F353317

General Info

Members Datasets Scaffolds Average Seq Length
240 148 480 162

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0808099|Ga0530510_0808099_29_538
Length 151
Sequence MRESRKASTKIGALEDVAQRVAEARARGRTVALANGCFDVLHVGHVRYLAGARAEADVLVVGVNGDASVRRLKGPGRPLLPEDDRAAMVAALRSVDHVVHCKGTDFVPDTVPERDVVRSYGGRVAIVGDPKDHDTRRLIERVRSARPRTDR

Samples

Sample ID Description Type Environment
1 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
118 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
119 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
120 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
121 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
129 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
130 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
131 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
132 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
133 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
134 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
135 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
139 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
140 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
141 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.42
Rhizosphere 97.5
Stem 0
Stem Tuber 0
Unclassified 32.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0530510_0808099 3300061734 Bacteria 716
2 rootL2_10093202 3300003322 Bacteria 4764
3 Ga0065704_10113023 3300005289 Bacteria 1921
4 Ga0065704_10342369 3300005289 Unclassified 821
5 Ga0065712_10033664 3300005290 Bacteria 1467
6 Ga0065715_10223340 3300005293 Bacteria 1263
7 Ga0070690_100383367 3300005330 Bacteria 1028
8 Ga0070670_100008536 3300005331 Bacteria 8739
9 Ga0070677_10002602 3300005333 Bacteria 5774
10 Ga0070680_100009754 3300005336 Bacteria 7391
11 Ga0070689_100076082 3300005340 Bacteria 2629
12 Ga0070689_101157877 3300005340 Bacteria 693
13 Ga0070661_100415223 3300005344 Bacteria 1066
14 Ga0070669_100003156 3300005353 Bacteria 11851
15 Ga0070675_100627493 3300005354 Unclassified 976
16 Ga0070675_100812583 3300005354 Bacteria 855
17 Ga0070675_100886824 3300005354 Bacteria 817
18 Ga0070674_100002234 3300005356 Bacteria 10654
19 Ga0070673_100128280 3300005364 Unclassified 2125
20 Ga0070673_100710177 3300005364 Bacteria 924
21 Ga0070688_100231248 3300005365 Bacteria 1308
22 Ga0070659_100002545 3300005366 Bacteria 12966
23 Ga0070705_100110351 3300005440 Bacteria 1756
24 Ga0070705_100316355 3300005440 Unclassified 1125
25 Ga0070705_101285054 3300005440 Bacteria 606
26 Ga0070700_100201732 3300005441 Bacteria 1397
27 Ga0070694_100477545 3300005444 Bacteria 989
28 Ga0070694_100802219 3300005444 Unclassified 772
29 Ga0070708_100320709 3300005445 Unclassified 1459
30 Ga0070708_101067499 3300005445 Unclassified 757
31 Ga0070678_100044059 3300005456 Bacteria 3184
32 Ga0070681_10002170 3300005458 Bacteria 17858
33 Ga0068867_100389919 3300005459 Bacteria 1172
34 Ga0070706_100005778 3300005467 Bacteria 11753
35 Ga0070706_100013057 3300005467 Bacteria 7687
36 Ga0070706_100085578 3300005467 Unclassified 2921
37 Ga0070706_100335827 3300005467 Unclassified 1409
38 Ga0070707_100006719 3300005468 Bacteria 10660
39 Ga0070707_100012747 3300005468 Bacteria 7849
40 Ga0070707_100049308 3300005468 Bacteria 4036
41 Ga0070707_100052899 3300005468 Unclassified 3893
42 Ga0070707_100301622 3300005468 Bacteria 1557
43 Ga0070698_100002252 3300005471 Bacteria 21345
44 Ga0070698_100115386 3300005471 Unclassified 2650
45 Ga0070698_100148891 3300005471 Bacteria 2289
46 Ga0070698_100314116 3300005471 Bacteria 1498
47 Ga0070699_100001087 3300005518 Bacteria 25323
48 Ga0070699_100040352 3300005518 Unclassified 4041
49 Ga0070699_100092144 3300005518 Unclassified 2650
50 Ga0070699_100117902 3300005518 Unclassified 2333
51 Ga0070699_100493236 3300005518 Bacteria 1112
52 Ga0070699_100512943 3300005518 Bacteria 1090
53 Ga0070679_100032900 3300005530 Bacteria 5132
54 Ga0070697_100000292 3300005536 Bacteria 40131
55 Ga0070697_100000395 3300005536 Bacteria 33783
56 Ga0070697_100022993 3300005536 Unclassified 4957
57 Ga0070697_100039136 3300005536 Unclassified 3833
58 Ga0070697_100042633 3300005536 Unclassified 3672
59 Ga0070697_100043126 3300005536 Bacteria 3652
60 Ga0070697_100089244 3300005536 Unclassified 2547
61 Ga0068853_100072955 3300005539 Unclassified 2992
62 Ga0070686_100230857 3300005544 Bacteria 1342
63 Ga0070695_100035396 3300005545 Unclassified 3137
64 Ga0070695_100834755 3300005545 Unclassified 740
65 Ga0070696_100051982 3300005546 Unclassified 2850
66 Ga0070696_100340552 3300005546 Bacteria 1159
67 Ga0070693_100066871 3300005547 Unclassified 2104
68 Ga0070693_100615703 3300005547 Bacteria 786
69 Ga0070704_100187750 3300005549 Bacteria 1659
70 Ga0070704_100755754 3300005549 Unclassified 866
71 Ga0070704_101310153 3300005549 Bacteria 663
72 Ga0068855_101064266 3300005563 Bacteria 847
73 Ga0068855_102019315 3300005563 Bacteria 582
74 Ga0070664_100001677 3300005564 Bacteria 17745
75 Ga0068857_100006374 3300005577 Bacteria 10108
76 Ga0068857_100637567 3300005577 Unclassified 1009
77 Ga0068859_100435508 3300005617 Bacteria 1407
78 Ga0068859_100648862 3300005617 Bacteria 1147
79 Ga0068859_101038841 3300005617 Bacteria 900
80 Ga0068864_100519009 3300005618 Bacteria 1148
81 Ga0068861_100010964 3300005719 Bacteria 6298
82 Ga0068861_100398649 3300005719 Bacteria 1220
83 Ga0068863_100358358 3300005841 Unclassified 1421
84 Ga0068863_100994932 3300005841 Bacteria 841
85 Ga0068862_100110852 3300005844 Bacteria 2408
86 Ga0068862_101688280 3300005844 Unclassified 641
87 Ga0081539_10001446 3300005985 Bacteria 40634
88 Ga0081539_10163492 3300005985 Bacteria 1059
89 Ga0070716_100116446 3300006173 Bacteria 1665
90 Ga0075428_100313865 3300006844 Bacteria 1685
91 Ga0075433_10008155 3300006852 Bacteria 8341
92 Ga0075433_10225489 3300006852 Unclassified 1664
93 Ga0075433_10542955 3300006852 Unclassified 1022
94 Ga0075434_100355171 3300006871 Unclassified 1487
95 Ga0075429_100148774 3300006880 Bacteria 2050
96 Ga0097620_100435528 3300006931 Bacteria 1407
97 Ga0097620_100648871 3300006931 Bacteria 1147
98 Ga0097620_101038850 3300006931 Bacteria 900
99 Ga0075435_100140026 3300007076 Bacteria 2029
100 Ga0105240_10668946 3300009093 Bacteria 1136
101 Ga0111539_10029608 3300009094 Bacteria 6666
102 Ga0111539_10121231 3300009094 Bacteria 3064
103 Ga0105245_10923179 3300009098 Unclassified 915
104 Ga0105243_10503531 3300009148 Unclassified 1148
105 Ga0105243_10702638 3300009148 Unclassified 986
106 Ga0105241_10008179 3300009174 Bacteria 7700
107 Ga0105241_10052541 3300009174 Bacteria 3112
108 Ga0105242_10657583 3300009176 Bacteria 1020
109 Ga0105248_10287352 3300009177 Bacteria 1852
110 Ga0105249_10010664 3300009553 Bacteria 8073
111 Ga0105249_11252978 3300009553 Bacteria 813
112 Ga0105249_12115332 3300009553 Bacteria 636
113 Ga0105239_10416332 3300010375 Unclassified 1522
114 Ga0105246_10186406 3300011119 Bacteria 1602
115 Ga0157373_10028017 3300013100 Unclassified 4064
116 Ga0157373_10270947 3300013100 Bacteria 1202
117 Ga0157374_10212063 3300013296 Unclassified 1899
118 Ga0157378_12003165 3300013297 Unclassified 629
119 Ga0157372_10085996 3300013307 Unclassified 3567
120 Ga0163163_10001143 3300014325 Bacteria 22584
121 Ga0163163_10092367 3300014325 Bacteria 3042
122 Ga0163163_10387631 3300014325 Bacteria 1455
123 Ga0163163_10431630 3300014325 Bacteria 1377
124 Ga0157380_10095648 3300014326 Bacteria 2461
125 Ga0213876_10000159 3300021384 Bacteria 70556
126 Ga0213876_10000600 3300021384 Bacteria 26721
127 Ga0207684_10005182 3300025910 Bacteria 12132
128 Ga0207684_10014654 3300025910 Bacteria 6754
129 Ga0207684_10021743 3300025910 Bacteria 5477
130 Ga0207654_10008321 3300025911 Bacteria 5240
131 Ga0207654_10452221 3300025911 Bacteria 901
132 Ga0207707_10071056 3300025912 Bacteria 3033
133 Ga0207660_10120378 3300025917 Bacteria 1987
134 Ga0207652_10024597 3300025921 Unclassified 4997
135 Ga0207646_10003709 3300025922 Bacteria 17042
136 Ga0207646_10008004 3300025922 Bacteria 10657
137 Ga0207646_10096506 3300025922 Bacteria 2649
138 Ga0207646_10134129 3300025922 Bacteria 2229
139 Ga0207646_10163752 3300025922 Unclassified 2007
140 Ga0207681_10000306 3300025923 Bacteria 36019
141 Ga0207650_10011334 3300025925 Bacteria 6135
142 Ga0207687_11186958 3300025927 Unclassified 656
143 Ga0207690_10119249 3300025932 Bacteria 1913
144 Ga0207709_10384864 3300025935 Bacteria 1068
145 Ga0207709_10622688 3300025935 Unclassified 857
146 Ga0207669_10000715 3300025937 Bacteria 14348
147 Ga0207665_10180536 3300025939 Bacteria 1528
148 Ga0207689_10056133 3300025942 Bacteria 3240
149 Ga0207679_10092560 3300025945 Unclassified 2342
150 Ga0207667_10947197 3300025949 Bacteria 851
151 Ga0207667_11204511 3300025949 Bacteria 737
152 Ga0207667_11331056 3300025949 Unclassified 694
153 Ga0207651_10030825 3300025960 Bacteria 3420
154 Ga0207651_10306838 3300025960 Bacteria 1322
155 Ga0207651_10522376 3300025960 Bacteria 1029
156 Ga0207651_11286970 3300025960 Unclassified 657
157 Ga0207712_10267941 3300025961 Bacteria 1388
158 Ga0207712_10697417 3300025961 Bacteria 886
159 Ga0207639_10071951 3300026041 Unclassified 2706
160 Ga0207708_10766647 3300026075 Bacteria 829
161 Ga0207641_10068022 3300026088 Unclassified 3053
162 Ga0207676_10089911 3300026095 Bacteria 2518
163 Ga0207676_10711852 3300026095 Bacteria 974
164 Ga0207676_11050467 3300026095 Bacteria 804
165 Ga0207674_10000198 3300026116 Bacteria 74606
166 Ga0207674_10513438 3300026116 Unclassified 1157
167 Ga0207675_100027577 3300026118 Bacteria 5290
168 Ga0207675_100156460 3300026118 Bacteria 2172
169 Ga0268265_10076173 3300028380 Bacteria 2631
170 Ga0268265_10586982 3300028380 Unclassified 1063
171 Ga0268264_10421820 3300028381 Bacteria 1287
172 Ga0268264_10608444 3300028381 Bacteria 1078
173 Ga0268264_11000086 3300028381 Unclassified 843
174 Ga0307405_10161269 3300031731 Bacteria 1589
175 Ga0307413_10090595 3300031824 Bacteria 1990
176 Ga0307413_10847469 3300031824 Unclassified 772
177 Ga0307410_10110880 3300031852 Bacteria 1985
178 Ga0307410_10278895 3300031852 Bacteria 1311
179 Ga0307410_10472729 3300031852 Bacteria 1027
180 Ga0307410_10582174 3300031852 Unclassified 931
181 Ga0307406_10145805 3300031901 Bacteria 1682
182 Ga0307407_10412750 3300031903 Unclassified 971
183 Ga0307409_100145716 3300031995 Bacteria 2048
184 Ga0307409_100690910 3300031995 Bacteria 1019
185 Ga0307416_100459807 3300032002 Bacteria 1327
186 Ga0307416_100789381 3300032002 Unclassified 1045
187 Ga0307416_102135469 3300032002 Bacteria 662
188 Ga0307416_102490337 3300032002 Unclassified 616
189 Ga0307414_10111963 3300032004 Unclassified 2080
190 Ga0307414_10472081 3300032004 Unclassified 1105
191 Ga0307411_10184884 3300032005 Unclassified 1585
192 Ga0307411_10196116 3300032005 Bacteria 1546
193 Ga0307415_100106314 3300032126 Unclassified 2071
194 Ga0373931_0348881 3300035691 Unclassified 926
195 Ga0395900_1413499 3300037418 Unclassified 609
196 Ga0436365_0067166 3300039437 Bacteria 157821
197 Ga0436365_0915988 3300039437 Bacteria 51495
198 Ga0439435_0142864 3300042436 Bacteria 763
199 Ga0495610_0197525 3300046512 Unclassified 826
200 Ga0495663_0000068 3300046525 Bacteria 47393
201 Ga0495598_0003125 3300046537 Bacteria 3490
202 Ga0495621_0000355 3300046539 Bacteria 11151
203 Ga0495621_0021564 3300046539 Bacteria 2124
204 Ga0495668_0263103 3300046616 Bacteria 944
205 Ga0495677_0207722 3300047445 Unclassified 762
206 Ga0496104_0112594 3300048907 Unclassified 2610
207 Ga0501290_033463 3300049513 Unclassified 745
208 Ga0501291_013318 3300049514 Bacteria 1215
209 Ga0501292_004599 3300049515 Unclassified 1894
210 Ga0501298_009928 3300049521 Bacteria 1627
211 Ga0501299_020014 3300049522 Bacteria 1216
212 Ga0501038_0001415 3300049574 Bacteria 21957
213 Ga0501042_0327159 3300049578 Bacteria 1108
214 Ga0501048_0278276 3300049582 Bacteria 1190
215 Ga0501071_1466469 3300049587 Bacteria 527
216 Ga0501076_0054884 3300049592 Bacteria 3158
217 Ga0501077_0518068 3300049593 Bacteria 765
218 Ga0501208_029760 3300049655 Unclassified 956
219 Ga0501216_008045 3300049660 Unclassified 1652
220 Ga0501233_065593 3300049668 Unclassified 910
221 Ga0501252_027666 3300049682 Unclassified 772
222 Ga0501260_003966 3300049689 Bacteria 1351
223 Ga0501261_005809 3300049690 Bacteria 1561
224 Ga0501225_0039392 3300049705 Bacteria 1302
225 Ga0501234_025488 3300049707 Unclassified 949
226 Ga0501079_0136897 3300049741 Bacteria 1907
227 Ga0501081_0032702 3300049743 Bacteria 3530
228 Ga0501265_032874 3300049762 Unclassified 754
229 Ga0501273_062817 3300049770 Unclassified 589
230 Ga0501283_000597 3300049779 Unclassified 4746
231 Ga0501212_088251 3300049851 Unclassified 569
232 nmdc:mga09592_624086_c1 3300050508 Bacteria 922
233 nmdc:mga06r32_103160_c1 3300050510 Bacteria 2800
234 nmdc:mga08y16_100600_c1 3300050511 Bacteria 3010
235 nmdc:mga08y16_299340_c1 3300050511 Bacteria 1658
236 nmdc:mga0rr50_956312_c1 3300050513 Unclassified 730
237 nmdc:mga0a205_2078_c1 3300050515 Bacteria 17510
238 nmdc:mga0a205_609123_c1 3300050515 Unclassified 945
239 Ga0501084_0137001 3300054114 Bacteria 2061
240 Ga0501082_0043083 3300060353 Bacteria 3891
241 Ga0530510_0808099
242 rootL2_10093202
243 Ga0065704_10113023
244 Ga0065704_10342369
245 Ga0065712_10033664
246 Ga0065715_10223340
247 Ga0070690_100383367
248 Ga0070670_100008536
249 Ga0070677_10002602
250 Ga0070680_100009754
251 Ga0070689_100076082
252 Ga0070689_101157877
253 Ga0070661_100415223
254 Ga0070669_100003156
255 Ga0070675_100627493
256 Ga0070675_100812583
257 Ga0070675_100886824
258 Ga0070674_100002234
259 Ga0070673_100128280
260 Ga0070673_100710177
261 Ga0070688_100231248
262 Ga0070659_100002545
263 Ga0070705_100110351
264 Ga0070705_100316355
265 Ga0070705_101285054
266 Ga0070700_100201732
267 Ga0070694_100477545
268 Ga0070694_100802219
269 Ga0070708_100320709
270 Ga0070708_101067499
271 Ga0070678_100044059
272 Ga0070681_10002170
273 Ga0068867_100389919
274 Ga0070706_100005778
275 Ga0070706_100013057
276 Ga0070706_100085578
277 Ga0070706_100335827
278 Ga0070707_100006719
279 Ga0070707_100012747
280 Ga0070707_100049308
281 Ga0070707_100052899
282 Ga0070707_100301622
283 Ga0070698_100002252
284 Ga0070698_100115386
285 Ga0070698_100148891
286 Ga0070698_100314116
287 Ga0070699_100001087
288 Ga0070699_100040352
289 Ga0070699_100092144
290 Ga0070699_100117902
291 Ga0070699_100493236
292 Ga0070699_100512943
293 Ga0070679_100032900
294 Ga0070697_100000292
295 Ga0070697_100000395
296 Ga0070697_100022993
297 Ga0070697_100039136
298 Ga0070697_100042633
299 Ga0070697_100043126
300 Ga0070697_100089244
301 Ga0068853_100072955
302 Ga0070686_100230857
303 Ga0070695_100035396
304 Ga0070695_100834755
305 Ga0070696_100051982
306 Ga0070696_100340552
307 Ga0070693_100066871
308 Ga0070693_100615703
309 Ga0070704_100187750
310 Ga0070704_100755754
311 Ga0070704_101310153
312 Ga0068855_101064266
313 Ga0068855_102019315
314 Ga0070664_100001677
315 Ga0068857_100006374
316 Ga0068857_100637567
317 Ga0068859_100435508
318 Ga0068859_100648862
319 Ga0068859_101038841
320 Ga0068864_100519009
321 Ga0068861_100010964
322 Ga0068861_100398649
323 Ga0068863_100358358
324 Ga0068863_100994932
325 Ga0068862_100110852
326 Ga0068862_101688280
327 Ga0081539_10001446
328 Ga0081539_10163492
329 Ga0070716_100116446
330 Ga0075428_100313865
331 Ga0075433_10008155
332 Ga0075433_10225489
333 Ga0075433_10542955
334 Ga0075434_100355171
335 Ga0075429_100148774
336 Ga0097620_100435528
337 Ga0097620_100648871
338 Ga0097620_101038850
339 Ga0075435_100140026
340 Ga0105240_10668946
341 Ga0111539_10029608
342 Ga0111539_10121231
343 Ga0105245_10923179
344 Ga0105243_10503531
345 Ga0105243_10702638
346 Ga0105241_10008179
347 Ga0105241_10052541
348 Ga0105242_10657583
349 Ga0105248_10287352
350 Ga0105249_10010664
351 Ga0105249_11252978
352 Ga0105249_12115332
353 Ga0105239_10416332
354 Ga0105246_10186406
355 Ga0157373_10028017
356 Ga0157373_10270947
357 Ga0157374_10212063
358 Ga0157378_12003165
359 Ga0157372_10085996
360 Ga0163163_10001143
361 Ga0163163_10092367
362 Ga0163163_10387631
363 Ga0163163_10431630
364 Ga0157380_10095648
365 Ga0213876_10000159
366 Ga0213876_10000600
367 Ga0207684_10005182
368 Ga0207684_10014654
369 Ga0207684_10021743
370 Ga0207654_10008321
371 Ga0207654_10452221
372 Ga0207707_10071056
373 Ga0207660_10120378
374 Ga0207652_10024597
375 Ga0207646_10003709
376 Ga0207646_10008004
377 Ga0207646_10096506
378 Ga0207646_10134129
379 Ga0207646_10163752
380 Ga0207681_10000306
381 Ga0207650_10011334
382 Ga0207687_11186958
383 Ga0207690_10119249
384 Ga0207709_10384864
385 Ga0207709_10622688
386 Ga0207669_10000715
387 Ga0207665_10180536
388 Ga0207689_10056133
389 Ga0207679_10092560
390 Ga0207667_10947197
391 Ga0207667_11204511
392 Ga0207667_11331056
393 Ga0207651_10030825
394 Ga0207651_10306838
395 Ga0207651_10522376
396 Ga0207651_11286970
397 Ga0207712_10267941
398 Ga0207712_10697417
399 Ga0207639_10071951
400 Ga0207708_10766647
401 Ga0207641_10068022
402 Ga0207676_10089911
403 Ga0207676_10711852
404 Ga0207676_11050467
405 Ga0207674_10000198
406 Ga0207674_10513438
407 Ga0207675_100027577
408 Ga0207675_100156460
409 Ga0268265_10076173
410 Ga0268265_10586982
411 Ga0268264_10421820
412 Ga0268264_10608444
413 Ga0268264_11000086
414 Ga0307405_10161269
415 Ga0307413_10090595
416 Ga0307413_10847469
417 Ga0307410_10110880
418 Ga0307410_10278895
419 Ga0307410_10472729
420 Ga0307410_10582174
421 Ga0307406_10145805
422 Ga0307407_10412750
423 Ga0307409_100145716
424 Ga0307409_100690910
425 Ga0307416_100459807
426 Ga0307416_100789381
427 Ga0307416_102135469
428 Ga0307416_102490337
429 Ga0307414_10111963
430 Ga0307414_10472081
431 Ga0307411_10184884
432 Ga0307411_10196116
433 Ga0307415_100106314
434 Ga0373931_0348881
435 Ga0395900_1413499
436 Ga0436365_0067166
437 Ga0436365_0915988
438 Ga0439435_0142864
439 Ga0495610_0197525
440 Ga0495663_0000068
441 Ga0495598_0003125
442 Ga0495621_0000355
443 Ga0495621_0021564
444 Ga0495668_0263103
445 Ga0495677_0207722
446 Ga0496104_0112594
447 Ga0501290_033463
448 Ga0501291_013318
449 Ga0501292_004599
450 Ga0501298_009928
451 Ga0501299_020014
452 Ga0501038_0001415
453 Ga0501042_0327159
454 Ga0501048_0278276
455 Ga0501071_1466469
456 Ga0501076_0054884
457 Ga0501077_0518068
458 Ga0501208_029760
459 Ga0501216_008045
460 Ga0501233_065593
461 Ga0501252_027666
462 Ga0501260_003966
463 Ga0501261_005809
464 Ga0501225_0039392
465 Ga0501234_025488
466 Ga0501079_0136897
467 Ga0501081_0032702
468 Ga0501265_032874
469 Ga0501273_062817
470 Ga0501283_000597
471 Ga0501212_088251
472 nmdc:mga09592_624086_c1
473 nmdc:mga06r32_103160_c1
474 nmdc:mga08y16_100600_c1
475 nmdc:mga08y16_299340_c1
476 nmdc:mga0rr50_956312_c1
477 nmdc:mga0a205_2078_c1
478 nmdc:mga0a205_609123_c1
479 Ga0501084_0137001
480 Ga0501082_0043083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

33

148

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9166 10 143
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.8488 10 143
2b7l-assembly2.cif.gz_D crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus 0.8409 29 143
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8255 10 160
3glv-assembly1.cif.gz_B crystal structure of the lipopolysaccharide core biosynthesis protein from thermoplasma volcanium gss1 0.8237 27 143
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8798 10 160 3.40.50.620
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8422 10 160 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8409 29 143 3.40.50.620
3glvB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8237 27 143 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8076 29 143 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4U3ML66-F1-model_v4 Bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase 0.976 9 144 GO:0005829
GO:0009244
GO:0033785
GO:0033786
AF-A0A7C9JE00-F1-model_v4 Adenylyltransferase/cytidyltransferase family protein 0.9724 5 144 GO:0005829
GO:0009244
GO:0033785
GO:0033786
AF-B9TMC6-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9701 10 140 GO:0005524
GO:0005829
GO:0009058
GO:0016773
GO:0033785
GO:0033786
AF-A0A819CBL1-F1-model_v4 Uncharacterized protein 0.9695 10 143 GO:0003824
GO:0006796
GO:0009058
AF-A0A660UEA3-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase 0.9673 9 136 GO:0009058
GO:0016779

Map