F353090

General Info

Members Datasets Scaffolds Average Seq Length
240 159 480 155

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0009811|Ga0439448_0009811_910_1464
Length 184
Sequence MGAGKAALAWRQASLLVYNCRLPHIRIRHTSMVTTIGSEAAIPNPALKPLGFLVGEWLTEGSHPVLPGKTLHGRTSFAWSAGGAFLVMRSEIDEPEVPSGIAIFGTDDDTKECSMLYFDERGVSRRYIVALRSDLWEWWRDTPGFSQRFTAKLVDGGRRMVGHGELNRGDRWEPDLQLTYTRIA

Samples

Sample ID Description Type Environment
1 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
116 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
122 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
123 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.25
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 27.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439448_0009811 3300042005 Bacteria 2828
2 Ga0065715_10093739 3300005293 Bacteria 4580
3 Ga0070658_10004673 3300005327 Bacteria 11133
4 Ga0070658_10033619 3300005327 Bacteria 4126
5 Ga0070658_10328603 3300005327 Bacteria 1306
6 Ga0070676_10078540 3300005328 Bacteria 1997
7 Ga0070683_100170578 3300005329 Bacteria 2065
8 Ga0070683_100570810 3300005329 Unclassified 1082
9 Ga0070690_100149012 3300005330 Unclassified 1594
10 Ga0070670_100044094 3300005331 Bacteria 3835
11 Ga0070680_100011488 3300005336 Bacteria 6852
12 Ga0070680_100019933 3300005336 Bacteria 5317
13 Ga0070682_100556844 3300005337 Unclassified 898
14 Ga0070682_100619674 3300005337 Bacteria 857
15 Ga0070660_100087050 3300005339 Bacteria 2459
16 Ga0070660_100089155 3300005339 Unclassified 2430
17 Ga0070689_100022644 3300005340 Bacteria 4693
18 Ga0070691_10045884 3300005341 Bacteria 2074
19 Ga0070691_10135477 3300005341 Bacteria 1251
20 Ga0070661_100157697 3300005344 Bacteria 1718
21 Ga0070692_10106581 3300005345 Bacteria 1544
22 Ga0070668_100185615 3300005347 Unclassified 1701
23 Ga0070675_100040808 3300005354 Unclassified 3790
24 Ga0070674_100892199 3300005356 Unclassified 774
25 Ga0070673_100743474 3300005364 Bacteria 903
26 Ga0070688_100013292 3300005365 Bacteria 4636
27 Ga0070667_100014377 3300005367 Bacteria 6540
28 Ga0070700_100441554 3300005441 Bacteria 988
29 Ga0070694_100834647 3300005444 Bacteria 757
30 Ga0070708_100526380 3300005445 Bacteria 1115
31 Ga0070663_100040544 3300005455 Bacteria 3261
32 Ga0070678_100051435 3300005456 Bacteria 2987
33 Ga0070681_10005170 3300005458 Bacteria 12592
34 Ga0070681_10799626 3300005458 Bacteria 860
35 Ga0070685_10018823 3300005466 Unclassified 3719
36 Ga0070698_100120587 3300005471 Bacteria 2583
37 Ga0070699_100115394 3300005518 Bacteria 2360
38 Ga0070699_100191600 3300005518 Bacteria 1817
39 Ga0070679_100000143 3300005530 Bacteria 57899
40 Ga0070679_100008991 3300005530 Bacteria 9424
41 Ga0070679_100162541 3300005530 Bacteria 2207
42 Ga0070684_100011254 3300005535 Bacteria 7124
43 Ga0070684_100327673 3300005535 Bacteria 1407
44 Ga0070672_100030023 3300005543 Bacteria 4081
45 Ga0070686_100024563 3300005544 Unclassified 3613
46 Ga0070696_100007460 3300005546 Bacteria 7317
47 Ga0070693_100047657 3300005547 Bacteria 2439
48 Ga0070693_100113896 3300005547 Bacteria 1668
49 Ga0070704_100749448 3300005549 Unclassified 869
50 Ga0070704_102221465 3300005549 Bacteria 510
51 Ga0068855_100047797 3300005563 Bacteria 5054
52 Ga0068857_101279329 3300005577 Unclassified 711
53 Ga0068856_100187392 3300005614 Bacteria 2083
54 Ga0068856_100453137 3300005614 Unclassified 1304
55 Ga0068856_101416772 3300005614 Bacteria 709
56 Ga0068859_100014453 3300005617 Bacteria 7923
57 Ga0068859_100167760 3300005617 Unclassified 2275
58 Ga0068864_100037976 3300005618 Bacteria 4111
59 Ga0068851_10722557 3300005834 Bacteria 614
60 Ga0068870_10051780 3300005840 Bacteria 2174
61 Ga0068870_10683059 3300005840 Unclassified 707
62 Ga0068860_101865792 3300005843 Unclassified 623
63 Ga0068862_100454869 3300005844 Bacteria 1207
64 Ga0075428_100350994 3300006844 Bacteria 1583
65 Ga0075433_10015988 3300006852 Bacteria 6172
66 Ga0075434_100013751 3300006871 Bacteria 7717
67 Ga0075434_100029452 3300006871 Bacteria 5403
68 Ga0075429_100175310 3300006880 Bacteria 1878
69 Ga0075429_100612441 3300006880 Unclassified 954
70 Ga0075436_100158049 3300006914 Unclassified 1597
71 Ga0097620_100014450 3300006931 Bacteria 7923
72 Ga0097620_100167756 3300006931 Unclassified 2275
73 Ga0075435_100057000 3300007076 Bacteria 3159
74 Ga0075435_100268738 3300007076 Bacteria 1454
75 Ga0105240_10004744 3300009093 Bacteria 20528
76 Ga0105240_10183108 3300009093 Bacteria 2470
77 Ga0105245_10250311 3300009098 Unclassified 1721
78 Ga0105245_11433535 3300009098 Bacteria 741
79 Ga0105245_12190109 3300009098 Unclassified 606
80 Ga0114129_10017817 3300009147 Bacteria 10112
81 Ga0105243_10143166 3300009148 Bacteria 2042
82 Ga0105241_10074640 3300009174 Bacteria 2641
83 Ga0105241_10179077 3300009174 Bacteria 1757
84 Ga0105241_10232074 3300009174 Bacteria 1556
85 Ga0105242_10096960 3300009176 Unclassified 2492
86 Ga0105249_10054431 3300009553 Unclassified 3659
87 Ga0157373_10006992 3300013100 Bacteria 8406
88 Ga0157373_10011922 3300013100 Bacteria 6388
89 Ga0157373_10020091 3300013100 Bacteria 4858
90 Ga0157373_10172574 3300013100 Bacteria 1521
91 Ga0157373_11172178 3300013100 Bacteria 578
92 Ga0157371_10029657 3300013102 Bacteria 3953
93 Ga0157371_11163504 3300013102 Unclassified 593
94 Ga0157370_10036916 3300013104 Bacteria 4740
95 Ga0157370_10118711 3300013104 Unclassified 2470
96 Ga0157369_10262442 3300013105 Unclassified 1801
97 Ga0157369_10295070 3300013105 Bacteria 1687
98 Ga0157369_10501661 3300013105 Bacteria 1255
99 Ga0157369_11250709 3300013105 Bacteria 757
100 Ga0157374_10040916 3300013296 Bacteria 4269
101 Ga0157378_10084009 3300013297 Unclassified 2882
102 Ga0163162_10606871 3300013306 Bacteria 1220
103 Ga0157372_10216866 3300013307 Unclassified 2218
104 Ga0157372_10247952 3300013307 Bacteria 2067
105 Ga0157372_10256832 3300013307 Bacteria 2029
106 Ga0157372_10263285 3300013307 Bacteria 2002
107 Ga0157372_11721963 3300013307 Bacteria 721
108 Ga0157375_10521161 3300013308 Bacteria 1352
109 Ga0163163_10053785 3300014325 Bacteria 3976
110 Ga0157377_10064234 3300014745 Unclassified 2105
111 Ga0157379_10098716 3300014968 Bacteria 2622
112 Ga0206356_10795449 3300020070 Bacteria 1220
113 Ga0207680_10021674 3300025903 Bacteria 3480
114 Ga0207643_10021358 3300025908 Bacteria 3555
115 Ga0207705_10027757 3300025909 Bacteria 4037
116 Ga0207705_10255454 3300025909 Bacteria 1337
117 Ga0207654_10054499 3300025911 Bacteria 2311
118 Ga0207707_10006195 3300025912 Bacteria 10451
119 Ga0207707_10031889 3300025912 Bacteria 4613
120 Ga0207707_10048775 3300025912 Bacteria 3689
121 Ga0207707_10214093 3300025912 Bacteria 1678
122 Ga0207707_10302360 3300025912 Bacteria 1383
123 Ga0207707_11090872 3300025912 Unclassified 651
124 Ga0207695_10015400 3300025913 Bacteria 9003
125 Ga0207695_10265358 3300025913 Unclassified 1614
126 Ga0207695_10422778 3300025913 Bacteria 1217
127 Ga0207693_10627913 3300025915 Unclassified 835
128 Ga0207660_10002901 3300025917 Bacteria 11206
129 Ga0207660_10065462 3300025917 Bacteria 2626
130 Ga0207660_10542955 3300025917 Unclassified 945
131 Ga0207660_10848732 3300025917 Unclassified 745
132 Ga0207657_10057708 3300025919 Bacteria 3344
133 Ga0207649_10247534 3300025920 Bacteria 1282
134 Ga0207649_10830445 3300025920 Unclassified 722
135 Ga0207652_10002761 3300025921 Bacteria 14746
136 Ga0207652_10029915 3300025921 Bacteria 4558
137 Ga0207652_10134356 3300025921 Bacteria 2208
138 Ga0207652_10198280 3300025921 Bacteria 1806
139 Ga0207652_10982972 3300025921 Bacteria 742
140 Ga0207646_10356238 3300025922 Bacteria 1322
141 Ga0207681_10358571 3300025923 Bacteria 1169
142 Ga0207650_10528308 3300025925 Bacteria 988
143 Ga0207659_10136836 3300025926 Bacteria 1897
144 Ga0207686_10351072 3300025934 Bacteria 1110
145 Ga0207670_10058751 3300025936 Bacteria 2613
146 Ga0207669_10675886 3300025937 Bacteria 847
147 Ga0207704_10185009 3300025938 Unclassified 1509
148 Ga0207665_10572051 3300025939 Unclassified 880
149 Ga0207691_10306055 3300025940 Unclassified 1365
150 Ga0207711_10192050 3300025941 Bacteria 1861
151 Ga0207661_10005829 3300025944 Bacteria 8688
152 Ga0207661_10253729 3300025944 Bacteria 1564
153 Ga0207661_10374681 3300025944 Unclassified 1288
154 Ga0207661_10465289 3300025944 Unclassified 1153
155 Ga0207679_10301138 3300025945 Bacteria 1382
156 Ga0207667_10269237 3300025949 Bacteria 1741
157 Ga0207667_10368195 3300025949 Unclassified 1465
158 Ga0207712_10047705 3300025961 Unclassified 2975
159 Ga0207640_10009492 3300025981 Bacteria 5450
160 Ga0207640_10171399 3300025981 Bacteria 1618
161 Ga0207703_10259072 3300026035 Bacteria 1571
162 Ga0207703_11689604 3300026035 Unclassified 609
163 Ga0207702_10361152 3300026078 Unclassified 1392
164 Ga0207641_10763667 3300026088 Bacteria 955
165 Ga0207674_10381146 3300026116 Unclassified 1363
166 Ga0207674_10967744 3300026116 Unclassified 820
167 Ga0207674_11143102 3300026116 Unclassified 748
168 Ga0207683_10205653 3300026121 Bacteria 1790
169 Ga0207698_11808292 3300026142 Bacteria 626
170 Ga0268266_10123058 3300028379 Unclassified 2311
171 Ga0268264_11150276 3300028381 Bacteria 785
172 Ga0307405_10296911 3300031731 Unclassified 1224
173 Ga0307405_10392672 3300031731 Bacteria 1084
174 Ga0307407_10258000 3300031903 Bacteria 1198
175 Ga0307409_101619712 3300031995 Unclassified 676
176 Ga0307416_100378548 3300032002 Bacteria 1445
177 Ga0307416_101052353 3300032002 Bacteria 918
178 Ga0307416_101138657 3300032002 Bacteria 885
179 Ga0307416_102131660 3300032002 Bacteria 662
180 Ga0307411_11193336 3300032005 Bacteria 690
181 Ga0373930_0106042 3300034816 Unclassified 672
182 Ga0373948_0060050 3300034817 Bacteria 833
183 Ga0373959_0020136 3300034820 Bacteria 1270
184 Ga0373929_0071028 3300035085 Unclassified 832
185 Ga0373939_0044511 3300035114 Bacteria 1351
186 Ga0373960_0041212 3300035121 Bacteria 1336
187 Ga0373961_0056334 3300035241 Bacteria 1180
188 Ga0373931_0013220 3300035691 Unclassified 4016
189 Ga0242419_000960 3300038698 Bacteria 1695
190 Ga0242420_002760 3300038996 Bacteria 2539
191 Ga0242420_043532 3300038996 Bacteria 863
192 Ga0451802_1310899 3300041460 Bacteria 2559
193 Ga0451576_0026569 3300045051 Bacteria 6225
194 Ga0495580_0225617 3300046472 Bacteria 1287
195 Ga0495581_0160688 3300047315 Unclassified 1313
196 Ga0496100_0410644 3300048903 Bacteria 1033
197 Ga0496104_0047903 3300048907 Bacteria 4029
198 Ga0496105_0775746 3300048908 Unclassified 730
199 Ga0496106_0397973 3300048909 Unclassified 1107
200 Ga0496108_0037754 3300048911 Bacteria 4025
201 Ga0496108_1314806 3300048911 Unclassified 608
202 Ga0496109_0005877 3300048912 Bacteria 10294
203 Ga0496111_0070217 3300048914 Bacteria 2547
204 Ga0496112_0002450 3300048915 Bacteria 14966
205 Ga0496112_0006078 3300048915 Bacteria 10551
206 Ga0496112_0318841 3300048915 Unclassified 1499
207 Ga0496113_0039036 3300048916 Bacteria 3493
208 Ga0496113_0041659 3300048916 Bacteria 3390
209 Ga0496113_0551721 3300048916 Unclassified 924
210 Ga0501291_044609 3300049514 Bacteria 790
211 Ga0501033_0150676 3300049570 Bacteria 1678
212 Ga0501034_0284791 3300049571 Bacteria 1592
213 Ga0501040_0178711 3300049576 Unclassified 1504
214 Ga0501042_0369432 3300049578 Unclassified 1038
215 Ga0501047_0249144 3300049581 Bacteria 1625
216 Ga0501071_0010815 3300049587 Bacteria 6121
217 Ga0501071_0049216 3300049587 Bacteria 3033
218 Ga0501072_0026030 3300049588 Bacteria 4558
219 Ga0501073_0006793 3300049589 Bacteria 8510
220 Ga0501074_0005298 3300049590 Bacteria 9284
221 Ga0501074_0010066 3300049590 Bacteria 6865
222 Ga0501074_0085958 3300049590 Bacteria 2253
223 Ga0501076_0188444 3300049592 Bacteria 1683
224 Ga0501076_0585742 3300049592 Bacteria 920
225 Ga0501077_0184360 3300049593 Bacteria 1326
226 Ga0501239_036623 3300049672 Unclassified 664
227 Ga0501079_0069958 3300049741 Bacteria 2709
228 Ga0501080_0019090 3300049742 Bacteria 6347
229 Ga0501081_0157036 3300049743 Bacteria 1637
230 nmdc:mga09592_473212_c1 3300050508 Bacteria 1080
231 nmdc:mga06r32_1379796_c1 3300050510 Unclassified 647
232 nmdc:mga0n895_21025_c1 3300050512 Bacteria 6098
233 nmdc:mga08x19_140660_c1 3300050514 Unclassified 1630
234 nmdc:mga0a205_15392_c1 3300050515 Bacteria 2289
235 Ga0501084_0054820 3300054114 Bacteria 3334
236 Ga0501084_0476310 3300054114 Unclassified 1055
237 Ga0501082_0050853 3300060353 Bacteria 3573
238 Ga0501082_0534428 3300060353 Bacteria 1025
239 Ga0530510_0260605 3300061734 Bacteria 1293
240 Ga0530510_0781911 3300061734 Unclassified 728
241 Ga0439448_0009811
242 Ga0065715_10093739
243 Ga0070658_10004673
244 Ga0070658_10033619
245 Ga0070658_10328603
246 Ga0070676_10078540
247 Ga0070683_100170578
248 Ga0070683_100570810
249 Ga0070690_100149012
250 Ga0070670_100044094
251 Ga0070680_100011488
252 Ga0070680_100019933
253 Ga0070682_100556844
254 Ga0070682_100619674
255 Ga0070660_100087050
256 Ga0070660_100089155
257 Ga0070689_100022644
258 Ga0070691_10045884
259 Ga0070691_10135477
260 Ga0070661_100157697
261 Ga0070692_10106581
262 Ga0070668_100185615
263 Ga0070675_100040808
264 Ga0070674_100892199
265 Ga0070673_100743474
266 Ga0070688_100013292
267 Ga0070667_100014377
268 Ga0070700_100441554
269 Ga0070694_100834647
270 Ga0070708_100526380
271 Ga0070663_100040544
272 Ga0070678_100051435
273 Ga0070681_10005170
274 Ga0070681_10799626
275 Ga0070685_10018823
276 Ga0070698_100120587
277 Ga0070699_100115394
278 Ga0070699_100191600
279 Ga0070679_100000143
280 Ga0070679_100008991
281 Ga0070679_100162541
282 Ga0070684_100011254
283 Ga0070684_100327673
284 Ga0070672_100030023
285 Ga0070686_100024563
286 Ga0070696_100007460
287 Ga0070693_100047657
288 Ga0070693_100113896
289 Ga0070704_100749448
290 Ga0070704_102221465
291 Ga0068855_100047797
292 Ga0068857_101279329
293 Ga0068856_100187392
294 Ga0068856_100453137
295 Ga0068856_101416772
296 Ga0068859_100014453
297 Ga0068859_100167760
298 Ga0068864_100037976
299 Ga0068851_10722557
300 Ga0068870_10051780
301 Ga0068870_10683059
302 Ga0068860_101865792
303 Ga0068862_100454869
304 Ga0075428_100350994
305 Ga0075433_10015988
306 Ga0075434_100013751
307 Ga0075434_100029452
308 Ga0075429_100175310
309 Ga0075429_100612441
310 Ga0075436_100158049
311 Ga0097620_100014450
312 Ga0097620_100167756
313 Ga0075435_100057000
314 Ga0075435_100268738
315 Ga0105240_10004744
316 Ga0105240_10183108
317 Ga0105245_10250311
318 Ga0105245_11433535
319 Ga0105245_12190109
320 Ga0114129_10017817
321 Ga0105243_10143166
322 Ga0105241_10074640
323 Ga0105241_10179077
324 Ga0105241_10232074
325 Ga0105242_10096960
326 Ga0105249_10054431
327 Ga0157373_10006992
328 Ga0157373_10011922
329 Ga0157373_10020091
330 Ga0157373_10172574
331 Ga0157373_11172178
332 Ga0157371_10029657
333 Ga0157371_11163504
334 Ga0157370_10036916
335 Ga0157370_10118711
336 Ga0157369_10262442
337 Ga0157369_10295070
338 Ga0157369_10501661
339 Ga0157369_11250709
340 Ga0157374_10040916
341 Ga0157378_10084009
342 Ga0163162_10606871
343 Ga0157372_10216866
344 Ga0157372_10247952
345 Ga0157372_10256832
346 Ga0157372_10263285
347 Ga0157372_11721963
348 Ga0157375_10521161
349 Ga0163163_10053785
350 Ga0157377_10064234
351 Ga0157379_10098716
352 Ga0206356_10795449
353 Ga0207680_10021674
354 Ga0207643_10021358
355 Ga0207705_10027757
356 Ga0207705_10255454
357 Ga0207654_10054499
358 Ga0207707_10006195
359 Ga0207707_10031889
360 Ga0207707_10048775
361 Ga0207707_10214093
362 Ga0207707_10302360
363 Ga0207707_11090872
364 Ga0207695_10015400
365 Ga0207695_10265358
366 Ga0207695_10422778
367 Ga0207693_10627913
368 Ga0207660_10002901
369 Ga0207660_10065462
370 Ga0207660_10542955
371 Ga0207660_10848732
372 Ga0207657_10057708
373 Ga0207649_10247534
374 Ga0207649_10830445
375 Ga0207652_10002761
376 Ga0207652_10029915
377 Ga0207652_10134356
378 Ga0207652_10198280
379 Ga0207652_10982972
380 Ga0207646_10356238
381 Ga0207681_10358571
382 Ga0207650_10528308
383 Ga0207659_10136836
384 Ga0207686_10351072
385 Ga0207670_10058751
386 Ga0207669_10675886
387 Ga0207704_10185009
388 Ga0207665_10572051
389 Ga0207691_10306055
390 Ga0207711_10192050
391 Ga0207661_10005829
392 Ga0207661_10253729
393 Ga0207661_10374681
394 Ga0207661_10465289
395 Ga0207679_10301138
396 Ga0207667_10269237
397 Ga0207667_10368195
398 Ga0207712_10047705
399 Ga0207640_10009492
400 Ga0207640_10171399
401 Ga0207703_10259072
402 Ga0207703_11689604
403 Ga0207702_10361152
404 Ga0207641_10763667
405 Ga0207674_10381146
406 Ga0207674_10967744
407 Ga0207674_11143102
408 Ga0207683_10205653
409 Ga0207698_11808292
410 Ga0268266_10123058
411 Ga0268264_11150276
412 Ga0307405_10296911
413 Ga0307405_10392672
414 Ga0307407_10258000
415 Ga0307409_101619712
416 Ga0307416_100378548
417 Ga0307416_101052353
418 Ga0307416_101138657
419 Ga0307416_102131660
420 Ga0307411_11193336
421 Ga0373930_0106042
422 Ga0373948_0060050
423 Ga0373959_0020136
424 Ga0373929_0071028
425 Ga0373939_0044511
426 Ga0373960_0041212
427 Ga0373961_0056334
428 Ga0373931_0013220
429 Ga0242419_000960
430 Ga0242420_002760
431 Ga0242420_043532
432 Ga0451802_1310899
433 Ga0451576_0026569
434 Ga0495580_0225617
435 Ga0495581_0160688
436 Ga0496100_0410644
437 Ga0496104_0047903
438 Ga0496105_0775746
439 Ga0496106_0397973
440 Ga0496108_0037754
441 Ga0496108_1314806
442 Ga0496109_0005877
443 Ga0496111_0070217
444 Ga0496112_0002450
445 Ga0496112_0006078
446 Ga0496112_0318841
447 Ga0496113_0039036
448 Ga0496113_0041659
449 Ga0496113_0551721
450 Ga0501291_044609
451 Ga0501033_0150676
452 Ga0501034_0284791
453 Ga0501040_0178711
454 Ga0501042_0369432
455 Ga0501047_0249144
456 Ga0501071_0010815
457 Ga0501071_0049216
458 Ga0501072_0026030
459 Ga0501073_0006793
460 Ga0501074_0005298
461 Ga0501074_0010066
462 Ga0501074_0085958
463 Ga0501076_0188444
464 Ga0501076_0585742
465 Ga0501077_0184360
466 Ga0501239_036623
467 Ga0501079_0069958
468 Ga0501080_0019090
469 Ga0501081_0157036
470 nmdc:mga09592_473212_c1
471 nmdc:mga06r32_1379796_c1
472 nmdc:mga0n895_21025_c1
473 nmdc:mga08x19_140660_c1
474 nmdc:mga0a205_15392_c1
475 Ga0501084_0054820
476 Ga0501084_0476310
477 Ga0501082_0050853
478 Ga0501082_0534428
479 Ga0530510_0260605
480 Ga0530510_0781911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8704 12 154
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8674 11 154
7sfp-assembly1.cif.gz_A crystal structure of osso, a spirocyclase involved in the biosynthesis of ossamycin 0.8586 11 153
7sfn-assembly1.cif.gz_A crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.838 12 154
7sfn-assembly1.cif.gz_B crystal structure of olmo, a spirocyclase involved in the biosynthesis of oligomycin 0.8151 11 154
ID Description Score Start End Superfamily
af_Q556I7_1_158_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8351 15 153 2.40.128.20
af_Q22857_66_227_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8067 12 154 2.40.128.20
af_Q09244_126_302_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7824 13 153 2.40.128.20
3wjeB00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7742 10 153 2.40.128.20
af_F1R6A1_237_360_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.773 104 137 3.30.160.40
ID Description Score Start End GO Terms
AF-A0A537JIU5-F1-model_v4 DUF1579 domain-containing protein 0.9775 11 154
AF-A0A534Q4I7-F1-model_v4 DUF1579 domain-containing protein 0.9741 29 154
AF-A0A838V7N0-F1-model_v4 DUF1579 domain-containing protein 0.9711 9 154
AF-A0A537JIU5-F1-model_v4 DUF1579 domain-containing protein 0.9709 11 154
AF-A0A1I3R1D1-F1-model_v4 DUF1579 domain-containing protein 0.9682 15 154

Map