Bacteria 979
140 Ga0265760_10000205 3300031090 Bacteria 15834
141 Ga0265760_10001451 3300031090 Bacteria 6976
142 Ga0265340_10102848 3300031247 Bacteria 1326
143 Ga0265339_10030088 3300031249 Unclassified 3077
144 Ga0265331_10200575 3300031250 Unclassified 899
145 Ga0265316_10005047 3300031344 Bacteria 12953
146 Ga0265316_10027704 3300031344 Bacteria 4685
147 Ga0265314_10025354 3300031711 Unclassified 4474
148 Ga0316214_1000448 3300033545 Bacteria 4187
149 Ga0373934_0017385 3300035086 Bacteria 2745
150 Ga0373923_0013602 3300035111 Bacteria 3036
151 Ga0373923_0036363 3300035111 Bacteria 2010
152 Ga0373936_0005320 3300035113 Unclassified 4845
153 Ga0373936_0006064 3300035113 Bacteria 4555
154 Ga0373936_0242643 3300035113 Unclassified 803
155 Ga0373945_0008760 3300035116 Bacteria 3302
156 Ga0373945_0103537 3300035116 Unclassified 1116
157 Ga0373954_0017577 3300035118 Bacteria 3214
158 Ga0373956_0117611 3300035119 Bacteria 1240
159 Ga0373956_0182131 3300035119 Bacteria 993
160 Ga0373957_0045171 3300035120 Bacteria 1668
161 Ga0373943_0001812 3300035170 Bacteria 9662
162 Ga0373943_0032550 3300035170 Bacteria 2479
163 Ga0373943_0130649 3300035170 Bacteria 1344
164 Ga0373943_0320420 3300035170 Unclassified 884
165 Ga0373946_0017812 3300035171 Bacteria 2721
166 Ga0373955_0091119 3300035172 Unclassified 1738
167 Ga0373955_0138920 3300035172 Bacteria 1423
168 Ga0373924_0013847 3300035410 Bacteria 3036
169 Ga0373924_0093887 3300035410 Bacteria 1285
170 Ga0373924_0192655 3300035410 Unclassified 898
171 Ga0373924_0228294 3300035410 Unclassified 823
172 Ga0373935_0003988 3300035692 Bacteria 8620
173 Ga0373935_0100110 3300035692 Bacteria 1909
174 Ga0373927_0000070 3300035695 Bacteria 73849
175 Ga0373927_0157494 3300035695 Bacteria 1488
176 Ga0373927_0272948 3300035695 Unclassified 1112
177 Ga0373933_0012927 3300035724 Bacteria 4618
178 Ga0373933_0034741 3300035724 Unclassified 2940
179 Ga0373933_0090156 3300035724 Bacteria 1891
180 Ga0373947_0000202 3300035725 Bacteria 33146
181 Ga0373947_0060091 3300035725 Bacteria 2307
182 Ga0373947_0621085 3300035725 Bacteria 737
183 Ga0373925_0001467 3300037068 Bacteria 20314
184 Ga0373925_0019550 3300037068 Unclassified 4927
185 Ga0373925_0316744 3300037068 Bacteria 1262
186 Ga0436360_0961106 3300039438 Unclassified 1699
187 Ga0495592_0223502 3300046454 Bacteria 1258
188 Ga0495603_0220255 3300046455 Unclassified 1095
189 Ga0495629_0017447 3300046459 Bacteria 5144
190 Ga0495629_0348338 3300046459 Bacteria 1011
191 Ga0495653_0111988 3300046463 Bacteria 1960
192 Ga0495580_0000750 3300046472 Bacteria 27781
193 Ga0495580_0001235 3300046472 Bacteria 22536
194 Ga0495580_0001427 3300046472 Bacteria 20991
195 Ga0495580_0131947 3300046472 Bacteria 1733
196 Ga0495582_0002008 3300046473 Bacteria 11399
197 Ga0495639_0210693 3300046475 Bacteria 953
198 Ga0495664_0148191 3300046477 Bacteria 1423
199 Ga0495608_0218747 3300046511 Bacteria 1196
200 Ga0495630_0071842 3300046517 Bacteria 2605
201 Ga0495630_0202840 3300046517 Unclassified 1513
202 Ga0495643_0490230 3300046522 Unclassified 530
203 Ga0495642_0327652 3300046528 Unclassified 672
204 Ga0495652_0371145 3300046529 Unclassified 1020
205 Ga0495665_0112198 3300046531 Bacteria 1430
206 Ga0495586_0009087 3300046535 Bacteria 5287
207 Ga0495587_0660678 3300046536 Bacteria 574
208 Ga0495634_0082592 3300046642 Bacteria 2099
209 Ga0495635_0166856 3300046663 Unclassified 1498
210 Ga0495657_0142374 3300046675 Bacteria 1494
211 Ga0495646_0414119 3300046680 Bacteria 699
212 Ga0495613_0243436 3300046689 Bacteria 1257
213 Ga0495624_0071161 3300046690 Bacteria 2164
214 Ga0495624_0570730 3300046690 Unclassified 675
215 Ga0495600_0304098 3300046809 Bacteria 1006
216 Ga0495674_0005111 3300047319 Bacteria 12603
217 Ga0495674_0134188 3300047319 Bacteria 2084
218 Ga0495674_0256468 3300047319 Bacteria 1438
219 Ga0495674_0482651 3300047319 Bacteria 993
220 Ga0495680_0271286 3300047322 Bacteria 1198
221 Ga0495684_0050082 3300047471 Bacteria 3190
222 Ga0495602_0112352 3300048088 Bacteria 2211
223 Ga0496100_0458560 3300048903 Unclassified 978
224 Ga0496101_0430540 3300048904 Bacteria 1040
225 Ga0496102_0137367 3300048905 Bacteria 2291
226 Ga0496102_0892570 3300048905 Unclassified 811
227 Ga0496112_0112895 3300048915 Unclassified 2688
228 Ga0496114_0163874 3300048917 Bacteria 1935
229 Ga0496115_0077258 3300048918 Bacteria 2707
230 Ga0501072_0482601 3300049588 Bacteria 981
231 nmdc:mga09592_125140_c1 3300050508 Bacteria 2209
232 nmdc:mga0qj67_147653_c1 3300050509 Bacteria 1906
233 nmdc:mga0qj67_472551_c1 3300050509 Bacteria 1009
234 nmdc:mga06r32_84640_c1 3300050510 Bacteria 3091
235 nmdc:mga0a205_32130_c1 3300050515 Bacteria 5032
236 2595089127 2593339131 Bacteria 5116855
237 2672337686 2671180330 Bacteria 5521719
238 2757564869 2757320391 Bacteria 4746095
239 2777763021 2775507177 Bacteria 4384303
240 2777836916 2775507192 Bacteria 4622234
241 2936343936 2936340661 Bacteria 5139038
242 Ga0495580_0056592
243 LJNas_1000976
244 Ga0055532_1000004
245 Ga0068868_100088264
246 Ga0070709_10000940
247 Ga0070709_10004694
248 Ga0070714_100000051
249 Ga0070714_100149698
250 Ga0070714_100810667
251 Ga0070714_100904744
252 Ga0070713_100000057
253 Ga0070713_100000433
254 Ga0070713_100005135
255 Ga0070713_100297918
256 Ga0070713_100437680
257 Ga0070713_100597289
258 Ga0070713_100620497
259 Ga0070710_10002500
260 Ga0070710_10053096
261 Ga0070710_10079689
262 Ga0070710_10227314
263 Ga0070710_10476605
264 Ga0070711_100001210
265 Ga0070711_100003381
266 Ga0070711_100024369
267 Ga0070711_100030362
268 Ga0070711_100047310
269 Ga0070711_100070181
270 Ga0070711_100075120
271 Ga0070711_100614589
272 Ga0070708_100051658
273 Ga0070685_10366679
274 Ga0070706_100052641
275 Ga0070707_100201412
276 Ga0070707_100225491
277 Ga0070707_100484902
278 Ga0070698_100143061
279 Ga0070698_100677094
280 Ga0070699_100157674
281 Ga0070679_100619117
282 Ga0070704_100254428
283 Ga0070664_100311152
284 Ga0068856_100538663
285 Ga0068859_100147196
286 Ga0068863_100655210
287 Ga0070717_10002025
288 Ga0070717_10076106
289 Ga0070717_10166429
290 Ga0070717_10240525
291 Ga0070717_10359385
292 Ga0070717_10394062
293 Ga0070717_10395677
294 Ga0070717_10628033
295 Ga0070715_10002810
296 Ga0070715_10066556
297 Ga0070715_10191228
298 Ga0070716_100000719
299 Ga0070716_100029581
300 Ga0070716_100075012
301 Ga0070716_100607948
302 Ga0070712_100000095
303 Ga0070712_100000125
304 Ga0070712_100001176
305 Ga0070712_100002110
306 Ga0070712_100031734
307 Ga0070712_100213301
308 Ga0097621_100213581
309 Ga0075430_100185068
310 Ga0075430_100505710
311 Ga0075433_10046536
312 Ga0075434_100008625
313 Ga0097620_100147189
314 Ga0105240_10018699
315 Ga0111539_10322891
316 Ga0105237_10146000
317 Ga0105237_11743462
318 Ga0105249_10029436
319 Ga0105239_11552976
320 Ga0157374_10039669
321 Ga0157374_10398267
322 Ga0157374_10561149
323 Ga0157374_11457047
324 Ga0163162_10172972
325 Ga0163162_10291472
326 Ga0157372_10009551
327 Ga0157379_10675617
328 Ga0182005_1022049
329 Ga0224571_101966
330 Ga0224572_1018996
331 Ga0228598_1000002
332 Ga0228598_1003089
333 Ga0209147_100010
334 Ga0209025_1072999
335 Ga0207692_10002880
336 Ga0207692_10033197
337 Ga0207692_10049019
338 Ga0207685_10002862
339 Ga0207685_10038431
340 Ga0207685_10229643
341 Ga0207699_10000512
342 Ga0207699_10005690
343 Ga0207684_10028613
344 Ga0207684_10076708
345 Ga0207684_10077814
346 Ga0207707_10020023
347 Ga0207671_10633949
348 Ga0207693_10000005
349 Ga0207693_10000016
350 Ga0207693_10001919
351 Ga0207693_10015535
352 Ga0207693_10021038
353 Ga0207693_10086234
354 Ga0207663_10002214
355 Ga0207663_10120143
356 Ga0207663_10335457
357 Ga0207652_10997582
358 Ga0207646_10200750
359 Ga0207646_10333752
360 Ga0207650_10045720
361 Ga0207700_10000425
362 Ga0207700_10002374
363 Ga0207700_10514554
364 Ga0207664_10000029
365 Ga0207664_10112729
366 Ga0207664_10500075
367 Ga0207665_10000107
368 Ga0207665_10002111
369 Ga0207665_10003836
370 Ga0207665_10021554
371 Ga0207665_10050347
372 Ga0207665_10513356
373 Ga0207712_10173952
374 Ga0207677_10060065
375 Ga0265356_1000003
376 Ga0265338_10105897
377 Ga0265762_1000792
378 Ga0265762_1000946
379 Ga0265762_1003136
380 Ga0265770_1024299
381 Ga0265760_10000205
382 Ga0265760_10001451
383 Ga0265340_10102848
384 Ga0265339_10030088
385 Ga0265331_10200575
386 Ga0265316_10005047
387 Ga0265316_10027704
388 Ga0265314_10025354
389 Ga0316214_1000448
390 Ga0373934_0017385
391 Ga0373923_0013602
392 Ga0373923_0036363
393 Ga0373936_0005320
394 Ga0373936_0006064
395 Ga0373936_0242643
396 Ga0373945_0008760
397 Ga0373945_0103537
398 Ga0373954_0017577
399 Ga0373956_0117611
400 Ga0373956_0182131
401 Ga0373957_0045171
402 Ga0373943_0001812
403 Ga0373943_0032550
404 Ga0373943_0130649
405 Ga0373943_0320420
406 Ga0373946_0017812
407 Ga0373955_0091119
408 Ga0373955_0138920
409 Ga0373924_0013847
410 Ga0373924_0093887
411 Ga0373924_0192655
412 Ga0373924_0228294
413 Ga0373935_0003988
414 Ga0373935_0100110
415 Ga0373927_0000070
416 Ga0373927_0157494
417 Ga0373927_0272948
418 Ga0373933_0012927
419 Ga0373933_0034741
420 Ga0373933_0090156
421 Ga0373947_0000202
422 Ga0373947_0060091
423 Ga0373947_0621085
424 Ga0373925_0001467
425 Ga0373925_0019550
426 Ga0373925_0316744
427 Ga0436360_0961106
428 Ga0495592_0223502
429 Ga0495603_0220255
430 Ga0495629_0017447
431 Ga0495629_0348338
432 Ga0495653_0111988
433 Ga0495580_0000750
434 Ga0495580_0001235
435 Ga0495580_0001427
436 Ga0495580_0131947
437 Ga0495582_0002008
438 Ga0495639_0210693
439 Ga0495664_0148191
440 Ga0495608_0218747
441 Ga0495630_0071842
442 Ga0495630_0202840
443 Ga0495643_0490230
444 Ga0495642_0327652
445 Ga0495652_0371145
446 Ga0495665_0112198
447 Ga0495586_0009087
448 Ga0495587_0660678
449 Ga0495634_0082592
450 Ga0495635_0166856
451 Ga0495657_0142374
452 Ga0495646_0414119
453 Ga0495613_0243436
454 Ga0495624_0071161
455 Ga0495624_0570730
456 Ga0495600_0304098
457 Ga0495674_0005111
458 Ga0495674_0134188
459 Ga0495674_0256468
460 Ga0495674_0482651
461 Ga0495680_0271286
462 Ga0495684_0050082
463 Ga0495602_0112352
464 Ga0496100_0458560
465 Ga0496101_0430540
466 Ga0496102_0137367
467 Ga0496102_0892570
468 Ga0496112_0112895
469 Ga0496114_0163874
470 Ga0496115_0077258
471 Ga0501072_0482601
472 nmdc:mga09592_125140_c1
473 nmdc:mga0qj67_147653_c1
474 nmdc:mga0qj67_472551_c1
475 nmdc:mga06r32_84640_c1
476 nmdc:mga0a205_32130_c1
477 2595089127
478 2672337686
479 2757564869
480 2777763021
481 2777836916
482 2936343936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07609

DUF1572

Protein of unknown function (DUF1572)

16

179

0.98

PF04978

DUF664

Protein of unknown function (DUF664)

20

165

0.88

PF12867

DinB_2

DinB superfamily

28

158

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.7633 9 152
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7611 11 159
5com-assembly2.cif.gz_B crystal structure of uncharacterized protein q187f5 from clostridium difficile 630 0.7568 9 145
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.7563 8 152
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.7476 9 145
ID Description Score Start End Superfamily
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7476 9 145 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.743 10 145 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7362 8 152 1.20.120.450
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7262 19 152 1.20.120.450
5civA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7161 9 153 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V9SRV6-F1-model_v4 DUF1572 domain-containing protein 0.9949 3 171
AF-A0A2V8J5L6-F1-model_v4 DUF1572 domain-containing protein 0.9932 4 164
AF-A0A838PBC1-F1-model_v4 DUF1572 family protein 0.9916 3 173
AF-A0A7T9GER0-F1-model_v4 deleted 0.9916 1 165
AF-A0A7W1PA25-F1-model_v4 DUF1572 family protein 0.9879 4 165

Map