F353134

General Info

Members Datasets Scaffolds Average Seq Length
240 179 480 141

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0259610|Ga0466967_0259610_776_1294
Length 172
Sequence MRISVAADELTGVAQPLVLELRERGHEPILHGAFVEDERPDWAWASELAARDVAEGRAEQAIVLCWTGTGASMAANKVPGIRAALCTDAKTAEGARRWNGANVLALSLRRTAVAELAGILDAWFSEEVSEDSQDVENIAHLTEIETGGRPQPAAEAKPKAARQSRAKRAAKS

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
108 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
109 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
110 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
176 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
179 2867475112 Streptomyces sp. TM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.5
Nodule 0
Rhizoplane 12.08
Rhizosphere 73.75
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0259610 3300045976 Bacteria 1662
2 JGI25406J46586_10004712 3300003203 Bacteria 6344
3 JGI25407J50210_10079055 3300003373 Bacteria 818
4 Ga0070676_10648441 3300005328 Bacteria 766
5 Ga0070683_100004044 3300005329 Bacteria 12013
6 Ga0070680_100026769 3300005336 Bacteria 4613
7 Ga0070682_101528478 3300005337 Bacteria 575
8 Ga0070691_10021594 3300005341 Bacteria 2979
9 Ga0070661_100419887 3300005344 Bacteria 1060
10 Ga0070661_101010931 3300005344 Bacteria 690
11 Ga0070669_100308807 3300005353 Bacteria 1274
12 Ga0070673_100517608 3300005364 Bacteria 1081
13 Ga0070709_10294917 3300005434 Bacteria 1183
14 Ga0070713_100389949 3300005436 Bacteria 1299
15 Ga0070711_100224215 3300005439 Bacteria 1463
16 Ga0070705_100311691 3300005440 Bacteria 1132
17 Ga0070694_100293681 3300005444 Bacteria 1243
18 Ga0070708_100032354 3300005445 Bacteria 4536
19 Ga0070663_100171557 3300005455 Bacteria 1677
20 Ga0070678_100488616 3300005456 Bacteria 1084
21 Ga0070681_10073633 3300005458 Bacteria 3378
22 Ga0070706_100025725 3300005467 Bacteria 5416
23 Ga0070706_100309340 3300005467 Bacteria 1474
24 Ga0070707_100102235 3300005468 Bacteria 2777
25 Ga0070698_100112508 3300005471 Bacteria 2687
26 Ga0070679_100013472 3300005530 Bacteria 7830
27 Ga0070684_100000705 3300005535 Bacteria 23075
28 Ga0070684_100098365 3300005535 Bacteria 2610
29 Ga0068853_101041805 3300005539 Bacteria 788
30 Ga0070693_100149509 3300005547 Bacteria 1478
31 Ga0070665_100623816 3300005548 Bacteria 1091
32 Ga0068857_100052679 3300005577 Bacteria 3610
33 Ga0068856_100021465 3300005614 Bacteria 6276
34 Ga0068856_101733414 3300005614 Bacteria 637
35 Ga0068864_100079328 3300005618 Bacteria 2874
36 Ga0068861_100470781 3300005719 Bacteria 1130
37 Ga0068863_100549237 3300005841 Bacteria 1140
38 Ga0068862_100011469 3300005844 Bacteria 7316
39 Ga0081455_10017404 3300005937 Bacteria 6894
40 Ga0081538_10005190 3300005981 Bacteria 11787
41 Ga0081539_10000661 3300005985 Bacteria 69277
42 Ga0070717_11191781 3300006028 Bacteria 693
43 Ga0075365_10038110 3300006038 Bacteria 3123
44 Ga0075365_10764989 3300006038 Bacteria 682
45 Ga0075365_11040013 3300006038 Bacteria 577
46 Ga0075363_100003932 3300006048 Bacteria 6412
47 Ga0075363_100211875 3300006048 Bacteria 1109
48 Ga0075364_10248364 3300006051 Bacteria 1209
49 Ga0070715_10141184 3300006163 Bacteria 1170
50 Ga0075367_10032976 3300006178 Bacteria 2983
51 Ga0075367_10112514 3300006178 Bacteria 1672
52 Ga0068871_100296083 3300006358 Bacteria 1419
53 Ga0075428_100337157 3300006844 Bacteria 1619
54 Ga0075430_100006138 3300006846 Bacteria 10121
55 Ga0075430_100165003 3300006846 Bacteria 1843
56 Ga0075430_100451851 3300006846 Bacteria 1060
57 Ga0075431_100098468 3300006847 Bacteria 3019
58 Ga0075431_100211156 3300006847 Bacteria 1983
59 Ga0075431_100825466 3300006847 Bacteria 899
60 Ga0075431_101546545 3300006847 Bacteria 621
61 Ga0075433_10186367 3300006852 Bacteria 1846
62 Ga0075433_10456661 3300006852 Bacteria 1126
63 Ga0075434_100100562 3300006871 Bacteria 2897
64 Ga0075429_100036138 3300006880 Bacteria 4295
65 Ga0075429_100115652 3300006880 Bacteria 2345
66 Ga0075429_100900438 3300006880 Bacteria 774
67 Ga0075436_100006675 3300006914 Bacteria 7903
68 Ga0075436_100581105 3300006914 Bacteria 824
69 Ga0075435_100128139 3300007076 Bacteria 2122
70 Ga0105251_10184229 3300009011 Bacteria 940
71 Ga0111539_10088751 3300009094 Bacteria 3633
72 Ga0111539_10626968 3300009094 Bacteria 1252
73 Ga0111539_11529056 3300009094 Bacteria 774
74 Ga0105245_10012796 3300009098 Bacteria 7310
75 Ga0105245_10560781 3300009098 Bacteria 1165
76 Ga0114129_10283795 3300009147 Bacteria 2212
77 Ga0114129_10510669 3300009147 Bacteria 1568
78 Ga0114129_10714761 3300009147 Bacteria 1286
79 Ga0114129_11759198 3300009147 Bacteria 755
80 Ga0105243_10361081 3300009148 Bacteria 1337
81 Ga0105242_10294332 3300009176 Bacteria 1479
82 Ga0105242_11552781 3300009176 Bacteria 694
83 Ga0105248_10399121 3300009177 Bacteria 1548
84 Ga0105246_10816294 3300011119 Bacteria 829
85 Ga0157374_10613306 3300013296 Bacteria 1098
86 Ga0157375_10253872 3300013308 Bacteria 1919
87 Ga0163163_10351350 3300014325 Bacteria 1531
88 Ga0157376_10427731 3300014969 Bacteria 1286
89 Ga0213873_10089006 3300021358 Bacteria 874
90 Ga0213876_10058845 3300021384 Bacteria 2028
91 Ga0207699_10172733 3300025906 Bacteria 1447
92 Ga0207645_10882651 3300025907 Bacteria 608
93 Ga0207707_10002638 3300025912 Bacteria 16018
94 Ga0207660_10010787 3300025917 Bacteria 5938
95 Ga0207649_10904359 3300025920 Bacteria 692
96 Ga0207652_10003783 3300025921 Bacteria 12398
97 Ga0207646_10107701 3300025922 Bacteria 2500
98 Ga0207681_10292940 3300025923 Bacteria 1285
99 Ga0207687_10007066 3300025927 Bacteria 7399
100 Ga0207700_10399656 3300025928 Bacteria 1204
101 Ga0207664_11478870 3300025929 Bacteria 601
102 Ga0207644_10330221 3300025931 Bacteria 1235
103 Ga0207686_10310296 3300025934 Bacteria 1175
104 Ga0207709_10174310 3300025935 Bacteria 1512
105 Ga0207711_10008258 3300025941 Bacteria 8718
106 Ga0207711_10861041 3300025941 Bacteria 843
107 Ga0207661_10000267 3300025944 Bacteria 33777
108 Ga0207661_10002572 3300025944 Bacteria 12488
109 Ga0207679_10135444 3300025945 Bacteria 1983
110 Ga0207651_10215151 3300025960 Bacteria 1550
111 Ga0207668_10000947 3300025972 Bacteria 17464
112 Ga0207639_11215212 3300026041 Bacteria 707
113 Ga0207678_10229773 3300026067 Bacteria 1588
114 Ga0207708_10717943 3300026075 Bacteria 855
115 Ga0207702_10009710 3300026078 Bacteria 8081
116 Ga0207676_10022341 3300026095 Bacteria 4652
117 Ga0207674_10011433 3300026116 Bacteria 9974
118 Ga0207683_10017302 3300026121 Bacteria 6142
119 Ga0268266_10659446 3300028379 Bacteria 1007
120 Ga0268265_10041224 3300028380 Bacteria 3415
121 Ga0307517_10238927 3300028786 Bacteria 1080
122 Ga0307515_10195883 3300028794 Bacteria 1913
123 Ga0307512_10002606 3300030522 Bacteria 22354
124 Ga0307513_10002569 3300031456 Bacteria 25080
125 Ga0307513_10449582 3300031456 Bacteria 1013
126 Ga0307509_10030531 3300031507 Bacteria 5959
127 Ga0307508_10094028 3300031616 Bacteria 2588
128 Ga0316576_10185625 3300031727 Bacteria 1568
129 Ga0316578_10648782 3300031728 Bacteria 616
130 Ga0307516_10005801 3300031730 Bacteria 14626
131 Ga0316577_10165136 3300031733 Bacteria 1249
132 Ga0307412_10687513 3300031911 Bacteria 877
133 Ga0307409_100022549 3300031995 Bacteria 4344
134 Ga0316585_10026974 3300032137 Bacteria 1790
135 Ga0316580_10018010 3300032139 Bacteria 2174
136 Ga0316214_1029847 3300033545 Bacteria 773
137 Ga0373950_0093635 3300034818 Bacteria 640
138 Ga0373951_0000001 3300035091 Bacteria 119231
139 Ga0373941_0058110 3300035115 Bacteria 1251
140 Ga0373956_0225955 3300035119 Unclassified 889
141 Ga0373942_0125591 3300035207 Bacteria 805
142 Ga0316574_0003581 3300035398 Bacteria 8033
143 Ga0373931_0420827 3300035691 Bacteria 849
144 Ga0373935_0044413 3300035692 Bacteria 2800
145 Ga0316582_0017005 3300036647 Bacteria 4196
146 Ga0395898_0020853 3300037466 Bacteria 6650
147 Ga0436364_1014151 3300037853 Bacteria 834
148 Ga0436365_0434778 3300039437 Bacteria 14752
149 Ga0436365_1500282 3300039437 Bacteria 2030
150 Ga0436360_1277940 3300039438 Bacteria 660
151 Ga0436363_1572479 3300039450 Bacteria 2760
152 Ga0436362_1034870 3300039453 Bacteria 2499
153 Ga0451837_0821925 3300041494 Bacteria 1570
154 Ga0466965_0141758 3300044683 Bacteria 1252
155 Ga0466957_0534976 3300044842 Bacteria 815
156 Ga0466958_0009733 3300045836 Bacteria 5363
157 Ga0466958_0772870 3300045836 Bacteria 626
158 Ga0495592_0053268 3300046454 Bacteria 3002
159 Ga0495653_0293929 3300046463 Unclassified 1061
160 Ga0495653_0645934 3300046463 Bacteria 647
161 Ga0495664_0154040 3300046477 Unclassified 1394
162 Ga0495618_0165691 3300046514 Unclassified 1407
163 Ga0495618_0234860 3300046514 Bacteria 1154
164 Ga0495628_0010089 3300046516 Bacteria 8034
165 Ga0495630_0166641 3300046517 Bacteria 1677
166 Ga0495630_0402508 3300046517 Bacteria 1049
167 Ga0495652_0198801 3300046529 Bacteria 1523
168 Ga0495640_0551305 3300046533 Bacteria 699
169 Ga0495667_0101975 3300046559 Bacteria 1856
170 Ga0495657_0133921 3300046675 Unclassified 1550
171 Ga0495589_0318409 3300046794 Bacteria 719
172 Ga0495604_0109499 3300047317 Bacteria 2016
173 Ga0495672_0104022 3300047320 Bacteria 1535
174 Ga0495680_0050542 3300047322 Bacteria 3250
175 Ga0495680_0479519 3300047322 Bacteria 847
176 Ga0495684_0267192 3300047471 Bacteria 1239
177 Ga0495602_0927462 3300048088 Bacteria 578
178 Ga0496102_0000736 3300048905 Bacteria 32144
179 Ga0496103_0011398 3300048906 Bacteria 5267
180 Ga0496104_0013777 3300048907 Bacteria 7294
181 Ga0496104_0066652 3300048907 Bacteria 3418
182 Ga0496104_0182954 3300048907 Bacteria 2006
183 Ga0496104_0474041 3300048907 Bacteria 1163
184 Ga0496104_1205853 3300048907 Bacteria 660
185 Ga0496105_0085538 3300048908 Bacteria 2605
186 Ga0496105_0086871 3300048908 Bacteria 2584
187 Ga0496105_0897135 3300048908 Bacteria 668
188 Ga0496105_0982083 3300048908 Bacteria 632
189 Ga0496107_0078619 3300048910 Bacteria 2404
190 Ga0496108_0007628 3300048911 Bacteria 8765
191 Ga0496108_0028296 3300048911 Bacteria 4637
192 Ga0496108_0448582 3300048911 Bacteria 1127
193 Ga0496109_0008429 3300048912 Bacteria 8764
194 Ga0496109_0071361 3300048912 Bacteria 3188
195 Ga0496109_0304217 3300048912 Bacteria 1504
196 Ga0496109_0932691 3300048912 Bacteria 806
197 Ga0496110_0028218 3300048913 Bacteria 4818
198 Ga0496110_0274465 3300048913 Bacteria 1535
199 Ga0496110_1016757 3300048913 Bacteria 736
200 Ga0496111_0119630 3300048914 Bacteria 1945
201 Ga0496111_0257066 3300048914 Bacteria 1296
202 Ga0496111_0386360 3300048914 Bacteria 1035
203 Ga0496112_0032612 3300048915 Bacteria 5058
204 Ga0496112_0076567 3300048915 Bacteria 3308
205 Ga0496113_0182591 3300048916 Bacteria 1663
206 Ga0496114_0002003 3300048917 Bacteria 15482
207 Ga0501040_0297124 3300049576 Bacteria 1154
208 Ga0501074_0319948 3300049590 Bacteria 1102
209 Ga0501075_0092880 3300049591 Bacteria 2291
210 Ga0501075_0756551 3300049591 Bacteria 740
211 nmdc:mga03n38_184865_c1 3300050490 Bacteria 1070
212 nmdc:mga03n38_22252_c1 3300050490 Bacteria 2563
213 nmdc:mga0yw44_662814_c1 3300050492 Bacteria 709
214 nmdc:mga06z11_106824_c1 3300050494 Bacteria 1544
215 nmdc:mga06z11_185223_c1 3300050494 Bacteria 1202
216 nmdc:mga05p37_1195495_c1 3300050507 Bacteria 786
217 nmdc:mga05p37_499925_c1 3300050507 Bacteria 1396
218 nmdc:mga05p37_879184_c1 3300050507 Bacteria 969
219 nmdc:mga05p37_99583_c1 3300050507 Bacteria 3580
220 nmdc:mga09592_290855_c1 3300050508 Bacteria 1416
221 nmdc:mga0qj67_106077_c1 3300050509 Bacteria 2267
222 nmdc:mga0qj67_4024_c1 3300050509 Bacteria 10644
223 nmdc:mga0qj67_982412_c1 3300050509 Bacteria 663
224 nmdc:mga06r32_1076803_c1 3300050510 Bacteria 754
225 nmdc:mga06r32_1249754_c1 3300050510 Bacteria 688
226 nmdc:mga06r32_7425_c1 3300050510 Bacteria 9862
227 nmdc:mga08y16_587823_c1 3300050511 Bacteria 1123
228 nmdc:mga08y16_628027_c1 3300050511 Bacteria 1080
229 nmdc:mga0n895_783819_c1 3300050512 Bacteria 945
230 nmdc:mga08x19_503914_c1 3300050514 Bacteria 855
231 nmdc:mga0a205_761021_c1 3300050515 Bacteria 817
232 Ga0495601_0010337 3300053077 Bacteria 5552
233 Ga0500646_0156711 3300053090 Bacteria 758
234 Ga0500651_0051645 3300053093 Bacteria 2579
235 Ga0500641_0078276 3300053096 Bacteria 1400
236 Ga0500594_0025986 3300053118 Bacteria 1505
237 Ga0500577_0274600 3300053142 Bacteria 734
238 Ga0530510_0038312 3300061734 Bacteria 3461
239 2676485147 2675903059 Bacteria 8644972
240 2867475854 2867475112 Bacteria 6909112
241 Ga0466967_0259610
242 JGI25406J46586_10004712
243 JGI25407J50210_10079055
244 Ga0070676_10648441
245 Ga0070683_100004044
246 Ga0070680_100026769
247 Ga0070682_101528478
248 Ga0070691_10021594
249 Ga0070661_100419887
250 Ga0070661_101010931
251 Ga0070669_100308807
252 Ga0070673_100517608
253 Ga0070709_10294917
254 Ga0070713_100389949
255 Ga0070711_100224215
256 Ga0070705_100311691
257 Ga0070694_100293681
258 Ga0070708_100032354
259 Ga0070663_100171557
260 Ga0070678_100488616
261 Ga0070681_10073633
262 Ga0070706_100025725
263 Ga0070706_100309340
264 Ga0070707_100102235
265 Ga0070698_100112508
266 Ga0070679_100013472
267 Ga0070684_100000705
268 Ga0070684_100098365
269 Ga0068853_101041805
270 Ga0070693_100149509
271 Ga0070665_100623816
272 Ga0068857_100052679
273 Ga0068856_100021465
274 Ga0068856_101733414
275 Ga0068864_100079328
276 Ga0068861_100470781
277 Ga0068863_100549237
278 Ga0068862_100011469
279 Ga0081455_10017404
280 Ga0081538_10005190
281 Ga0081539_10000661
282 Ga0070717_11191781
283 Ga0075365_10038110
284 Ga0075365_10764989
285 Ga0075365_11040013
286 Ga0075363_100003932
287 Ga0075363_100211875
288 Ga0075364_10248364
289 Ga0070715_10141184
290 Ga0075367_10032976
291 Ga0075367_10112514
292 Ga0068871_100296083
293 Ga0075428_100337157
294 Ga0075430_100006138
295 Ga0075430_100165003
296 Ga0075430_100451851
297 Ga0075431_100098468
298 Ga0075431_100211156
299 Ga0075431_100825466
300 Ga0075431_101546545
301 Ga0075433_10186367
302 Ga0075433_10456661
303 Ga0075434_100100562
304 Ga0075429_100036138
305 Ga0075429_100115652
306 Ga0075429_100900438
307 Ga0075436_100006675
308 Ga0075436_100581105
309 Ga0075435_100128139
310 Ga0105251_10184229
311 Ga0111539_10088751
312 Ga0111539_10626968
313 Ga0111539_11529056
314 Ga0105245_10012796
315 Ga0105245_10560781
316 Ga0114129_10283795
317 Ga0114129_10510669
318 Ga0114129_10714761
319 Ga0114129_11759198
320 Ga0105243_10361081
321 Ga0105242_10294332
322 Ga0105242_11552781
323 Ga0105248_10399121
324 Ga0105246_10816294
325 Ga0157374_10613306
326 Ga0157375_10253872
327 Ga0163163_10351350
328 Ga0157376_10427731
329 Ga0213873_10089006
330 Ga0213876_10058845
331 Ga0207699_10172733
332 Ga0207645_10882651
333 Ga0207707_10002638
334 Ga0207660_10010787
335 Ga0207649_10904359
336 Ga0207652_10003783
337 Ga0207646_10107701
338 Ga0207681_10292940
339 Ga0207687_10007066
340 Ga0207700_10399656
341 Ga0207664_11478870
342 Ga0207644_10330221
343 Ga0207686_10310296
344 Ga0207709_10174310
345 Ga0207711_10008258
346 Ga0207711_10861041
347 Ga0207661_10000267
348 Ga0207661_10002572
349 Ga0207679_10135444
350 Ga0207651_10215151
351 Ga0207668_10000947
352 Ga0207639_11215212
353 Ga0207678_10229773
354 Ga0207708_10717943
355 Ga0207702_10009710
356 Ga0207676_10022341
357 Ga0207674_10011433
358 Ga0207683_10017302
359 Ga0268266_10659446
360 Ga0268265_10041224
361 Ga0307517_10238927
362 Ga0307515_10195883
363 Ga0307512_10002606
364 Ga0307513_10002569
365 Ga0307513_10449582
366 Ga0307509_10030531
367 Ga0307508_10094028
368 Ga0316576_10185625
369 Ga0316578_10648782
370 Ga0307516_10005801
371 Ga0316577_10165136
372 Ga0307412_10687513
373 Ga0307409_100022549
374 Ga0316585_10026974
375 Ga0316580_10018010
376 Ga0316214_1029847
377 Ga0373950_0093635
378 Ga0373951_0000001
379 Ga0373941_0058110
380 Ga0373956_0225955
381 Ga0373942_0125591
382 Ga0316574_0003581
383 Ga0373931_0420827
384 Ga0373935_0044413
385 Ga0316582_0017005
386 Ga0395898_0020853
387 Ga0436364_1014151
388 Ga0436365_0434778
389 Ga0436365_1500282
390 Ga0436360_1277940
391 Ga0436363_1572479
392 Ga0436362_1034870
393 Ga0451837_0821925
394 Ga0466965_0141758
395 Ga0466957_0534976
396 Ga0466958_0009733
397 Ga0466958_0772870
398 Ga0495592_0053268
399 Ga0495653_0293929
400 Ga0495653_0645934
401 Ga0495664_0154040
402 Ga0495618_0165691
403 Ga0495618_0234860
404 Ga0495628_0010089
405 Ga0495630_0166641
406 Ga0495630_0402508
407 Ga0495652_0198801
408 Ga0495640_0551305
409 Ga0495667_0101975
410 Ga0495657_0133921
411 Ga0495589_0318409
412 Ga0495604_0109499
413 Ga0495672_0104022
414 Ga0495680_0050542
415 Ga0495680_0479519
416 Ga0495684_0267192
417 Ga0495602_0927462
418 Ga0496102_0000736
419 Ga0496103_0011398
420 Ga0496104_0013777
421 Ga0496104_0066652
422 Ga0496104_0182954
423 Ga0496104_0474041
424 Ga0496104_1205853
425 Ga0496105_0085538
426 Ga0496105_0086871
427 Ga0496105_0897135
428 Ga0496105_0982083
429 Ga0496107_0078619
430 Ga0496108_0007628
431 Ga0496108_0028296
432 Ga0496108_0448582
433 Ga0496109_0008429
434 Ga0496109_0071361
435 Ga0496109_0304217
436 Ga0496109_0932691
437 Ga0496110_0028218
438 Ga0496110_0274465
439 Ga0496110_1016757
440 Ga0496111_0119630
441 Ga0496111_0257066
442 Ga0496111_0386360
443 Ga0496112_0032612
444 Ga0496112_0076567
445 Ga0496113_0182591
446 Ga0496114_0002003
447 Ga0501040_0297124
448 Ga0501074_0319948
449 Ga0501075_0092880
450 Ga0501075_0756551
451 nmdc:mga03n38_184865_c1
452 nmdc:mga03n38_22252_c1
453 nmdc:mga0yw44_662814_c1
454 nmdc:mga06z11_106824_c1
455 nmdc:mga06z11_185223_c1
456 nmdc:mga05p37_1195495_c1
457 nmdc:mga05p37_499925_c1
458 nmdc:mga05p37_879184_c1
459 nmdc:mga05p37_99583_c1
460 nmdc:mga09592_290855_c1
461 nmdc:mga0qj67_106077_c1
462 nmdc:mga0qj67_4024_c1
463 nmdc:mga0qj67_982412_c1
464 nmdc:mga06r32_1076803_c1
465 nmdc:mga06r32_1249754_c1
466 nmdc:mga06r32_7425_c1
467 nmdc:mga08y16_587823_c1
468 nmdc:mga08y16_628027_c1
469 nmdc:mga0n895_783819_c1
470 nmdc:mga08x19_503914_c1
471 nmdc:mga0a205_761021_c1
472 Ga0495601_0010337
473 Ga0500646_0156711
474 Ga0500651_0051645
475 Ga0500641_0078276
476 Ga0500594_0025986
477 Ga0500577_0274600
478 Ga0530510_0038312
479 2676485147
480 2867475854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

3

141

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9343 1 119
5ifz-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m 0.9038 1 119
4lfk-assembly1.cif.gz_A crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.8898 1 137
3s5p-assembly1.cif.gz_A crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.8894 1 124
3s5p-assembly1.cif.gz_B crystal structure of ribose-5-phosphate isomerase b rpib from giardia lamblia 0.8874 1 124
ID Description Score Start End Superfamily
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9343 1 119 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9056 2 136 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9038 1 119 3.40.1400.10
af_Q2G2R4_1_142_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.8929 1 137 3.40.1400.10
4lfmA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.8888 1 137 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A543A797-F1-model_v4 Ribose 5-phosphate isomerase B 0.9886 1 137 GO:0004751
GO:0009052
GO:0019316
AF-A0A2A5P0E3-F1-model_v4 Galactose isomerase 0.9871 35 136 GO:0004751
GO:0009052
GO:0019316
AF-A0A545AFR0-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9867 1 133 GO:0004751
GO:0009052
GO:0019316
AF-A0A2N3S216-F1-model_v4 deleted 0.9797 1 136
AF-A0A6V8K1Q4-F1-model_v4 Ribose 5-phosphate isomerase B 0.9793 1 136 GO:0004751
GO:0009052
GO:0019316

Map