F353589

General Info

Members Datasets Scaffolds Average Seq Length
241 171 482 279

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_100031010|Ga0070695_1000310104
Length 285
Sequence MLPFALVPVTDAHIHVQPWWEMKPGMLEVMTRGRQDMDELMKIMKSPQHLLRRLDADGIERAVLVNYPAPLFGFTHRVNDYVADYCGAAPERLIAMGGVNPRLPEDAAAEVRRAKERGVRALKLHPPHMGVAPNEYLHGLDALRALYEEAQRLRLPVMIHTGTSIFPGARSRLGEPIAVDDVAVDFPELVIVIAHGGRPLWMEQAFFLVRRFPNLFMDVSGIPPKKVLEYFPRLEEVADKVLYGSDWPSPGVKSMAANVRDFRALGLSAEALDKILDANSRKVFG

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.71
Nodule 0
Rhizoplane 1.24
Rhizosphere 90.04
Stem 0
Stem Tuber 0
Unclassified 12.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_100031010 3300005545 Bacteria 3331
2 JGI24751J29686_10025251 3300002459 Bacteria 1233
3 Ga0065712_10086500 3300005290 Bacteria 2632
4 Ga0065707_10004536 3300005295 Bacteria 4544
5 Ga0070676_10027378 3300005328 Bacteria 3232
6 Ga0070683_100015092 3300005329 Bacteria 6779
7 Ga0070690_100035607 3300005330 Bacteria 3124
8 Ga0070690_100177755 3300005330 Unclassified 1469
9 Ga0070670_100220115 3300005331 Bacteria 1651
10 Ga0068869_100286207 3300005334 Unclassified 1327
11 Ga0070666_10000450 3300005335 Bacteria 25018
12 Ga0070666_10256800 3300005335 Bacteria 1238
13 Ga0070680_100232489 3300005336 Bacteria 1557
14 Ga0068868_100026432 3300005338 Bacteria 4423
15 Ga0070689_100023625 3300005340 Bacteria 4604
16 Ga0070689_100404151 3300005340 Unclassified 1155
17 Ga0070691_10019613 3300005341 Bacteria 3121
18 Ga0070661_100074924 3300005344 Bacteria 2493
19 Ga0070692_10051216 3300005345 Bacteria 2146
20 Ga0070669_100210252 3300005353 Bacteria 1534
21 Ga0070675_100097576 3300005354 Bacteria 2471
22 Ga0070671_100251137 3300005355 Unclassified 1502
23 Ga0070671_100301568 3300005355 Bacteria 1364
24 Ga0070674_100017088 3300005356 Bacteria 4555
25 Ga0070674_100032616 3300005356 Bacteria 3460
26 Ga0070674_100094756 3300005356 Bacteria 2163
27 Ga0070673_100001103 3300005364 Bacteria 15474
28 Ga0070688_100009506 3300005365 Bacteria 5322
29 Ga0070688_100232390 3300005365 Bacteria 1305
30 Ga0070659_100205675 3300005366 Bacteria 1621
31 Ga0070701_10052898 3300005438 Bacteria 2111
32 Ga0070705_100045061 3300005440 Bacteria 2536
33 Ga0070705_100097548 3300005440 Bacteria 1848
34 Ga0070700_100008355 3300005441 Bacteria 5635
35 Ga0070708_100083678 3300005445 Bacteria 2893
36 Ga0070708_100093902 3300005445 Bacteria 2736
37 Ga0070663_100389555 3300005455 Unclassified 1137
38 Ga0070678_100291854 3300005456 Unclassified 1383
39 Ga0068867_100047100 3300005459 Bacteria 3169
40 Ga0068867_100256240 3300005459 Unclassified 1424
41 Ga0070706_100005841 3300005467 Bacteria 11677
42 Ga0070706_100008202 3300005467 Bacteria 9742
43 Ga0070707_100007813 3300005468 Bacteria 9932
44 Ga0070707_100228744 3300005468 Unclassified 1811
45 Ga0070698_100003897 3300005471 Bacteria 16407
46 Ga0070698_100010307 3300005471 Bacteria 9975
47 Ga0070699_100000657 3300005518 Bacteria 32335
48 Ga0070699_100114195 3300005518 Bacteria 2372
49 Ga0070679_100480964 3300005530 Bacteria 1186
50 Ga0070697_100014373 3300005536 Bacteria 6218
51 Ga0070697_100116450 3300005536 Bacteria 2232
52 Ga0068853_100453596 3300005539 Bacteria 1206
53 Ga0070672_100024839 3300005543 Bacteria 4435
54 Ga0070693_100105957 3300005547 Bacteria 1721
55 Ga0070704_100049275 3300005549 Bacteria 2954
56 Ga0070704_100086900 3300005549 Bacteria 2319
57 Ga0070704_100088326 3300005549 Bacteria 2303
58 Ga0068854_100156253 3300005578 Bacteria 1762
59 Ga0068854_100284873 3300005578 Unclassified 1332
60 Ga0070702_100087838 3300005615 Unclassified 1879
61 Ga0068852_100622489 3300005616 Bacteria 1085
62 Ga0068859_100093198 3300005617 Bacteria 3063
63 Ga0068859_100441251 3300005617 Bacteria 1398
64 Ga0068866_10133407 3300005718 Unclassified 1416
65 Ga0068860_100172299 3300005843 Bacteria 2091
66 Ga0075365_10000429 3300006038 Bacteria 15576
67 Ga0075368_10006363 3300006042 Bacteria 4121
68 Ga0075368_10038007 3300006042 Bacteria 1883
69 Ga0075363_100028734 3300006048 Bacteria 2863
70 Ga0075364_10019597 3300006051 Bacteria 4246
71 Ga0075362_10000951 3300006177 Bacteria 8839
72 Ga0075367_10001801 3300006178 Bacteria 9432
73 Ga0075366_10000265 3300006195 Bacteria 23143
74 Ga0068871_100156190 3300006358 Bacteria 1948
75 Ga0075428_100079227 3300006844 Bacteria 3586
76 Ga0075428_100348913 3300006844 Bacteria 1588
77 Ga0075430_100366222 3300006846 Unclassified 1190
78 Ga0075431_100051754 3300006847 Bacteria 4234
79 Ga0075431_100054295 3300006847 Bacteria 4131
80 Ga0075431_100469505 3300006847 Bacteria 1252
81 Ga0075433_10072063 3300006852 Bacteria 3037
82 Ga0075434_100069084 3300006871 Bacteria 3521
83 Ga0075434_100144698 3300006871 Bacteria 2397
84 Ga0075434_100171886 3300006871 Bacteria 2187
85 Ga0075429_100152913 3300006880 Bacteria 2020
86 Ga0068865_100121705 3300006881 Bacteria 1942
87 Ga0097620_100093197 3300006931 Bacteria 3063
88 Ga0097620_100441257 3300006931 Bacteria 1398
89 Ga0075435_100039541 3300007076 Bacteria 3764
90 Ga0075435_100160494 3300007076 Bacteria 1893
91 Ga0105240_10228806 3300009093 Bacteria 2162
92 Ga0111539_10003664 3300009094 Bacteria 20235
93 Ga0105245_10756915 3300009098 Unclassified 1008
94 Ga0105247_10227729 3300009101 Unclassified 1264
95 Ga0114129_10050151 3300009147 Bacteria 5864
96 Ga0114129_10079047 3300009147 Bacteria 4573
97 Ga0114129_10219931 3300009147 Bacteria 2563
98 Ga0105243_10169867 3300009148 Unclassified 1887
99 Ga0105241_10067909 3300009174 Bacteria 2761
100 Ga0105242_10219272 3300009176 Bacteria 1699
101 Ga0105242_10326845 3300009176 Bacteria 1409
102 Ga0105248_10062682 3300009177 Bacteria 4174
103 Ga0105248_10064904 3300009177 Bacteria 4099
104 Ga0105249_10261408 3300009553 Bacteria 1720
105 Ga0105239_10676326 3300010375 Unclassified 1180
106 Ga0157378_10306726 3300013297 Bacteria 1538
107 Ga0157372_10039795 3300013307 Bacteria 5190
108 Ga0163163_10557303 3300014325 Bacteria 1209
109 Ga0157380_10207426 3300014326 Bacteria 1744
110 Ga0157379_10694951 3300014968 Unclassified 954
111 Ga0163161_10286478 3300017792 Bacteria 1294
112 Ga0207653_10082985 3300025885 Bacteria 1112
113 Ga0207642_10116640 3300025899 Bacteria 1369
114 Ga0207680_10003357 3300025903 Bacteria 7542
115 Ga0207645_10041528 3300025907 Bacteria 2943
116 Ga0207643_10010790 3300025908 Bacteria 4927
117 Ga0207684_10003557 3300025910 Bacteria 15174
118 Ga0207684_10005790 3300025910 Bacteria 11335
119 Ga0207684_10017575 3300025910 Bacteria 6133
120 Ga0207654_10150816 3300025911 Bacteria 1492
121 Ga0207695_10140970 3300025913 Bacteria 2359
122 Ga0207660_10208040 3300025917 Bacteria 1531
123 Ga0207662_10001183 3300025918 Bacteria 12407
124 Ga0207662_10015082 3300025918 Bacteria 4343
125 Ga0207649_10108255 3300025920 Bacteria 1852
126 Ga0207646_10001085 3300025922 Bacteria 34591
127 Ga0207646_10062950 3300025922 Bacteria 3312
128 Ga0207681_10042708 3300025923 Bacteria 3030
129 Ga0207681_10045113 3300025923 Bacteria 2958
130 Ga0207650_10174663 3300025925 Bacteria 1709
131 Ga0207659_10086592 3300025926 Bacteria 2330
132 Ga0207687_10080516 3300025927 Bacteria 2351
133 Ga0207700_10111048 3300025928 Bacteria 2206
134 Ga0207644_10054545 3300025931 Bacteria 2879
135 Ga0207690_10121046 3300025932 Bacteria 1901
136 Ga0207706_10022326 3300025933 Bacteria 5679
137 Ga0207686_10262305 3300025934 Bacteria 1267
138 Ga0207709_10295919 3300025935 Bacteria 1202
139 Ga0207670_10053616 3300025936 Bacteria 2717
140 Ga0207669_10109562 3300025937 Bacteria 1847
141 Ga0207669_10323763 3300025937 Unclassified 1181
142 Ga0207691_10008403 3300025940 Bacteria 9917
143 Ga0207691_10024453 3300025940 Bacteria 5680
144 Ga0207689_10017155 3300025942 Bacteria 6129
145 Ga0207689_10043153 3300025942 Bacteria 3728
146 Ga0207661_10115958 3300025944 Bacteria 2273
147 Ga0207712_10166650 3300025961 Bacteria 1718
148 Ga0207640_10084880 3300025981 Bacteria 2175
149 Ga0207640_10252788 3300025981 Unclassified 1369
150 Ga0207677_10275211 3300026023 Bacteria 1379
151 Ga0207678_10023425 3300026067 Bacteria 5399
152 Ga0207708_10110308 3300026075 Bacteria 2135
153 Ga0207641_10520455 3300026088 Unclassified 1157
154 Ga0207648_10012167 3300026089 Bacteria 8062
155 Ga0207648_10111023 3300026089 Bacteria 2407
156 Ga0207675_100098729 3300026118 Bacteria 2750
157 Ga0207683_10214846 3300026121 Bacteria 1751
158 Ga0207683_10405941 3300026121 Bacteria 1254
159 Ga0207698_10134420 3300026142 Bacteria 2119
160 Ga0207428_10000909 3300027907 Bacteria 33062
161 Ga0307408_100075766 3300031548 Bacteria 2501
162 Ga0307413_10592136 3300031824 Bacteria 906
163 Ga0307410_10219102 3300031852 Bacteria 1463
164 Ga0307407_10190334 3300031903 Bacteria 1367
165 Ga0307409_100015589 3300031995 Bacteria 4994
166 Ga0373944_0116509 3300035089 Bacteria 917
167 Ga0373935_0174359 3300035692 Bacteria 1473
168 Ga0373933_0297124 3300035724 Bacteria 1045
169 Ga0373947_0015229 3300035725 Bacteria 4415
170 Ga0373937_0008143 3300036401 Bacteria 9102
171 Ga0373937_0112741 3300036401 Bacteria 2530
172 Ga0373937_0522386 3300036401 Bacteria 1128
173 Ga0373925_0081116 3300037068 Bacteria 2466
174 Ga0439446_0035183 3300042156 Bacteria 1460
175 Ga0439435_0102235 3300042436 Bacteria 882
176 Ga0495603_0343058 3300046455 Bacteria 857
177 Ga0495582_0274100 3300046473 Unclassified 968
178 Ga0495635_0130528 3300046663 Bacteria 1713
179 Ga0495658_0187283 3300046683 Bacteria 1285
180 Ga0495658_0235807 3300046683 Bacteria 1148
181 Ga0495669_0030580 3300046684 Unclassified 2363
182 Ga0495613_0178638 3300046689 Bacteria 1504
183 Ga0495613_0189591 3300046689 Bacteria 1454
184 Ga0496107_0146573 3300048910 Bacteria 1746
185 Ga0496112_0154854 3300048915 Bacteria 2259
186 Ga0496114_0085239 3300048917 Bacteria 2676
187 Ga0501034_0054772 3300049571 Bacteria 4015
188 Ga0501034_0072026 3300049571 Bacteria 3465
189 Ga0501034_0206715 3300049571 Unclassified 1919
190 Ga0501038_0128048 3300049574 Bacteria 2088
191 Ga0501038_0440084 3300049574 Bacteria 1004
192 Ga0501039_0087948 3300049575 Bacteria 2421
193 Ga0501039_0449697 3300049575 Bacteria 1012
194 Ga0501040_0076055 3300049576 Bacteria 2321
195 Ga0501040_0329887 3300049576 Bacteria 1092
196 Ga0501046_0188950 3300049580 Bacteria 1537
197 Ga0501071_0071896 3300049587 Bacteria 2522
198 Ga0501072_0036127 3300049588 Bacteria 3872
199 Ga0501074_0085733 3300049590 Bacteria 2257
200 Ga0501075_0060948 3300049591 Bacteria 2842
201 Ga0501075_0080955 3300049591 Bacteria 2458
202 Ga0501075_0140350 3300049591 Bacteria 1841
203 Ga0501076_0016809 3300049592 Bacteria 5553
204 Ga0501076_0318131 3300049592 Unclassified 1276
205 Ga0501079_0058427 3300049741 Unclassified 2976
206 Ga0501081_0088331 3300049743 Unclassified 2177
207 Ga0501081_0312970 3300049743 Bacteria 1153
208 Ga0501081_0577617 3300049743 Bacteria 841
209 Ga0501045_0120410 3300049824 Bacteria 1949
210 nmdc:mga03683_31140_c1 3300050489 Bacteria 2139
211 nmdc:mga03n38_14408_c1 3300050490 Bacteria 3029
212 nmdc:mga00v17_103788_c1 3300050491 Unclassified 1797
213 nmdc:mga00v17_47203_c1 3300050491 Bacteria 2608
214 nmdc:mga0yw44_75409_c1 3300050492 Bacteria 2103
215 nmdc:mga0yw44_9584_c1 3300050492 Bacteria 4908
216 nmdc:mga0k408_155779_c1 3300050493 Bacteria 1361
217 nmdc:mga0k408_22558_c1 3300050493 Bacteria 2493
218 nmdc:mga0k408_430_c1 3300050493 Bacteria 22974
219 nmdc:mga06z11_3677_c1 3300050494 Bacteria 5956
220 nmdc:mga06z11_63605_c1 3300050494 Bacteria 1931
221 nmdc:mga07m45_14253_c1 3300050496 Bacteria 4230
222 nmdc:mga05p37_21618_c1 3300050507 Bacteria 7796
223 nmdc:mga05p37_63672_c1 3300050507 Bacteria 4538
224 nmdc:mga05p37_64194_c1 3300050507 Bacteria 4518
225 nmdc:mga05p37_888814_c1 3300050507 Unclassified 962
226 nmdc:mga09592_32797_c1 3300050508 Bacteria 4330
227 nmdc:mga09592_59244_c1 3300050508 Bacteria 3237
228 nmdc:mga09592_99723_c1 3300050508 Bacteria 2486
229 nmdc:mga06r32_19808_c1 3300050510 Bacteria 6184
230 nmdc:mga06r32_306481_c1 3300050510 Bacteria 1573
231 nmdc:mga06r32_3963_c1 3300050510 Bacteria 13274
232 nmdc:mga08y16_18083_c1 3300050511 Bacteria 7424
233 nmdc:mga0n895_228383_c1 3300050512 Bacteria 1889
234 nmdc:mga0a205_13950_c2 3300050515 Bacteria 5796
235 nmdc:mga0a205_45958_c2 3300050515 Bacteria 3536
236 Ga0495619_0186613 3300053085 Bacteria 1435
237 Ga0500628_034391 3300053129 Unclassified 1121
238 Ga0501084_0119866 3300054114 Bacteria 2212
239 Ga0501082_0028069 3300060353 Bacteria 4849
240 Ga0530510_0003625 3300061734 Bacteria 10621
241 Ga0530510_0181787 3300061734 Bacteria 1560
242 Ga0070695_100031010
243 JGI24751J29686_10025251
244 Ga0065712_10086500
245 Ga0065707_10004536
246 Ga0070676_10027378
247 Ga0070683_100015092
248 Ga0070690_100035607
249 Ga0070690_100177755
250 Ga0070670_100220115
251 Ga0068869_100286207
252 Ga0070666_10000450
253 Ga0070666_10256800
254 Ga0070680_100232489
255 Ga0068868_100026432
256 Ga0070689_100023625
257 Ga0070689_100404151
258 Ga0070691_10019613
259 Ga0070661_100074924
260 Ga0070692_10051216
261 Ga0070669_100210252
262 Ga0070675_100097576
263 Ga0070671_100251137
264 Ga0070671_100301568
265 Ga0070674_100017088
266 Ga0070674_100032616
267 Ga0070674_100094756
268 Ga0070673_100001103
269 Ga0070688_100009506
270 Ga0070688_100232390
271 Ga0070659_100205675
272 Ga0070701_10052898
273 Ga0070705_100045061
274 Ga0070705_100097548
275 Ga0070700_100008355
276 Ga0070708_100083678
277 Ga0070708_100093902
278 Ga0070663_100389555
279 Ga0070678_100291854
280 Ga0068867_100047100
281 Ga0068867_100256240
282 Ga0070706_100005841
283 Ga0070706_100008202
284 Ga0070707_100007813
285 Ga0070707_100228744
286 Ga0070698_100003897
287 Ga0070698_100010307
288 Ga0070699_100000657
289 Ga0070699_100114195
290 Ga0070679_100480964
291 Ga0070697_100014373
292 Ga0070697_100116450
293 Ga0068853_100453596
294 Ga0070672_100024839
295 Ga0070693_100105957
296 Ga0070704_100049275
297 Ga0070704_100086900
298 Ga0070704_100088326
299 Ga0068854_100156253
300 Ga0068854_100284873
301 Ga0070702_100087838
302 Ga0068852_100622489
303 Ga0068859_100093198
304 Ga0068859_100441251
305 Ga0068866_10133407
306 Ga0068860_100172299
307 Ga0075365_10000429
308 Ga0075368_10006363
309 Ga0075368_10038007
310 Ga0075363_100028734
311 Ga0075364_10019597
312 Ga0075362_10000951
313 Ga0075367_10001801
314 Ga0075366_10000265
315 Ga0068871_100156190
316 Ga0075428_100079227
317 Ga0075428_100348913
318 Ga0075430_100366222
319 Ga0075431_100051754
320 Ga0075431_100054295
321 Ga0075431_100469505
322 Ga0075433_10072063
323 Ga0075434_100069084
324 Ga0075434_100144698
325 Ga0075434_100171886
326 Ga0075429_100152913
327 Ga0068865_100121705
328 Ga0097620_100093197
329 Ga0097620_100441257
330 Ga0075435_100039541
331 Ga0075435_100160494
332 Ga0105240_10228806
333 Ga0111539_10003664
334 Ga0105245_10756915
335 Ga0105247_10227729
336 Ga0114129_10050151
337 Ga0114129_10079047
338 Ga0114129_10219931
339 Ga0105243_10169867
340 Ga0105241_10067909
341 Ga0105242_10219272
342 Ga0105242_10326845
343 Ga0105248_10062682
344 Ga0105248_10064904
345 Ga0105249_10261408
346 Ga0105239_10676326
347 Ga0157378_10306726
348 Ga0157372_10039795
349 Ga0163163_10557303
350 Ga0157380_10207426
351 Ga0157379_10694951
352 Ga0163161_10286478
353 Ga0207653_10082985
354 Ga0207642_10116640
355 Ga0207680_10003357
356 Ga0207645_10041528
357 Ga0207643_10010790
358 Ga0207684_10003557
359 Ga0207684_10005790
360 Ga0207684_10017575
361 Ga0207654_10150816
362 Ga0207695_10140970
363 Ga0207660_10208040
364 Ga0207662_10001183
365 Ga0207662_10015082
366 Ga0207649_10108255
367 Ga0207646_10001085
368 Ga0207646_10062950
369 Ga0207681_10042708
370 Ga0207681_10045113
371 Ga0207650_10174663
372 Ga0207659_10086592
373 Ga0207687_10080516
374 Ga0207700_10111048
375 Ga0207644_10054545
376 Ga0207690_10121046
377 Ga0207706_10022326
378 Ga0207686_10262305
379 Ga0207709_10295919
380 Ga0207670_10053616
381 Ga0207669_10109562
382 Ga0207669_10323763
383 Ga0207691_10008403
384 Ga0207691_10024453
385 Ga0207689_10017155
386 Ga0207689_10043153
387 Ga0207661_10115958
388 Ga0207712_10166650
389 Ga0207640_10084880
390 Ga0207640_10252788
391 Ga0207677_10275211
392 Ga0207678_10023425
393 Ga0207708_10110308
394 Ga0207641_10520455
395 Ga0207648_10012167
396 Ga0207648_10111023
397 Ga0207675_100098729
398 Ga0207683_10214846
399 Ga0207683_10405941
400 Ga0207698_10134420
401 Ga0207428_10000909
402 Ga0307408_100075766
403 Ga0307413_10592136
404 Ga0307410_10219102
405 Ga0307407_10190334
406 Ga0307409_100015589
407 Ga0373944_0116509
408 Ga0373935_0174359
409 Ga0373933_0297124
410 Ga0373947_0015229
411 Ga0373937_0008143
412 Ga0373937_0112741
413 Ga0373937_0522386
414 Ga0373925_0081116
415 Ga0439446_0035183
416 Ga0439435_0102235
417 Ga0495603_0343058
418 Ga0495582_0274100
419 Ga0495635_0130528
420 Ga0495658_0187283
421 Ga0495658_0235807
422 Ga0495669_0030580
423 Ga0495613_0178638
424 Ga0495613_0189591
425 Ga0496107_0146573
426 Ga0496112_0154854
427 Ga0496114_0085239
428 Ga0501034_0054772
429 Ga0501034_0072026
430 Ga0501034_0206715
431 Ga0501038_0128048
432 Ga0501038_0440084
433 Ga0501039_0087948
434 Ga0501039_0449697
435 Ga0501040_0076055
436 Ga0501040_0329887
437 Ga0501046_0188950
438 Ga0501071_0071896
439 Ga0501072_0036127
440 Ga0501074_0085733
441 Ga0501075_0060948
442 Ga0501075_0080955
443 Ga0501075_0140350
444 Ga0501076_0016809
445 Ga0501076_0318131
446 Ga0501079_0058427
447 Ga0501081_0088331
448 Ga0501081_0312970
449 Ga0501081_0577617
450 Ga0501045_0120410
451 nmdc:mga03683_31140_c1
452 nmdc:mga03n38_14408_c1
453 nmdc:mga00v17_103788_c1
454 nmdc:mga00v17_47203_c1
455 nmdc:mga0yw44_75409_c1
456 nmdc:mga0yw44_9584_c1
457 nmdc:mga0k408_155779_c1
458 nmdc:mga0k408_22558_c1
459 nmdc:mga0k408_430_c1
460 nmdc:mga06z11_3677_c1
461 nmdc:mga06z11_63605_c1
462 nmdc:mga07m45_14253_c1
463 nmdc:mga05p37_21618_c1
464 nmdc:mga05p37_63672_c1
465 nmdc:mga05p37_64194_c1
466 nmdc:mga05p37_888814_c1
467 nmdc:mga09592_32797_c1
468 nmdc:mga09592_59244_c1
469 nmdc:mga09592_99723_c1
470 nmdc:mga06r32_19808_c1
471 nmdc:mga06r32_306481_c1
472 nmdc:mga06r32_3963_c1
473 nmdc:mga08y16_18083_c1
474 nmdc:mga0n895_228383_c1
475 nmdc:mga0a205_13950_c2
476 nmdc:mga0a205_45958_c2
477 Ga0495619_0186613
478 Ga0500628_034391
479 Ga0501084_0119866
480 Ga0501082_0028069
481 Ga0530510_0003625
482 Ga0530510_0181787

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

10

285

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.8087 1 278
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.7955 1 278
7pwy-assembly2.cif.gz_C structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.6871 4 278
7pwy-assembly2.cif.gz_C structure of human dimeric acmsd in complex with the inhibitor tes-1025 0.676 4 278
4inf-assembly1.cif.gz_B crystal structure of amidohydrolase saro_0799 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 with bound calcium 0.6758 3 278
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8418 4 278 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8413 22 278 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8214 4 278 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8028 22 278 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.801 1 278 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7V8WHB6-F1-model_v4 Amidohydrolase 0.9991 1 278 GO:0016787
GO:0016831
AF-A0A7V8WHB6-F1-model_v4 Amidohydrolase 0.992 1 278 GO:0016787
GO:0016831
AF-A0A2V8HGR9-F1-model_v4 Amidohydrolase 0.991 79 278 GO:0016787
GO:0016831
AF-A0A534LIG1-F1-model_v4 Amidohydrolase 0.9906 53 278 GO:0016787
GO:0016831
AF-A0A1Q7N696-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9898 3 279 GO:0016787
GO:0016831

Map