F353534

General Info

Members Datasets Scaffolds Average Seq Length
241 181 482 168

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100628882|Ga0070714_1006288822
Length 178
Sequence MSFQGQRYDFRDKTGDYARVADELASLLAGESDLIANAANTAAMIFDALPDLNWAGFYFLRGDAHSGELVVGPFQGKPACVRIALGKGVCGTAAARRMTLVVADVQQFPGHIACDAASRSEIVVPLLRAGALLGVLDLDSPRLARFDEDDRLGLERLAQIFLAASVAPSSGESLQRPK

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
166 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
167 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
168 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
169 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
170 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
171 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
172 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
173 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
176 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
177 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
180 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.88
Nodule 0
Rhizoplane 8.3
Rhizosphere 80.91
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100628882 3300005435 Bacteria 1032
2 Ga0065715_10526921 3300005293 Bacteria 759
3 Ga0070690_100000249 3300005330 Bacteria 27854
4 Ga0070666_10001526 3300005335 Bacteria 14049
5 Ga0070666_10084760 3300005335 Bacteria 2169
6 Ga0068868_100006089 3300005338 Bacteria 8518
7 Ga0070689_100228952 3300005340 Bacteria 1527
8 Ga0070661_100107439 3300005344 Bacteria 2081
9 Ga0070671_100032796 3300005355 Bacteria 4292
10 Ga0070674_100037381 3300005356 Bacteria 3265
11 Ga0070673_100052751 3300005364 Bacteria 3192
12 Ga0070667_100000792 3300005367 Bacteria 29646
13 Ga0070667_100035132 3300005367 Bacteria 4198
14 Ga0070709_10162256 3300005434 Bacteria 1555
15 Ga0070714_100513296 3300005435 Bacteria 1144
16 Ga0070713_100004648 3300005436 Bacteria 9263
17 Ga0070710_10017784 3300005437 Bacteria 3646
18 Ga0070711_100005916 3300005439 Bacteria 7342
19 Ga0070705_100046277 3300005440 Bacteria 2507
20 Ga0070705_100261187 3300005440 Bacteria 1221
21 Ga0070700_100770653 3300005441 Bacteria 772
22 Ga0070663_100062071 3300005455 Bacteria 2692
23 Ga0070678_100010307 3300005456 Bacteria 5701
24 Ga0068867_100012395 3300005459 Bacteria 6030
25 Ga0070699_100869776 3300005518 Bacteria 825
26 Ga0070672_100013970 3300005543 Bacteria 5680
27 Ga0070686_100448696 3300005544 Bacteria 991
28 Ga0070665_100009390 3300005548 Bacteria 9897
29 Ga0070665_100017574 3300005548 Bacteria 7183
30 Ga0070665_100507293 3300005548 Bacteria 1218
31 Ga0068855_100019676 3300005563 Bacteria 8108
32 Ga0068857_101326689 3300005577 Bacteria 699
33 Ga0068854_100972116 3300005578 Bacteria 750
34 Ga0068856_100001171 3300005614 Bacteria 27588
35 Ga0068856_100001820 3300005614 Bacteria 22280
36 Ga0068856_100006735 3300005614 Bacteria 11259
37 Ga0070702_100007371 3300005615 Bacteria 5265
38 Ga0068859_100001721 3300005617 Bacteria 22327
39 Ga0068859_100236709 3300005617 Bacteria 1915
40 Ga0068864_100284130 3300005618 Bacteria 1545
41 Ga0068866_10084940 3300005718 Bacteria 1709
42 Ga0068863_100024906 3300005841 Bacteria 5707
43 Ga0068863_100105431 3300005841 Bacteria 2681
44 Ga0068858_100003348 3300005842 Bacteria 15953
45 Ga0068858_100043729 3300005842 Bacteria 4153
46 Ga0068860_100007813 3300005843 Bacteria 10680
47 Ga0068862_101501864 3300005844 Bacteria 679
48 Ga0070715_10015065 3300006163 Bacteria 2877
49 Ga0070716_100006723 3300006173 Bacteria 5633
50 Ga0070712_100002140 3300006175 Bacteria 12152
51 Ga0097621_100033248 3300006237 Bacteria 4105
52 Ga0097621_100155596 3300006237 Bacteria 1962
53 Ga0068871_100022407 3300006358 Bacteria 4868
54 Ga0068871_100279073 3300006358 Bacteria 1461
55 Ga0068865_100019314 3300006881 Bacteria 4409
56 Ga0068865_100349754 3300006881 Bacteria 1197
57 Ga0068865_100551920 3300006881 Bacteria 968
58 Ga0097620_100001721 3300006931 Bacteria 22327
59 Ga0097620_100236703 3300006931 Bacteria 1915
60 Ga0105240_10791343 3300009093 Bacteria 1028
61 Ga0105245_10004540 3300009098 Bacteria 12254
62 Ga0105247_10013313 3300009101 Bacteria 4937
63 Ga0105247_10077656 3300009101 Bacteria 2087
64 Ga0114129_10016422 3300009147 Bacteria 10535
65 Ga0105241_10108405 3300009174 Bacteria 2220
66 Ga0105242_10001415 3300009176 Bacteria 18906
67 Ga0105242_10231952 3300009176 Bacteria 1655
68 Ga0105248_10000909 3300009177 Bacteria 33023
69 Ga0105248_10069170 3300009177 Bacteria 3964
70 Ga0105248_10596422 3300009177 Bacteria 1246
71 Ga0105237_10209577 3300009545 Bacteria 1949
72 Ga0105238_10006188 3300009551 Bacteria 11884
73 Ga0105238_11420423 3300009551 Bacteria 721
74 Ga0105238_12301042 3300009551 Unclassified 574
75 Ga0105249_10063914 3300009553 Bacteria 3383
76 Ga0105239_10168089 3300010375 Bacteria 2452
77 Ga0157369_10098205 3300013105 Unclassified 3123
78 Ga0157374_10069188 3300013296 Bacteria 3323
79 Ga0157378_10009774 3300013297 Bacteria 8361
80 Ga0157378_10054732 3300013297 Bacteria 3553
81 Ga0157378_11348063 3300013297 Bacteria 755
82 Ga0157375_10011023 3300013308 Bacteria 7972
83 Ga0157375_10036725 3300013308 Bacteria 4689
84 Ga0157375_10111089 3300013308 Bacteria 2839
85 Ga0163163_10313886 3300014325 Bacteria 1621
86 Ga0182008_10285558 3300014497 Bacteria 860
87 Ga0157379_10001430 3300014968 Bacteria 19600
88 Ga0157379_10166987 3300014968 Bacteria 1987
89 Ga0157376_10576314 3300014969 Bacteria 1117
90 Ga0213876_10186475 3300021384 Bacteria 1103
91 Ga0213875_10270350 3300021388 Unclassified 802
92 Ga0207692_10026396 3300025898 Bacteria 2725
93 Ga0207710_10074042 3300025900 Bacteria 1567
94 Ga0207680_10034457 3300025903 Bacteria 2897
95 Ga0207685_10048124 3300025905 Bacteria 1632
96 Ga0207699_10090510 3300025906 Bacteria 1920
97 Ga0207693_10000007 3300025915 Bacteria 173735
98 Ga0207663_10073698 3300025916 Bacteria 2210
99 Ga0207649_10115669 3300025920 Bacteria 1800
100 Ga0207687_10079464 3300025927 Bacteria 2365
101 Ga0207700_10051301 3300025928 Bacteria 3078
102 Ga0207700_10146469 3300025928 Bacteria 1947
103 Ga0207664_10023877 3300025929 Bacteria 4588
104 Ga0207664_10775334 3300025929 Bacteria 863
105 Ga0207644_10034637 3300025931 Bacteria 3534
106 Ga0207686_10092133 3300025934 Bacteria 2003
107 Ga0207670_10189073 3300025936 Bacteria 1557
108 Ga0207704_10185058 3300025938 Bacteria 1509
109 Ga0207704_10457413 3300025938 Bacteria 1020
110 Ga0207665_10004836 3300025939 Bacteria 8965
111 Ga0207691_10007440 3300025940 Bacteria 10545
112 Ga0207711_10023578 3300025941 Bacteria 5151
113 Ga0207651_10036338 3300025960 Bacteria 3214
114 Ga0207651_10300771 3300025960 Bacteria 1334
115 Ga0207712_10068664 3300025961 Bacteria 2540
116 Ga0207712_10423795 3300025961 Bacteria 1123
117 Ga0207658_10048802 3300025986 Bacteria 3106
118 Ga0207658_10307742 3300025986 Bacteria 1367
119 Ga0207703_10145868 3300026035 Bacteria 2058
120 Ga0207678_10079602 3300026067 Bacteria 2805
121 Ga0207702_10001443 3300026078 Bacteria 23631
122 Ga0207702_10229394 3300026078 Bacteria 1734
123 Ga0207702_10356359 3300026078 Bacteria 1401
124 Ga0207641_10071350 3300026088 Bacteria 2987
125 Ga0207641_10288065 3300026088 Bacteria 1547
126 Ga0207648_10019776 3300026089 Bacteria 6076
127 Ga0207648_10396968 3300026089 Bacteria 1249
128 Ga0207676_10316416 3300026095 Bacteria 1431
129 Ga0207674_10391276 3300026116 Bacteria 1344
130 Ga0207683_10019203 3300026121 Bacteria 5835
131 Ga0207683_10289394 3300026121 Bacteria 1498
132 Ga0268266_10052544 3300028379 Bacteria 3499
133 Ga0268266_10241015 3300028379 Bacteria 1669
134 Ga0268264_10085099 3300028381 Bacteria 2713
135 Ga0268264_10097015 3300028381 Bacteria 2554
136 Ga0265318_10008415 3300028577 Bacteria 4596
137 Ga0265338_10030934 3300028800 Bacteria 5258
138 Ga0265338_10036407 3300028800 Bacteria 4710
139 Ga0265338_10070079 3300028800 Bacteria 3008
140 Ga0265332_10227830 3300031238 Bacteria 772
141 Ga0265320_10077091 3300031240 Bacteria 1560
142 Ga0265325_10073780 3300031241 Bacteria 1708
143 Ga0265325_10107176 3300031241 Bacteria 1362
144 Ga0265339_10228351 3300031249 Bacteria 908
145 Ga0265316_10050567 3300031344 Bacteria 3268
146 Ga0265313_10021658 3300031595 Bacteria 3510
147 Ga0265313_10090235 3300031595 Bacteria 1378
148 Ga0265314_10005575 3300031711 Bacteria 11318
149 Ga0265342_10022821 3300031712 Bacteria 3972
150 Ga0307516_10062276 3300031730 Bacteria 3616
151 Ga0307405_10509361 3300031731 Bacteria 966
152 Ga0307413_10004222 3300031824 Bacteria 6210
153 Ga0307410_10020238 3300031852 Bacteria 4066
154 Ga0307407_10539662 3300031903 Bacteria 860
155 Ga0307409_100010871 3300031995 Bacteria 5696
156 Ga0307409_100020623 3300031995 Bacteria 4497
157 Ga0307416_100224454 3300032002 Bacteria 1805
158 Ga0307411_10422792 3300032005 Bacteria 1107
159 Ga0307411_11042456 3300032005 Bacteria 734
160 Ga0307411_11346728 3300032005 Bacteria 652
161 Ga0373944_0200210 3300035089 Bacteria 723
162 Ga0373923_0244304 3300035111 Bacteria 839
163 Ga0373954_0084167 3300035118 Bacteria 1522
164 Ga0373957_0167810 3300035120 Bacteria 906
165 Ga0373955_0030153 3300035172 Bacteria 2828
166 Ga0373935_0180901 3300035692 Bacteria 1448
167 Ga0373927_0033810 3300035695 Bacteria 3327
168 Ga0373933_0032118 3300035724 Bacteria 3050
169 Ga0373925_0242120 3300037068 Bacteria 1445
170 Ga0436365_0299920 3300039437 Bacteria 951
171 Ga0436365_1161890 3300039437 Bacteria 1218
172 Ga0436363_1531622 3300039450 Bacteria 17727
173 Ga0436362_0241447 3300039453 Bacteria 2617
174 Ga0451577_0011772 3300042876 Bacteria 8256
175 Ga0451577_0406747 3300042876 Bacteria 1235
176 Ga0453684_1289733 3300044712 Bacteria 762
177 Ga0466971_0190056 3300044719 Bacteria 967
178 Ga0495650_0003750 3300046471 Bacteria 10856
179 Ga0495580_0039086 3300046472 Bacteria 3395
180 Ga0495630_0156107 3300046517 Bacteria 1737
181 Ga0495665_0425805 3300046531 Bacteria 672
182 Ga0495586_0163927 3300046535 Bacteria 1254
183 Ga0495625_0105506 3300046660 Bacteria 1930
184 Ga0495658_0060552 3300046683 Bacteria 2172
185 Ga0495674_0211559 3300047319 Bacteria 1606
186 Ga0495602_0854672 3300048088 Bacteria 608
187 Ga0496100_0040478 3300048903 Bacteria 2965
188 Ga0496101_0055435 3300048904 Bacteria 2863
189 Ga0496101_0080731 3300048904 Bacteria 2403
190 Ga0496102_0003321 3300048905 Bacteria 13637
191 Ga0496103_0163443 3300048906 Bacteria 1428
192 Ga0496103_0193269 3300048906 Bacteria 1308
193 Ga0496105_0187059 3300048908 Bacteria 1694
194 Ga0496106_0000870 3300048909 Bacteria 21979
195 Ga0496106_0409775 3300048909 Bacteria 1089
196 Ga0496107_0002268 3300048910 Bacteria 12409
197 Ga0496107_0018446 3300048910 Bacteria 4913
198 Ga0496108_0162446 3300048911 Bacteria 1931
199 Ga0496108_0243179 3300048911 Bacteria 1565
200 Ga0496109_0010522 3300048912 Bacteria 7906
201 Ga0496110_0358062 3300048913 Bacteria 1329
202 Ga0496111_0054316 3300048914 Bacteria 2895
203 Ga0496113_0159062 3300048916 Bacteria 1785
204 Ga0496114_0017327 3300048917 Bacteria 5813
205 Ga0496115_0048756 3300048918 Bacteria 3388
206 Ga0496115_0693635 3300048918 Bacteria 801
207 Ga0496126_0000463 3300048929 Bacteria 80860
208 Ga0501031_0000638 3300049568 Bacteria 20752
209 Ga0501032_0015768 3300049569 Bacteria 5329
210 Ga0501033_0004029 3300049570 Bacteria 11864
211 Ga0501036_0683204 3300049572 Bacteria 849
212 Ga0501043_0471142 3300049579 Bacteria 941
213 Ga0501043_0606543 3300049579 Bacteria 808
214 Ga0501046_0603748 3300049580 Bacteria 779
215 Ga0501070_0754136 3300049586 Bacteria 767
216 Ga0501071_0538755 3300049587 Bacteria 896
217 Ga0501076_0716646 3300049592 Bacteria 826
218 Ga0501035_0007736 3300049822 Bacteria 10037
219 Ga0501044_0000611 3300049823 Bacteria 43362
220 Ga0501044_0556366 3300049823 Bacteria 1044
221 nmdc:mga05p37_309799_c1 3300050507 Bacteria 1872
222 Ga0500635_0050426 3300053080 Bacteria 1423
223 Ga0500578_0339276 3300053086 Bacteria 881
224 Ga0500647_0289395 3300053091 Bacteria 705
225 Ga0500566_0002483 3300053094 Bacteria 10954
226 Ga0500566_0019869 3300053094 Bacteria 3943
227 Ga0500640_001950 3300053095 Bacteria 6604
228 Ga0500554_000049 3300053102 Bacteria 21007
229 Ga0500572_018009 3300053111 Bacteria 1822
230 Ga0500595_001264 3300053119 Bacteria 13906
231 Ga0500595_038386 3300053119 Bacteria 1557
232 Ga0500614_000037 3300053123 Bacteria 28403
233 Ga0500559_0014252 3300053136 Bacteria 3359
234 Ga0500585_026133 3300053144 Bacteria 1968
235 Ga0500585_180310 3300053144 Bacteria 717
236 Ga0500603_004886 3300053150 Bacteria 2871
237 Ga0500619_048806 3300053154 Bacteria 1364
238 Ga0500622_0000315 3300053156 Bacteria 49087
239 Ga0500637_0330363 3300053178 Bacteria 820
240 Ga0500601_001782 3300053737 Bacteria 2316
241 Ga0501084_0388653 3300054114 Bacteria 1179
242 Ga0070714_100628882
243 Ga0065715_10526921
244 Ga0070690_100000249
245 Ga0070666_10001526
246 Ga0070666_10084760
247 Ga0068868_100006089
248 Ga0070689_100228952
249 Ga0070661_100107439
250 Ga0070671_100032796
251 Ga0070674_100037381
252 Ga0070673_100052751
253 Ga0070667_100000792
254 Ga0070667_100035132
255 Ga0070709_10162256
256 Ga0070714_100513296
257 Ga0070713_100004648
258 Ga0070710_10017784
259 Ga0070711_100005916
260 Ga0070705_100046277
261 Ga0070705_100261187
262 Ga0070700_100770653
263 Ga0070663_100062071
264 Ga0070678_100010307
265 Ga0068867_100012395
266 Ga0070699_100869776
267 Ga0070672_100013970
268 Ga0070686_100448696
269 Ga0070665_100009390
270 Ga0070665_100017574
271 Ga0070665_100507293
272 Ga0068855_100019676
273 Ga0068857_101326689
274 Ga0068854_100972116
275 Ga0068856_100001171
276 Ga0068856_100001820
277 Ga0068856_100006735
278 Ga0070702_100007371
279 Ga0068859_100001721
280 Ga0068859_100236709
281 Ga0068864_100284130
282 Ga0068866_10084940
283 Ga0068863_100024906
284 Ga0068863_100105431
285 Ga0068858_100003348
286 Ga0068858_100043729
287 Ga0068860_100007813
288 Ga0068862_101501864
289 Ga0070715_10015065
290 Ga0070716_100006723
291 Ga0070712_100002140
292 Ga0097621_100033248
293 Ga0097621_100155596
294 Ga0068871_100022407
295 Ga0068871_100279073
296 Ga0068865_100019314
297 Ga0068865_100349754
298 Ga0068865_100551920
299 Ga0097620_100001721
300 Ga0097620_100236703
301 Ga0105240_10791343
302 Ga0105245_10004540
303 Ga0105247_10013313
304 Ga0105247_10077656
305 Ga0114129_10016422
306 Ga0105241_10108405
307 Ga0105242_10001415
308 Ga0105242_10231952
309 Ga0105248_10000909
310 Ga0105248_10069170
311 Ga0105248_10596422
312 Ga0105237_10209577
313 Ga0105238_10006188
314 Ga0105238_11420423
315 Ga0105238_12301042
316 Ga0105249_10063914
317 Ga0105239_10168089
318 Ga0157369_10098205
319 Ga0157374_10069188
320 Ga0157378_10009774
321 Ga0157378_10054732
322 Ga0157378_11348063
323 Ga0157375_10011023
324 Ga0157375_10036725
325 Ga0157375_10111089
326 Ga0163163_10313886
327 Ga0182008_10285558
328 Ga0157379_10001430
329 Ga0157379_10166987
330 Ga0157376_10576314
331 Ga0213876_10186475
332 Ga0213875_10270350
333 Ga0207692_10026396
334 Ga0207710_10074042
335 Ga0207680_10034457
336 Ga0207685_10048124
337 Ga0207699_10090510
338 Ga0207693_10000007
339 Ga0207663_10073698
340 Ga0207649_10115669
341 Ga0207687_10079464
342 Ga0207700_10051301
343 Ga0207700_10146469
344 Ga0207664_10023877
345 Ga0207664_10775334
346 Ga0207644_10034637
347 Ga0207686_10092133
348 Ga0207670_10189073
349 Ga0207704_10185058
350 Ga0207704_10457413
351 Ga0207665_10004836
352 Ga0207691_10007440
353 Ga0207711_10023578
354 Ga0207651_10036338
355 Ga0207651_10300771
356 Ga0207712_10068664
357 Ga0207712_10423795
358 Ga0207658_10048802
359 Ga0207658_10307742
360 Ga0207703_10145868
361 Ga0207678_10079602
362 Ga0207702_10001443
363 Ga0207702_10229394
364 Ga0207702_10356359
365 Ga0207641_10071350
366 Ga0207641_10288065
367 Ga0207648_10019776
368 Ga0207648_10396968
369 Ga0207676_10316416
370 Ga0207674_10391276
371 Ga0207683_10019203
372 Ga0207683_10289394
373 Ga0268266_10052544
374 Ga0268266_10241015
375 Ga0268264_10085099
376 Ga0268264_10097015
377 Ga0265318_10008415
378 Ga0265338_10030934
379 Ga0265338_10036407
380 Ga0265338_10070079
381 Ga0265332_10227830
382 Ga0265320_10077091
383 Ga0265325_10073780
384 Ga0265325_10107176
385 Ga0265339_10228351
386 Ga0265316_10050567
387 Ga0265313_10021658
388 Ga0265313_10090235
389 Ga0265314_10005575
390 Ga0265342_10022821
391 Ga0307516_10062276
392 Ga0307405_10509361
393 Ga0307413_10004222
394 Ga0307410_10020238
395 Ga0307407_10539662
396 Ga0307409_100010871
397 Ga0307409_100020623
398 Ga0307416_100224454
399 Ga0307411_10422792
400 Ga0307411_11042456
401 Ga0307411_11346728
402 Ga0373944_0200210
403 Ga0373923_0244304
404 Ga0373954_0084167
405 Ga0373957_0167810
406 Ga0373955_0030153
407 Ga0373935_0180901
408 Ga0373927_0033810
409 Ga0373933_0032118
410 Ga0373925_0242120
411 Ga0436365_0299920
412 Ga0436365_1161890
413 Ga0436363_1531622
414 Ga0436362_0241447
415 Ga0451577_0011772
416 Ga0451577_0406747
417 Ga0453684_1289733
418 Ga0466971_0190056
419 Ga0495650_0003750
420 Ga0495580_0039086
421 Ga0495630_0156107
422 Ga0495665_0425805
423 Ga0495586_0163927
424 Ga0495625_0105506
425 Ga0495658_0060552
426 Ga0495674_0211559
427 Ga0495602_0854672
428 Ga0496100_0040478
429 Ga0496101_0055435
430 Ga0496101_0080731
431 Ga0496102_0003321
432 Ga0496103_0163443
433 Ga0496103_0193269
434 Ga0496105_0187059
435 Ga0496106_0000870
436 Ga0496106_0409775
437 Ga0496107_0002268
438 Ga0496107_0018446
439 Ga0496108_0162446
440 Ga0496108_0243179
441 Ga0496109_0010522
442 Ga0496110_0358062
443 Ga0496111_0054316
444 Ga0496113_0159062
445 Ga0496114_0017327
446 Ga0496115_0048756
447 Ga0496115_0693635
448 Ga0496126_0000463
449 Ga0501031_0000638
450 Ga0501032_0015768
451 Ga0501033_0004029
452 Ga0501036_0683204
453 Ga0501043_0471142
454 Ga0501043_0606543
455 Ga0501046_0603748
456 Ga0501070_0754136
457 Ga0501071_0538755
458 Ga0501076_0716646
459 Ga0501035_0007736
460 Ga0501044_0000611
461 Ga0501044_0556366
462 nmdc:mga05p37_309799_c1
463 Ga0500635_0050426
464 Ga0500578_0339276
465 Ga0500647_0289395
466 Ga0500566_0002483
467 Ga0500566_0019869
468 Ga0500640_001950
469 Ga0500554_000049
470 Ga0500572_018009
471 Ga0500595_001264
472 Ga0500595_038386
473 Ga0500614_000037
474 Ga0500559_0014252
475 Ga0500585_026133
476 Ga0500585_180310
477 Ga0500603_004886
478 Ga0500619_048806
479 Ga0500622_0000315
480 Ga0500637_0330363
481 Ga0500601_001782
482 Ga0501084_0388653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13185

GAF_2

GAF domain

36

164

0.86

PF01590

GAF

GAF domain

18

164

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksf-assembly3.cif.gz_F structure of frmsr of staphylococcus aureus (reduced form) 0.9819 17 160
3rfb-assembly1.cif.gz_A structure of frmsr 0.9753 13 161
3ksg-assembly1.cif.gz_B structure of frmsr of staphylococcus aureus (complex with substrate) 0.9648 17 160
5hl6-assembly1.cif.gz_A crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9589 13 166
1vhm-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9569 12 160
ID Description Score Start End Superfamily
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9753 13 161 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9603 13 157 3.30.450.40
1vhmA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9569 12 160 3.30.450.40
af_Q4DSC2_14_185_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9366 13 161 3.30.450.40
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9039 13 161 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A7G8XD19-F1-model_v4 GAF domain-containing protein 1 35 159 GO:0005829
GO:0033745
AF-A0A838PFU2-F1-model_v4 GAF domain-containing protein 0.9983 13 161 GO:0005829
GO:0033745
AF-A0A7V5PQN9-F1-model_v4 GAF domain-containing protein 0.9977 13 161 GO:0005829
GO:0033745
AF-A0A836XJZ0-F1-model_v4 GAF domain-containing protein 0.9975 17 158 GO:0005829
GO:0033745
AF-A0A5Q4GRY3-F1-model_v4 GAF domain-containing protein 0.9973 16 160 GO:0005829
GO:0033745

Map