F353411

General Info

Members Datasets Scaffolds Average Seq Length
241 123 238 294

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10216871|rootH1_102168711
Length 312
Sequence LENIPVSLTLDVFQKIIPMNIPSTITIAANSAHPFTVNRPGYGTMRLTGEGIYGEPPNRPEALQILKQAVKSGVNFLDTADYYGEDVTNRLIAEALYPYPADLVICTKVGGARKPDKSWIPYNKPHELRASIDNNLRTLKIEQVQLVHFRSFGAHSPTPFEESMGAMFEMQKEGKILHVGVSNVSREQLQTAMKMGEVATVENMYGHAQRNTFDSQFGTTHGGGEVLDICEKHGIPLVPYFSLFLSMPKKDERIASIAKKYNISEVQANIAWLLHRSPWILPIPGTSSLKHFAENMLAASIELTEEDMRYLA

Samples

Sample ID Description Type Environment
1 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
90 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 0
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10016314 3300003320 Bacteria 2932
2 rootH1_10216871 3300003323 Bacteria 1542
3 Ga0070658_10033505 3300005327 Bacteria 4133
4 Ga0070658_10071875 3300005327 Bacteria 2834
5 Ga0070658_10126032 3300005327 Bacteria 2132
6 Ga0070658_10147888 3300005327 Bacteria 1965
7 Ga0070658_10425298 3300005327 Unclassified 1142
8 Ga0070658_10520345 3300005327 Bacteria 1028
9 Ga0070683_100031719 3300005329 Bacteria 4808
10 Ga0070683_100296615 3300005329 Bacteria 1537
11 Ga0070666_10000156 3300005335 Bacteria 47136
12 Ga0070680_100012512 3300005336 Bacteria 6596
13 Ga0070680_100018214 3300005336 Bacteria 5547
14 Ga0070680_100137397 3300005336 Bacteria 2048
15 Ga0070680_100198469 3300005336 Bacteria 1692
16 Ga0070682_100423818 3300005337 Bacteria 1012
17 Ga0068868_100022143 3300005338 Bacteria 4793
18 Ga0070660_100049481 3300005339 Bacteria 3231
19 Ga0070660_100091395 3300005339 Bacteria 2401
20 Ga0070674_100265831 3300005356 Unclassified 1353
21 Ga0070673_100488114 3300005364 Bacteria 1113
22 Ga0070659_100014415 3300005366 Bacteria 5908
23 Ga0070659_100137355 3300005366 Bacteria 1988
24 Ga0070667_100057683 3300005367 Bacteria 3282
25 Ga0070667_100138061 3300005367 Bacteria 2132
26 Ga0070663_100092666 3300005455 Bacteria 2241
27 Ga0070663_100253003 3300005455 Bacteria 1395
28 Ga0070681_10043441 3300005458 Bacteria 4503
29 Ga0070681_10066605 3300005458 Bacteria 3570
30 Ga0070681_10176097 3300005458 Bacteria 2061
31 Ga0070681_10324176 3300005458 Bacteria 1450
32 Ga0070685_10034368 3300005466 Bacteria 2855
33 Ga0070679_100006523 3300005530 Bacteria 10872
34 Ga0070679_100010563 3300005530 Bacteria 8758
35 Ga0070679_100035775 3300005530 Bacteria 4926
36 Ga0070679_100106797 3300005530 Bacteria 2785
37 Ga0070679_100338644 3300005530 Bacteria 1452
38 Ga0070684_100084232 3300005535 Bacteria 2818
39 Ga0068853_100130361 3300005539 Bacteria 2250
40 Ga0068853_100271217 3300005539 Unclassified 1562
41 Ga0068853_100516166 3300005539 Bacteria 1129
42 Ga0068855_100000043 3300005563 Bacteria 149118
43 Ga0068855_100000097 3300005563 Bacteria 106474
44 Ga0068855_100025193 3300005563 Bacteria 7122
45 Ga0068855_100062661 3300005563 Bacteria 4340
46 Ga0068855_100097443 3300005563 Bacteria 3388
47 Ga0068855_100241717 3300005563 Bacteria 2017
48 Ga0068855_100739099 3300005563 Unclassified 1050
49 Ga0068854_100035592 3300005578 Bacteria 3486
50 Ga0068856_100000824 3300005614 Bacteria 33487
51 Ga0068856_100002280 3300005614 Bacteria 19791
52 Ga0068856_100080740 3300005614 Bacteria 3226
53 Ga0068852_100027329 3300005616 Bacteria 4650
54 Ga0068852_100051546 3300005616 Bacteria 3532
55 Ga0068852_100091236 3300005616 Bacteria 2726
56 Ga0068852_100148369 3300005616 Bacteria 2178
57 Ga0068859_100000024 3300005617 Bacteria 217931
58 Ga0068859_100010236 3300005617 Bacteria 9439
59 Ga0068859_100154765 3300005617 Bacteria 2369
60 Ga0068851_10005773 3300005834 Bacteria 5637
61 Ga0068863_100011308 3300005841 Bacteria 8644
62 Ga0068863_100039424 3300005841 Bacteria 4494
63 Ga0068858_100012733 3300005842 Bacteria 7925
64 Ga0068860_100004190 3300005843 Bacteria 14778
65 Ga0075366_10010291 3300006195 Bacteria 5248
66 Ga0097621_100365110 3300006237 Bacteria 1287
67 Ga0068871_100226900 3300006358 Bacteria 1620
68 Ga0097620_100000024 3300006931 Bacteria 217931
69 Ga0097620_100010236 3300006931 Bacteria 9439
70 Ga0097620_100154775 3300006931 Bacteria 2369
71 Ga0105240_10000101 3300009093 Bacteria 175584
72 Ga0105240_10001228 3300009093 Bacteria 44551
73 Ga0105240_10039490 3300009093 Bacteria 6043
74 Ga0105240_10065224 3300009093 Bacteria 4521
75 Ga0105240_10125427 3300009093 Bacteria 3086
76 Ga0105245_10120534 3300009098 Bacteria 2450
77 Ga0105243_10194573 3300009148 Bacteria 1774
78 Ga0105241_10000856 3300009174 Bacteria 23074
79 Ga0105241_10001790 3300009174 Bacteria 16323
80 Ga0105237_10042402 3300009545 Bacteria 4588
81 Ga0105238_10180252 3300009551 Bacteria 2089
82 Ga0105239_10001340 3300010375 Bacteria 33201
83 Ga0105239_10013703 3300010375 Bacteria 9004
84 Ga0105239_10042662 3300010375 Bacteria 4970
85 Ga0105239_10097451 3300010375 Bacteria 3250
86 Ga0105246_10105966 3300011119 Unclassified 2055
87 Ga0157373_10011444 3300013100 Bacteria 6525
88 Ga0157373_10012068 3300013100 Bacteria 6350
89 Ga0157373_10055916 3300013100 Bacteria 2803
90 Ga0157373_10057497 3300013100 Bacteria 2759
91 Ga0157373_10164403 3300013100 Bacteria 1562
92 Ga0157373_10181341 3300013100 Bacteria 1482
93 Ga0157371_10001923 3300013102 Bacteria 20736
94 Ga0157371_10004024 3300013102 Bacteria 13009
95 Ga0157371_10023632 3300013102 Bacteria 4496
96 Ga0157371_10081814 3300013102 Bacteria 2286
97 Ga0157371_10103149 3300013102 Bacteria 2024
98 Ga0157371_10108418 3300013102 Unclassified 1971
99 Ga0157371_10198103 3300013102 Bacteria 1439
100 Ga0157370_10010854 3300013104 Bacteria 9567
101 Ga0157370_10144114 3300013104 Bacteria 2219
102 Ga0157369_10001079 3300013105 Bacteria 34142
103 Ga0157369_10010087 3300013105 Bacteria 10786
104 Ga0157369_10124112 3300013105 Bacteria 2739
105 Ga0157369_10257252 3300013105 Bacteria 1821
106 Ga0157374_10051930 3300013296 Bacteria 3816
107 Ga0157374_10240180 3300013296 Unclassified 1781
108 Ga0157378_10003337 3300013297 Bacteria 14278
109 Ga0157378_10047046 3300013297 Bacteria 3835
110 Ga0157378_10383430 3300013297 Bacteria 1381
111 Ga0163162_10001970 3300013306 Bacteria 19305
112 Ga0163162_10004069 3300013306 Bacteria 14035
113 Ga0157372_10000039 3300013307 Bacteria 165839
114 Ga0157372_10017207 3300013307 Bacteria 7761
115 Ga0157372_10080650 3300013307 Bacteria 3683
116 Ga0157372_10104752 3300013307 Bacteria 3234
117 Ga0157375_10039678 3300013308 Bacteria 4533
118 Ga0163163_10371630 3300014325 Bacteria 1487
119 Ga0163163_10517724 3300014325 Bacteria 1255
120 Ga0157379_10044767 3300014968 Bacteria 3950
121 Ga0157379_10495445 3300014968 Bacteria 1132
122 Ga0157376_10035993 3300014969 Unclassified 4007
123 Ga0209233_1018957 3300025261 Unclassified 1838
124 Ga0207656_10019734 3300025321 Bacteria 2669
125 Ga0207680_10001921 3300025903 Bacteria 9742
126 Ga0207705_10012699 3300025909 Bacteria 6077
127 Ga0207705_10031606 3300025909 Bacteria 3780
128 Ga0207705_10081537 3300025909 Bacteria 2358
129 Ga0207705_10234900 3300025909 Bacteria 1395
130 Ga0207654_10001496 3300025911 Bacteria 12339
131 Ga0207654_10007288 3300025911 Bacteria 5574
132 Ga0207707_10073139 3300025912 Bacteria 2989
133 Ga0207695_10000020 3300025913 Bacteria 723025
134 Ga0207695_10001743 3300025913 Bacteria 34552
135 Ga0207695_10117228 3300025913 Bacteria 2636
136 Ga0207671_10008266 3300025914 Bacteria 8852
137 Ga0207660_10017967 3300025917 Bacteria 4709
138 Ga0207660_10152955 3300025917 Unclassified 1774
139 Ga0207660_10175192 3300025917 Bacteria 1663
140 Ga0207660_10190868 3300025917 Bacteria 1595
141 Ga0207660_10198950 3300025917 Bacteria 1564
142 Ga0207657_10004524 3300025919 Bacteria 14691
143 Ga0207657_10012983 3300025919 Bacteria 8187
144 Ga0207657_10092047 3300025919 Bacteria 2527
145 Ga0207657_10415786 3300025919 Bacteria 1057
146 Ga0207652_10000180 3300025921 Bacteria 66974
147 Ga0207652_10002224 3300025921 Bacteria 16555
148 Ga0207652_10071695 3300025921 Bacteria 3011
149 Ga0207652_10079471 3300025921 Bacteria 2865
150 Ga0207652_10134255 3300025921 Bacteria 2209
151 Ga0207652_10364492 3300025921 Bacteria 1304
152 Ga0207650_10189822 3300025925 Bacteria 1641
153 Ga0207650_10294671 3300025925 Bacteria 1324
154 Ga0207644_10165051 3300025931 Bacteria 1725
155 Ga0207690_10143543 3300025932 Bacteria 1762
156 Ga0207689_10001965 3300025942 Bacteria 19412
157 Ga0207661_10272860 3300025944 Bacteria 1510
158 Ga0207661_10503081 3300025944 Unclassified 1107
159 Ga0207679_10353398 3300025945 Unclassified 1282
160 Ga0207667_10000015 3300025949 Bacteria 417534
161 Ga0207667_10000190 3300025949 Bacteria 90197
162 Ga0207667_10103445 3300025949 Unclassified 2937
163 Ga0207667_10135796 3300025949 Bacteria 2533
164 Ga0207667_10216241 3300025949 Unclassified 1964
165 Ga0207667_10341249 3300025949 Bacteria 1529
166 Ga0207658_10154568 3300025986 Bacteria 1873
167 Ga0207677_10105712 3300026023 Unclassified 2084
168 Ga0207677_10124979 3300026023 Bacteria 1942
169 Ga0207677_10232524 3300026023 Bacteria 1486
170 Ga0207703_10000764 3300026035 Bacteria 31691
171 Ga0207639_10053901 3300026041 Bacteria 3071
172 Ga0207639_10067824 3300026041 Bacteria 2777
173 Ga0207639_10108725 3300026041 Bacteria 2255
174 Ga0207639_10312532 3300026041 Unclassified 1392
175 Ga0207678_10195141 3300026067 Bacteria 1730
176 Ga0207702_10000165 3300026078 Bacteria 79066
177 Ga0207702_10108746 3300026078 Bacteria 2461
178 Ga0207641_10000087 3300026088 Bacteria 132202
179 Ga0207641_10007550 3300026088 Bacteria 9043
180 Ga0207648_10186485 3300026089 Bacteria 1837
181 Ga0207676_10018217 3300026095 Bacteria 5101
182 Ga0207674_10044546 3300026116 Bacteria 4570
183 Ga0207675_100283747 3300026118 Bacteria 1609
184 Ga0207698_10030195 3300026142 Bacteria 3894
185 Ga0207698_10195379 3300026142 Bacteria 1807
186 Ga0207698_10231035 3300026142 Bacteria 1679
187 Ga0207698_10379312 3300026142 Bacteria 1344
188 Ga0268264_10004777 3300028381 Bacteria 11497
189 Ga0265337_1002475 3300028556 Bacteria 8433
190 Ga0265319_1000466 3300028563 Bacteria 28680
191 Ga0265334_10046076 3300028573 Unclassified 1686
192 Ga0265322_10045317 3300028654 Unclassified 1251
193 Ga0265336_10000223 3300028666 Bacteria 40169
194 Ga0307515_10000118 3300028794 Bacteria 190444
195 Ga0265338_10009469 3300028800 Bacteria 11608
196 Ga0265338_10126104 3300028800 Bacteria 2031
197 Ga0265330_10008648 3300031235 Bacteria 4887
198 Ga0265330_10086832 3300031235 Unclassified 1345
199 Ga0265332_10001318 3300031238 Bacteria 14101
200 Ga0265320_10009204 3300031240 Bacteria 5972
201 Ga0265325_10022580 3300031241 Unclassified 3445
202 Ga0265340_10005434 3300031247 Bacteria 7076
203 Ga0265339_10011033 3300031249 Bacteria 5584
204 Ga0265339_10052127 3300031249 Unclassified 2230
205 Ga0265327_10012995 3300031251 Bacteria 5567
206 Ga0265327_10173458 3300031251 Unclassified 990
207 Ga0265316_10006071 3300031344 Bacteria 11594
208 Ga0265316_10055923 3300031344 Unclassified 3084
209 Ga0265313_10006655 3300031595 Bacteria 8103
210 Ga0265342_10041693 3300031712 Unclassified 2777
211 Ga0395899_0000002 3300037312 Bacteria 1324310
212 Ga0395899_0000325 3300037312 Bacteria 60438
213 Ga0395899_0017229 3300037312 Bacteria 5505
214 Ga0395899_0354021 3300037312 Bacteria 981
215 Ga0395900_0014096 3300037418 Bacteria 8161
216 Ga0395900_0312845 3300037418 Bacteria 1553
217 Ga0395898_0006787 3300037466 Bacteria 12183
218 Ga0395898_0028408 3300037466 Bacteria 5604
219 Ga0395898_0286187 3300037466 Bacteria 1572
220 Ga0395901_0023951 3300038443 Bacteria 6263
221 Ga0395901_0161156 3300038443 Bacteria 2356
222 Ga0466969_0004818 3300044656 Bacteria 7188
223 Ga0466966_0131152 3300044684 Unclassified 1534
224 Ga0466961_0009665 3300044693 Bacteria 6140
225 Ga0466959_0005764 3300045049 Bacteria 8525
226 Ga0495630_0504195 3300046517 Unclassified 928
227 Ga0495634_0106917 3300046642 Bacteria 1803
228 Ga0495635_0221293 3300046663 Bacteria 1280
229 Ga0495661_0014316 3300046665 Bacteria 5316
230 Ga0495647_0049400 3300046681 Unclassified 1630
231 Ga0495624_0096542 3300046690 Bacteria 1821
232 Ga0495674_0113070 3300047319 Bacteria 2300
233 Ga0495672_0016866 3300047320 Bacteria 4902
234 Ga0495672_0127759 3300047320 Bacteria 1341
235 Ga0495680_0156423 3300047322 Bacteria 1658
236 Ga0501034_0101405 3300049571 Bacteria 2872
237 Ga0501037_0242069 3300049573 Bacteria 1264
238 Ga0500618_027390 3300053125 Bacteria 1356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10001923 Ga0157371_1000192320 261
2 3300025911 Ga0207654_10007288 Ga0207654_100072883 267
3 3300037312 Ga0395899_0354021 Ga0395899_0354021_145_951 267
4 3300005616 Ga0068852_100148369 Ga0068852_1001483691 269
5 3300026142 Ga0207698_10195379 Ga0207698_101953791 269
6 3300025919 Ga0207657_10012983 Ga0207657_100129833 275
7 3300005455 Ga0070663_100253003 Ga0070663_1002530032 279
8 iso_pu_bacteria 2739367866 2740032978 285
9 iso_pu_bacteria 2919437846 2919440486 288
10 3300005617 Ga0068859_100010236 Ga0068859_1000102365 289
11 3300006931 Ga0097620_100010236 Ga0097620_10001023612 289
12 3300013297 Ga0157378_10383430 Ga0157378_103834301 289
13 3300013308 Ga0157375_10039678 Ga0157375_100396783 289
14 3300053125 Ga0500618_027390 Ga0500618_027390_392_1261 289
15 iso_pu_bacteria 2914759650 2914761272 289
16 3300005356 Ga0070674_100265831 Ga0070674_1002658311 291
17 3300005530 Ga0070679_100106797 Ga0070679_1001067973 291
18 3300005834 Ga0068851_10005773 Ga0068851_100057734 291
19 3300014969 Ga0157376_10035993 Ga0157376_100359932 291
20 3300025909 Ga0207705_10234900 Ga0207705_102349002 291
21 3300025917 Ga0207660_10175192 Ga0207660_101751922 291
22 3300025921 Ga0207652_10364492 Ga0207652_103644921 291
23 3300026041 Ga0207639_10053901 Ga0207639_100539012 291
24 3300026118 Ga0207675_100283747 Ga0207675_1002837473 291
25 3300046517 Ga0495630_0504195 Ga0495630_0504195_37_915 291
26 3300046642 Ga0495634_0106917 Ga0495634_0106917_289_1167 291
27 3300046663 Ga0495635_0221293 Ga0495635_0221293_176_1054 291
28 3300046681 Ga0495647_0049400 Ga0495647_0049400_652_1530 291
29 3300046690 Ga0495624_0096542 Ga0495624_0096542_841_1719 291
30 3300047319 Ga0495674_0113070 Ga0495674_0113070_302_1180 291
31 3300047320 Ga0495672_0127759 Ga0495672_0127759_160_1035 291
32 3300047322 Ga0495680_0156423 Ga0495680_0156423_604_1482 291
33 3300049573 Ga0501037_0242069 Ga0501037_0242069_179_1057 291
34 3300005327 Ga0070658_10033505 Ga0070658_100335052 292
35 3300005327 Ga0070658_10147888 Ga0070658_101478882 292
36 3300005327 Ga0070658_10425298 Ga0070658_104252982 292
37 3300005327 Ga0070658_10520345 Ga0070658_105203451 292
38 3300005329 Ga0070683_100031719 Ga0070683_1000317193 292
39 3300005329 Ga0070683_100296615 Ga0070683_1002966152 292
40 3300005336 Ga0070680_100018214 Ga0070680_1000182142 292
41 3300005336 Ga0070680_100137397 Ga0070680_1001373972 292
42 3300005336 Ga0070680_100198469 Ga0070680_1001984692 292
43 3300005337 Ga0070682_100423818 Ga0070682_1004238181 292
44 3300005339 Ga0070660_100049481 Ga0070660_1000494814 292
45 3300005339 Ga0070660_100091395 Ga0070660_1000913952 292
46 3300005366 Ga0070659_100014415 Ga0070659_1000144152 292
47 3300005366 Ga0070659_100137355 Ga0070659_1001373553 292
48 3300005455 Ga0070663_100092666 Ga0070663_1000926662 292
49 3300005458 Ga0070681_10043441 Ga0070681_100434415 292
50 3300005458 Ga0070681_10066605 Ga0070681_100666053 292
51 3300005458 Ga0070681_10176097 Ga0070681_101760973 292
52 3300005458 Ga0070681_10324176 Ga0070681_103241762 292
53 3300005530 Ga0070679_100010563 Ga0070679_10001056310 292
54 3300005530 Ga0070679_100035775 Ga0070679_1000357754 292
55 3300005530 Ga0070679_100338644 Ga0070679_1003386442 292
56 3300005535 Ga0070684_100084232 Ga0070684_1000842322 292
57 3300005539 Ga0068853_100130361 Ga0068853_1001303612 292
58 3300005539 Ga0068853_100271217 Ga0068853_1002712172 292
59 3300005563 Ga0068855_100025193 Ga0068855_1000251935 292
60 3300005563 Ga0068855_100062661 Ga0068855_1000626614 292
61 3300005563 Ga0068855_100097443 Ga0068855_1000974431 292
62 3300005563 Ga0068855_100241717 Ga0068855_1002417172 292
63 3300005563 Ga0068855_100739099 Ga0068855_1007390991 292
64 3300005578 Ga0068854_100035592 Ga0068854_1000355923 292
65 3300005614 Ga0068856_100002280 Ga0068856_10000228011 292
66 3300006237 Ga0097621_100365110 Ga0097621_1003651102 292
67 3300009093 Ga0105240_10000101 Ga0105240_10000101117 292
68 3300009093 Ga0105240_10065224 Ga0105240_100652242 292
69 3300009093 Ga0105240_10125427 Ga0105240_101254273 292
70 3300010375 Ga0105239_10001340 Ga0105239_1000134010 292
71 3300010375 Ga0105239_10013703 Ga0105239_100137033 292
72 3300013100 Ga0157373_10011444 Ga0157373_100114446 292
73 3300013100 Ga0157373_10012068 Ga0157373_100120687 292
74 3300013100 Ga0157373_10055916 Ga0157373_100559162 292
75 3300013100 Ga0157373_10057497 Ga0157373_100574973 292
76 3300013100 Ga0157373_10164403 Ga0157373_101644031 292
77 3300013100 Ga0157373_10181341 Ga0157373_101813411 292
78 3300013102 Ga0157371_10023632 Ga0157371_100236323 292
79 3300013102 Ga0157371_10081814 Ga0157371_100818143 292
80 3300013102 Ga0157371_10103149 Ga0157371_101031492 292
81 3300013102 Ga0157371_10108418 Ga0157371_101084182 292
82 3300013102 Ga0157371_10198103 Ga0157371_101981032 292
83 3300013104 Ga0157370_10010854 Ga0157370_1001085410 292
84 3300013104 Ga0157370_10144114 Ga0157370_101441142 292
85 3300013105 Ga0157369_10010087 Ga0157369_100100879 292
86 3300013105 Ga0157369_10124112 Ga0157369_101241123 292
87 3300013105 Ga0157369_10257252 Ga0157369_102572522 292
88 3300013296 Ga0157374_10240180 Ga0157374_102401802 292
89 3300013307 Ga0157372_10080650 Ga0157372_100806502 292
90 3300013307 Ga0157372_10104752 Ga0157372_101047523 292
91 3300014325 Ga0163163_10517724 Ga0163163_105177241 292
92 3300025909 Ga0207705_10012699 Ga0207705_100126994 292
93 3300025909 Ga0207705_10031606 Ga0207705_100316063 292
94 3300025912 Ga0207707_10073139 Ga0207707_100731393 292
95 3300025913 Ga0207695_10000020 Ga0207695_10000020582 292
96 3300025917 Ga0207660_10017967 Ga0207660_100179672 292
97 3300025917 Ga0207660_10152955 Ga0207660_101529552 292
98 3300025917 Ga0207660_10190868 Ga0207660_101908682 292
99 3300025917 Ga0207660_10198950 Ga0207660_101989502 292
100 3300025919 Ga0207657_10004524 Ga0207657_100045242 292
101 3300025919 Ga0207657_10092047 Ga0207657_100920472 292
102 3300025919 Ga0207657_10415786 Ga0207657_104157861 292
103 3300025921 Ga0207652_10000180 Ga0207652_1000018020 292
104 3300025921 Ga0207652_10071695 Ga0207652_100716952 292
105 3300025921 Ga0207652_10079471 Ga0207652_100794712 292
106 3300025921 Ga0207652_10134255 Ga0207652_101342552 292
107 3300025925 Ga0207650_10294671 Ga0207650_102946711 292
108 3300025932 Ga0207690_10143543 Ga0207690_101435432 292
109 3300025944 Ga0207661_10272860 Ga0207661_102728603 292
110 3300025944 Ga0207661_10503081 Ga0207661_105030812 292
111 3300025945 Ga0207679_10353398 Ga0207679_103533982 292
112 3300025949 Ga0207667_10103445 Ga0207667_101034451 292
113 3300025949 Ga0207667_10135796 Ga0207667_101357961 292
114 3300025949 Ga0207667_10216241 Ga0207667_102162412 292
115 3300025949 Ga0207667_10341249 Ga0207667_103412492 292
116 3300026041 Ga0207639_10067824 Ga0207639_100678243 292
117 3300026041 Ga0207639_10108725 Ga0207639_101087252 292
118 3300026041 Ga0207639_10312532 Ga0207639_103125322 292
119 3300026067 Ga0207678_10195141 Ga0207678_101951411 292
120 3300026089 Ga0207648_10186485 Ga0207648_101864852 292
121 3300026116 Ga0207674_10044546 Ga0207674_100445464 292
122 3300026142 Ga0207698_10231035 Ga0207698_102310351 292
123 3300026142 Ga0207698_10379312 Ga0207698_103793121 292
124 3300028556 Ga0265337_1002475 Ga0265337_10024757 292
125 3300028563 Ga0265319_1000466 Ga0265319_100046629 292
126 3300028573 Ga0265334_10046076 Ga0265334_100460761 292
127 3300028654 Ga0265322_10045317 Ga0265322_100453171 292
128 3300028666 Ga0265336_10000223 Ga0265336_1000022345 292
129 3300028800 Ga0265338_10009469 Ga0265338_100094698 292
130 3300031235 Ga0265330_10008648 Ga0265330_100086482 292
131 3300031235 Ga0265330_10086832 Ga0265330_100868321 292
132 3300031238 Ga0265332_10001318 Ga0265332_100013183 292
133 3300031240 Ga0265320_10009204 Ga0265320_100092042 292
134 3300031241 Ga0265325_10022580 Ga0265325_100225804 292
135 3300031247 Ga0265340_10005434 Ga0265340_100054341 292
136 3300031249 Ga0265339_10011033 Ga0265339_100110335 292
137 3300031249 Ga0265339_10052127 Ga0265339_100521271 292
138 3300031251 Ga0265327_10173458 Ga0265327_101734581 292
139 3300031344 Ga0265316_10006071 Ga0265316_100060719 292
140 3300031344 Ga0265316_10055923 Ga0265316_100559231 292
141 3300031595 Ga0265313_10006655 Ga0265313_100066558 292
142 3300031712 Ga0265342_10041693 Ga0265342_100416931 292
143 3300037312 Ga0395899_0017229 Ga0395899_0017229_291_1214 292
144 3300037418 Ga0395900_0014096 Ga0395900_0014096_4737_5618 292
145 3300037418 Ga0395900_0312845 Ga0395900_0312845_435_1316 292
146 3300037466 Ga0395898_0006787 Ga0395898_0006787_5266_6189 292
147 3300037466 Ga0395898_0028408 Ga0395898_0028408_4570_5451 292
148 3300037466 Ga0395898_0286187 Ga0395898_0286187_451_1332 292
149 3300038443 Ga0395901_0023951 Ga0395901_0023951_2431_3354 292
150 3300038443 Ga0395901_0161156 Ga0395901_0161156_637_1518 292
151 3300046665 Ga0495661_0014316 Ga0495661_0014316_3491_4369 292
152 3300049571 Ga0501034_0101405 Ga0501034_0101405_1535_2416 292
153 3300003323 rootH1_10216871 rootH1_102168711 293
154 3300005327 Ga0070658_10071875 Ga0070658_100718754 293
155 3300005327 Ga0070658_10126032 Ga0070658_101260321 293
156 3300005335 Ga0070666_10000156 Ga0070666_1000015619 293
157 3300005336 Ga0070680_100012512 Ga0070680_1000125124 293
158 3300005338 Ga0068868_100022143 Ga0068868_1000221435 293
159 3300005364 Ga0070673_100488114 Ga0070673_1004881141 293
160 3300005367 Ga0070667_100057683 Ga0070667_1000576833 293
161 3300005367 Ga0070667_100138061 Ga0070667_1001380613 293
162 3300005466 Ga0070685_10034368 Ga0070685_100343686 293
163 3300005530 Ga0070679_100006523 Ga0070679_10000652312 293
164 3300005539 Ga0068853_100516166 Ga0068853_1005161661 293
165 3300005563 Ga0068855_100000043 Ga0068855_10000004338 293
166 3300005563 Ga0068855_100000097 Ga0068855_10000009718 293
167 3300005614 Ga0068856_100000824 Ga0068856_10000082436 293
168 3300005616 Ga0068852_100027329 Ga0068852_1000273294 293
169 3300005616 Ga0068852_100051546 Ga0068852_1000515463 293
170 3300005616 Ga0068852_100091236 Ga0068852_1000912362 293
171 3300005617 Ga0068859_100000024 Ga0068859_100000024165 293
172 3300005617 Ga0068859_100154765 Ga0068859_1001547653 293
173 3300005841 Ga0068863_100011308 Ga0068863_1000113083 293
174 3300005841 Ga0068863_100039424 Ga0068863_1000394246 293
175 3300005842 Ga0068858_100012733 Ga0068858_1000127337 293
176 3300005843 Ga0068860_100004190 Ga0068860_1000041907 293
177 3300006195 Ga0075366_10010291 Ga0075366_100102914 293
178 3300006358 Ga0068871_100226900 Ga0068871_1002269003 293
179 3300006931 Ga0097620_100000024 Ga0097620_100000024165 293
180 3300006931 Ga0097620_100154775 Ga0097620_1001547753 293
181 3300009093 Ga0105240_10001228 Ga0105240_1000122812 293
182 3300009093 Ga0105240_10039490 Ga0105240_100394903 293
183 3300009098 Ga0105245_10120534 Ga0105245_101205342 293
184 3300009148 Ga0105243_10194573 Ga0105243_101945732 293
185 3300009174 Ga0105241_10000856 Ga0105241_1000085613 293
186 3300009174 Ga0105241_10001790 Ga0105241_100017904 293
187 3300009545 Ga0105237_10042402 Ga0105237_100424022 293
188 3300009551 Ga0105238_10180252 Ga0105238_101802522 293
189 3300010375 Ga0105239_10042662 Ga0105239_100426624 293
190 3300010375 Ga0105239_10097451 Ga0105239_100974511 293
191 3300011119 Ga0105246_10105966 Ga0105246_101059662 293
192 3300013102 Ga0157371_10004024 Ga0157371_100040248 293
193 3300013105 Ga0157369_10001079 Ga0157369_1000107930 293
194 3300013296 Ga0157374_10051930 Ga0157374_100519302 293
195 3300013297 Ga0157378_10003337 Ga0157378_100033374 293
196 3300013297 Ga0157378_10047046 Ga0157378_100470463 293
197 3300013306 Ga0163162_10001970 Ga0163162_1000197014 293
198 3300013306 Ga0163162_10004069 Ga0163162_100040697 293
199 3300013307 Ga0157372_10000039 Ga0157372_10000039146 293
200 3300013307 Ga0157372_10017207 Ga0157372_100172072 293
201 3300014325 Ga0163163_10371630 Ga0163163_103716301 293
202 3300014968 Ga0157379_10044767 Ga0157379_100447676 293
203 3300014968 Ga0157379_10495445 Ga0157379_104954451 293
204 3300025321 Ga0207656_10019734 Ga0207656_100197341 293
205 3300025903 Ga0207680_10001921 Ga0207680_100019213 293
206 3300025909 Ga0207705_10081537 Ga0207705_100815372 293
207 3300025911 Ga0207654_10001496 Ga0207654_100014969 293
208 3300025913 Ga0207695_10001743 Ga0207695_100017434 293
209 3300025913 Ga0207695_10117228 Ga0207695_101172283 293
210 3300025914 Ga0207671_10008266 Ga0207671_100082662 293
211 3300025921 Ga0207652_10002224 Ga0207652_1000222416 293
212 3300025925 Ga0207650_10189822 Ga0207650_101898222 293
213 3300025931 Ga0207644_10165051 Ga0207644_101650512 293
214 3300025942 Ga0207689_10001965 Ga0207689_100019652 293
215 3300025949 Ga0207667_10000015 Ga0207667_1000001537 293
216 3300025949 Ga0207667_10000190 Ga0207667_1000019018 293
217 3300025986 Ga0207658_10154568 Ga0207658_101545681 293
218 3300026023 Ga0207677_10105712 Ga0207677_101057122 293
219 3300026023 Ga0207677_10124979 Ga0207677_101249794 293
220 3300026023 Ga0207677_10232524 Ga0207677_102325243 293
221 3300026035 Ga0207703_10000764 Ga0207703_1000076425 293
222 3300026078 Ga0207702_10000165 Ga0207702_1000016512 293
223 3300026088 Ga0207641_10000087 Ga0207641_1000008787 293
224 3300026088 Ga0207641_10007550 Ga0207641_100075505 293
225 3300026095 Ga0207676_10018217 Ga0207676_100182174 293
226 3300026142 Ga0207698_10030195 Ga0207698_100301953 293
227 3300028381 Ga0268264_10004777 Ga0268264_100047777 293
228 3300028794 Ga0307515_10000118 Ga0307515_10000118143 293
229 3300028800 Ga0265338_10126104 Ga0265338_101261041 293
230 3300031251 Ga0265327_10012995 Ga0265327_100129952 293
231 3300037312 Ga0395899_0000325 Ga0395899_0000325_75_959 293
232 3300044656 Ga0466969_0004818 Ga0466969_0004818_4833_5717 293
233 3300044684 Ga0466966_0131152 Ga0466966_0131152_466_1350 293
234 3300044693 Ga0466961_0009665 Ga0466961_0009665_2680_3564 293
235 3300045049 Ga0466959_0005764 Ga0466959_0005764_3534_4418 293
236 3300047320 Ga0495672_0016866 Ga0495672_0016866_1018_1914 293
237 3300003320 rootH2_10016314 rootH2_100163142 294
238 3300005614 Ga0068856_100080740 Ga0068856_1000807403 294
239 3300025261 Ga0209233_1018957 Ga0209233_10189572 294
240 3300026078 Ga0207702_10108746 Ga0207702_101087463 294
241 3300037312 Ga0395899_0000002 Ga0395899_0000002_440202_441086 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

41

312

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9125 3 294
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.8941 3 294
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.8655 6 293
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8588 3 293
3wbx-assembly2.cif.gz_B crystal structure of gox0644 at apoform 0.8582 6 293
ID Description Score Start End Superfamily
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9435 19 293 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9293 17 293 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8938 17 293 3.20.20.100
3wbyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.868 6 293 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8588 3 293 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A5B8A449-F1-model_v4 Aldo/keto reductase 0.9788 6 294 GO:0004033
GO:0005737
AF-A0A5B8A449-F1-model_v4 Aldo/keto reductase 0.9721 6 294 GO:0004033
GO:0005737
AF-A0A7K1T1A8-F1-model_v4 Aldo/keto reductase 0.9673 1 214 GO:0004033
GO:0005737
AF-A0A561J1U4-F1-model_v4 deleted 0.9636 7 294
AF-A0A7Y0FLQ6-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9625 102 294 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
92.18 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map