F353081

General Info

Members Datasets Scaffolds Average Seq Length
240 150 232 265

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_0782982|Ga0451793_0782982_273_1142
Length 289
Sequence MTLAPMYIDGIGLLGPGLPSWPAAQPVLRGEEPHAFQLTVLPAPPRLPPAERRRAGPVIRLAMAVAEEAIAHAQADPSALATVFSSSGGEGSNCHSLCETLASDNPLLSPTRFTNSVHNAASGYWHIAVGSRHASTSLCAFDGSFGAGLLEAAVLMHSDRRPLMLVAYDLPYPEPLNTVRPLPDNFGLAFVLSSQRSARSIACCEVATLAGRAMPAPDACADPSLEALRTGIPAGAALPMLQAIARADAQPRTLTVDYLPAMRLRVVLTGLATAQADDASRSTTADAAA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
58 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
59 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
108 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
113 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
142 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
145 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
146 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
147 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
148 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
149 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
150 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.08
Nodule 0
Rhizoplane 2.5
Rhizosphere 49.17
Stem 0
Stem Tuber 0
Unclassified 21.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001167 3300003215 Bacteria 15888
2 JGI25153J46596_10007747 3300003215 Bacteria 5227
3 rootH1_10016854 3300003316 Bacteria 2362
4 rootL2_10004369 3300003322 Bacteria 2618
5 Ga0055526_1007397 3300003771 Bacteria 5718
6 Ga0055530_10010859 3300003791 Bacteria 3320
7 Ga0055531_10000265 3300003794 Bacteria 54568
8 Ga0065165_1002987 3300005262 Bacteria 12835
9 Ga0070676_10003217 3300005328 Bacteria 8463
10 Ga0070670_100101689 3300005331 Bacteria 2475
11 Ga0068869_100009708 3300005334 Bacteria 6250
12 Ga0068869_100304033 3300005334 Bacteria 1289
13 Ga0070666_10280515 3300005335 Bacteria 1184
14 Ga0068868_100010457 3300005338 Bacteria 6720
15 Ga0068868_100276869 3300005338 Bacteria 1419
16 Ga0070675_100248345 3300005354 Bacteria 1556
17 Ga0070675_100310250 3300005354 Bacteria 1392
18 Ga0070671_100007112 3300005355 Bacteria 8950
19 Ga0070671_100039304 3300005355 Bacteria 3928
20 Ga0070673_100010773 3300005364 Bacteria 6206
21 Ga0070667_100001541 3300005367 Bacteria 20646
22 Ga0070708_100066375 3300005445 Bacteria 3239
23 Ga0070663_100236991 3300005455 Bacteria 1439
24 Ga0068867_100001608 3300005459 Bacteria 15698
25 Ga0070706_100000761 3300005467 Bacteria 36053
26 Ga0070707_100103020 3300005468 Bacteria 2765
27 Ga0070672_100010519 3300005543 Bacteria 6420
28 Ga0070665_100098554 3300005548 Bacteria 2927
29 Ga0068857_100013202 3300005577 Bacteria 7198
30 Ga0068857_100064805 3300005577 Bacteria 3249
31 Ga0068854_100039147 3300005578 Bacteria 3338
32 Ga0068856_100008360 3300005614 Bacteria 10084
33 Ga0068852_100069901 3300005616 Bacteria 3079
34 Ga0068859_100288614 3300005617 Bacteria 1733
35 Ga0068859_100398122 3300005617 Bacteria 1473
36 Ga0068864_100011625 3300005618 Bacteria 7269
37 Ga0068870_10046788 3300005840 Bacteria 2271
38 Ga0068863_100281444 3300005841 Bacteria 1611
39 Ga0068860_100421413 3300005843 Bacteria 1323
40 Ga0075368_10050437 3300006042 Bacteria 1653
41 Ga0075364_10046917 3300006051 Bacteria 2813
42 Ga0075362_10085508 3300006177 Bacteria 1458
43 Ga0075362_10169941 3300006177 Bacteria 1053
44 Ga0075367_10039959 3300006178 Bacteria 2738
45 Ga0075367_10078855 3300006178 Bacteria 1989
46 Ga0075367_10084140 3300006178 Bacteria 1928
47 Ga0075366_10003828 3300006195 Bacteria 8012
48 Ga0075366_10005896 3300006195 Bacteria 6662
49 Ga0075366_10014303 3300006195 Bacteria 4532
50 Ga0075366_10064902 3300006195 Bacteria 2171
51 Ga0075366_10131828 3300006195 Bacteria 1508
52 Ga0075366_10216928 3300006195 Bacteria 1165
53 Ga0075370_10000058 3300006353 Bacteria 32658
54 Ga0075370_10002893 3300006353 Bacteria 8055
55 Ga0075370_10003283 3300006353 Bacteria 7675
56 Ga0075370_10003344 3300006353 Bacteria 7618
57 Ga0075370_10004875 3300006353 Bacteria 6584
58 Ga0075370_10110239 3300006353 Bacteria 1598
59 Ga0075370_10168369 3300006353 Bacteria 1287
60 Ga0075370_10169534 3300006353 Bacteria 1283
61 Ga0075370_10179570 3300006353 Bacteria 1245
62 Ga0068865_100065562 3300006881 Bacteria 2559
63 Ga0097620_100288605 3300006931 Bacteria 1733
64 Ga0097620_100398139 3300006931 Bacteria 1473
65 Ga0105240_10221417 3300009093 Bacteria 2204
66 Ga0105245_10063034 3300009098 Bacteria 3346
67 Ga0105245_10182953 3300009098 Bacteria 2003
68 Ga0105245_10406148 3300009098 Bacteria 1362
69 Ga0105243_10205885 3300009148 Bacteria 1729
70 Ga0105243_10256845 3300009148 Bacteria 1563
71 Ga0105237_10004239 3300009545 Bacteria 16688
72 Ga0105239_10215813 3300010375 Bacteria 2151
73 Ga0157378_10206840 3300013297 Bacteria 1859
74 Ga0157375_10072461 3300013308 Bacteria 3461
75 Ga0157375_10361881 3300013308 Bacteria 1617
76 Ga0157375_10522866 3300013308 Bacteria 1350
77 Ga0157379_10032799 3300014968 Bacteria 4631
78 Ga0207425_1000511 3300025245 Bacteria 23911
79 Ga0209129_1000225 3300025258 Bacteria 63564
80 Ga0209673_1057768 3300025273 Bacteria 986
81 Ga0209564_1000196 3300025295 Bacteria 141368
82 Ga0209758_1000181 3300025297 Bacteria 140847
83 Ga0209758_1000207 3300025297 Bacteria 129217
84 Ga0209050_1002192 3300025298 Bacteria 17608
85 Ga0209051_1000252 3300025303 Bacteria 90654
86 Ga0209257_1000012 3300025304 Bacteria 1111138
87 Ga0209257_1069459 3300025304 Bacteria 933
88 Ga0207645_10006310 3300025907 Bacteria 8527
89 Ga0207643_10026872 3300025908 Bacteria 3189
90 Ga0207684_10002593 3300025910 Bacteria 18101
91 Ga0207695_10263941 3300025913 Bacteria 1619
92 Ga0207671_10008882 3300025914 Bacteria 8461
93 Ga0207646_10167090 3300025922 Bacteria 1986
94 Ga0207659_10003420 3300025926 Bacteria 9512
95 Ga0207659_10438672 3300025926 Bacteria 1098
96 Ga0207687_10042877 3300025927 Bacteria 3116
97 Ga0207644_10306493 3300025931 Bacteria 1281
98 Ga0207709_10052037 3300025935 Bacteria 2513
99 Ga0207691_10026020 3300025940 Bacteria 5492
100 Ga0207691_10034907 3300025940 Bacteria 4673
101 Ga0207689_10032536 3300025942 Bacteria 4338
102 Ga0207689_10065499 3300025942 Bacteria 2988
103 Ga0207651_10007148 3300025960 Bacteria 5932
104 Ga0207658_10000856 3300025986 Bacteria 25445
105 Ga0207658_10532678 3300025986 Bacteria 1049
106 Ga0207658_10577271 3300025986 Bacteria 1008
107 Ga0207677_10207845 3300026023 Bacteria 1561
108 Ga0207678_10064563 3300026067 Bacteria 3145
109 Ga0207702_10006680 3300026078 Bacteria 9916
110 Ga0207648_10021517 3300026089 Bacteria 5796
111 Ga0207676_10334989 3300026095 Bacteria 1394
112 Ga0207674_10017514 3300026116 Bacteria 7815
113 Ga0207674_10110768 3300026116 Bacteria 2720
114 Ga0207683_10113112 3300026121 Bacteria 2431
115 Ga0207698_10144892 3300026142 Bacteria 2053
116 Ga0209974_10000953 3300027876 Bacteria 10135
117 Ga0268266_10055007 3300028379 Bacteria 3420
118 Ga0268264_10063627 3300028381 Bacteria 3102
119 Ga0307517_10003456 3300028786 Bacteria 24568
120 Ga0307517_10066413 3300028786 Bacteria 3319
121 Ga0307517_10129992 3300028786 Bacteria 1818
122 Ga0307517_10239390 3300028786 Bacteria 1079
123 Ga0307515_10000066 3300028794 Bacteria 244076
124 Ga0307515_10000347 3300028794 Bacteria 114603
125 Ga0307515_10002435 3300028794 Bacteria 40544
126 Ga0307515_10012248 3300028794 Bacteria 16152
127 Ga0307515_10027522 3300028794 Bacteria 9715
128 Ga0307515_10119820 3300028794 Bacteria 2990
129 Ga0307515_10246653 3300028794 Bacteria 1546
130 Ga0307515_10325392 3300028794 Bacteria 1200
131 Ga0307512_10087965 3300030522 Bacteria 2184
132 Ga0307512_10114199 3300030522 Bacteria 1763
133 Ga0307513_10045648 3300031456 Bacteria 4787
134 Ga0307513_10078590 3300031456 Bacteria 3412
135 Ga0307513_10196640 3300031456 Bacteria 1862
136 Ga0307513_10308958 3300031456 Bacteria 1344
137 Ga0307513_10385506 3300031456 Bacteria 1140
138 Ga0307509_10011055 3300031507 Bacteria 10992
139 Ga0307509_10017568 3300031507 Bacteria 8226
140 Ga0307509_10017810 3300031507 Bacteria 8158
141 Ga0307509_10023641 3300031507 Bacteria 6893
142 Ga0307509_10034698 3300031507 Bacteria 5541
143 Ga0307509_10047897 3300031507 Bacteria 4595
144 Ga0307509_10137066 3300031507 Bacteria 2391
145 Ga0307508_10000392 3300031616 Bacteria 52650
146 Ga0307508_10001470 3300031616 Bacteria 26429
147 Ga0307508_10092039 3300031616 Bacteria 2621
148 Ga0307508_10201078 3300031616 Bacteria 1593
149 Ga0307514_10010399 3300031649 Bacteria 7776
150 Ga0307514_10018273 3300031649 Bacteria 5752
151 Ga0307514_10060430 3300031649 Bacteria 2891
152 Ga0307516_10001538 3300031730 Bacteria 31719
153 Ga0307516_10056003 3300031730 Bacteria 3846
154 Ga0307410_10095714 3300031852 Bacteria 2118
155 Ga0307407_10118065 3300031903 Bacteria 1677
156 Ga0307416_100814489 3300032002 Bacteria 1030
157 Ga0307411_10101407 3300032005 Bacteria 2037
158 Ga0307510_10014813 3300033180 Bacteria 9230
159 Ga0307510_10054706 3300033180 Bacteria 4177
160 Ga0307510_10320946 3300033180 Bacteria 1006
161 Ga0395899_0067719 3300037312 Bacteria 2619
162 Ga0395898_0368660 3300037466 Bacteria 1369
163 Ga0395905_0032480 3300037471 Bacteria 4909
164 Ga0451793_0274953 3300041452 Bacteria 1338
165 Ga0451793_0782982 3300041452 Bacteria 1426
166 Ga0451800_0599260 3300041459 Bacteria 1368
167 Ga0439433_0004487 3300041999 Bacteria 3005
168 Ga0439445_0005049 3300042004 Bacteria 2997
169 Ga0439449_0112897 3300042007 Bacteria 1007
170 Ga0439462_0028704 3300042015 Bacteria 1471
171 Ga0450911_000061 3300042115 Bacteria 44228
172 Ga0450898_012803 3300042134 Bacteria 1390
173 Ga0466957_0231305 3300044842 Bacteria 1224
174 Ga0495592_0000425 3300046454 Bacteria 31964
175 Ga0495592_0291411 3300046454 Bacteria 1064
176 Ga0495638_0027323 3300046460 Bacteria 3695
177 Ga0495610_0021265 3300046512 Bacteria 3573
178 Ga0495620_0094272 3300046515 Bacteria 1198
179 Ga0495632_0001710 3300046519 Bacteria 17844
180 Ga0495632_0011271 3300046519 Bacteria 5228
181 Ga0495632_0022293 3300046519 Bacteria 3397
182 Ga0495632_0142073 3300046519 Bacteria 1113
183 Ga0495643_0028812 3300046522 Bacteria 3110
184 Ga0495643_0156810 3300046522 Bacteria 1123
185 Ga0495648_0082178 3300046524 Bacteria 1830
186 Ga0495656_0003437 3300046615 Bacteria 5355
187 Ga0495625_0015039 3300046660 Bacteria 6146
188 Ga0495625_0074517 3300046660 Bacteria 2377
189 Ga0495649_0001974 3300046694 Bacteria 14887
190 Ga0495660_0032460 3300046810 Bacteria 2932
191 Ga0495676_0127978 3300047321 Bacteria 1838
192 Ga0495687_000700 3300047443 Bacteria 37469
193 Ga0495673_0102107 3300047469 Bacteria 1158
194 Ga0495686_0073910 3300047472 Bacteria 2093
195 Ga0495626_0043650 3300048091 Bacteria 2102
196 Ga0496102_0001150 3300048905 Bacteria 24162
197 Ga0496102_0028412 3300048905 Bacteria 4995
198 Ga0496114_0323126 3300048917 Bacteria 1364
199 Ga0496121_0002603 3300048924 Bacteria 27252
200 Ga0496121_0008266 3300048924 Bacteria 12317
201 Ga0496125_0005663 3300048928 Bacteria 13789
202 Ga0496125_0012324 3300048928 Bacteria 8494
203 Ga0496125_0016211 3300048928 Bacteria 7164
204 Ga0496126_0077294 3300048929 Bacteria 2951
205 Ga0496126_0137853 3300048929 Bacteria 2103
206 nmdc:mga03683_103011_c1 3300050489 Bacteria 1256
207 nmdc:mga03n38_37848_c1 3300050490 Bacteria 2083
208 nmdc:mga0k408_182541_c1 3300050493 Bacteria 1252
209 nmdc:mga0k408_1874_c2 3300050493 Bacteria 8190
210 nmdc:mga0k408_4689_c1 3300050493 Bacteria 7248
211 nmdc:mga0k408_46990_c1 3300050493 Bacteria 2494
212 nmdc:mga0k408_4962_c1 3300050493 Bacteria 7053
213 nmdc:mga0k408_98709_c1 3300050493 Bacteria 1721
214 nmdc:mga06z11_14858_c1 3300050494 Bacteria 3460
215 nmdc:mga07m45_14492_c1 3300050496 Bacteria 4200
216 nmdc:mga07m45_273055_c1 3300050496 Bacteria 984
217 nmdc:mga07m45_304_c2 3300050496 Bacteria 11935
218 nmdc:mga07m45_306968_c1 3300050496 Bacteria 923
219 nmdc:mga07m45_50371_c1 3300050496 Bacteria 2347
220 nmdc:mga07m45_57_c1 3300050496 Bacteria 46544
221 nmdc:mga07m45_97315_c1 3300050496 Bacteria 1689
222 nmdc:mga0sz30_4916_c1 3300050516 Bacteria 4870
223 Ga0500578_0000224 3300053086 Bacteria 70358
224 Ga0500578_0009546 3300053086 Bacteria 6300
225 Ga0500651_0109605 3300053093 Bacteria 1686
226 Ga0500593_001750 3300053117 Bacteria 7823
227 Ga0500628_070742 3300053129 Bacteria 873
228 Ga0500658_0010242 3300053134 Bacteria 3455
229 Ga0500619_000078 3300053154 Bacteria 27132
230 Ga0500634_0034116 3300053161 Bacteria 2773
231 Ga0500645_003083 3300053730 Bacteria 6985
232 Ga0500587_001305 3300053739 Bacteria 3496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053129 Ga0500628_070742 Ga0500628_070742_30_692 217
2 3300053093 Ga0500651_0109605 Ga0500651_0109605_30_737 225
3 3300028794 Ga0307515_10000066 Ga0307515_1000006684 227
4 3300009098 Ga0105245_10182953 Ga0105245_101829533 228
5 3300005843 Ga0068860_100421413 Ga0068860_1004214132 229
6 3300028381 Ga0268264_10063627 Ga0268264_100636274 229
7 3300048924 Ga0496121_0008266 Ga0496121_0008266_5555_6340 229
8 3300025908 Ga0207643_10026872 Ga0207643_100268723 230
9 3300047443 Ga0495687_000700 Ga0495687_000700_9912_10721 233
10 3300050496 nmdc:mga07m45_304_c2 nmdc:mga07m45_304_c2_8398_9216 233
11 3300006353 Ga0075370_10003283 Ga0075370_100032836 235
12 3300003322 rootL2_10004369 rootL2_100043694 237
13 3300025304 Ga0209257_1069459 Ga0209257_10694591 238
14 3300026121 Ga0207683_10113112 Ga0207683_101131124 238
15 3300041452 Ga0451793_0274953 Ga0451793_0274953_579_1319 238
16 3300050496 nmdc:mga07m45_306968_c1 nmdc:mga07m45_306968_c1_145_885 238
17 3300044842 Ga0466957_0231305 Ga0466957_0231305_37_861 240
18 3300031649 Ga0307514_10010399 Ga0307514_100103993 241
19 3300042134 Ga0450898_012803 Ga0450898_012803_517_1302 242
20 3300003794 Ga0055531_10000265 Ga0055531_1000026517 243
21 3300025303 Ga0209051_1000252 Ga0209051_100025247 243
22 3300025304 Ga0209257_1000012 Ga0209257_1000012115 243
23 3300031852 Ga0307410_10095714 Ga0307410_100957142 243
24 3300031903 Ga0307407_10118065 Ga0307407_101180652 243
25 3300032002 Ga0307416_100814489 Ga0307416_1008144892 243
26 3300032005 Ga0307411_10101407 Ga0307411_101014073 243
27 3300046615 Ga0495656_0003437 Ga0495656_0003437_2717_3541 243
28 3300048905 Ga0496102_0001150 Ga0496102_0001150_11372_12178 244
29 3300006195 Ga0075366_10064902 Ga0075366_100649023 245
30 3300006353 Ga0075370_10179570 Ga0075370_101795702 245
31 3300025273 Ga0209673_1057768 Ga0209673_10577681 245
32 3300031730 Ga0307516_10056003 Ga0307516_100560034 245
33 3300046522 Ga0495643_0156810 Ga0495643_0156810_176_1000 245
34 3300050493 nmdc:mga0k408_182541_c1 nmdc:mga0k408_182541_c1_248_1081 245
35 3300050493 nmdc:mga0k408_46990_c1 nmdc:mga0k408_46990_c1_539_1372 245
36 3300050496 nmdc:mga07m45_50371_c1 nmdc:mga07m45_50371_c1_1056_1889 245
37 3300048928 Ga0496125_0016211 Ga0496125_0016211_924_1724 246
38 3300048929 Ga0496126_0137853 Ga0496126_0137853_808_1608 246
39 3300031456 Ga0307513_10385506 Ga0307513_103855062 247
40 3300048924 Ga0496121_0002603 Ga0496121_0002603_6328_7134 247
41 3300048928 Ga0496125_0012324 Ga0496125_0012324_7318_8124 247
42 3300041999 Ga0439433_0004487 Ga0439433_0004487_263_1081 248
43 3300042007 Ga0439449_0112897 Ga0439449_0112897_107_925 248
44 3300042015 Ga0439462_0028704 Ga0439462_0028704_328_1146 248
45 3300031507 Ga0307509_10017810 Ga0307509_100178107 250
46 3300033180 Ga0307510_10054706 Ga0307510_100547064 250
47 3300053161 Ga0500634_0034116 Ga0500634_0034116_903_1712 250
48 3300046454 Ga0495592_0000425 Ga0495592_0000425_15837_16640 251
49 3300037312 Ga0395899_0067719 Ga0395899_0067719_1075_1887 252
50 3300042004 Ga0439445_0005049 Ga0439445_0005049_532_1338 252
51 3300042115 Ga0450911_000061 Ga0450911_000061_26007_26813 252
52 3300037466 Ga0395898_0368660 Ga0395898_0368660_200_1015 253
53 3300005328 Ga0070676_10003217 Ga0070676_100032178 257
54 3300005334 Ga0068869_100009708 Ga0068869_1000097084 257
55 3300005338 Ga0068868_100010457 Ga0068868_1000104579 257
56 3300005354 Ga0070675_100248345 Ga0070675_1002483452 257
57 3300005355 Ga0070671_100007112 Ga0070671_1000071126 257
58 3300005364 Ga0070673_100010773 Ga0070673_1000107736 257
59 3300005459 Ga0068867_100001608 Ga0068867_1000016086 257
60 3300005543 Ga0070672_100010519 Ga0070672_1000105195 257
61 3300005577 Ga0068857_100064805 Ga0068857_1000648051 257
62 3300005840 Ga0068870_10046788 Ga0068870_100467882 257
63 3300006881 Ga0068865_100065562 Ga0068865_1000655623 257
64 3300009148 Ga0105243_10205885 Ga0105243_102058852 257
65 3300013308 Ga0157375_10522866 Ga0157375_105228662 257
66 3300025907 Ga0207645_10006310 Ga0207645_100063108 257
67 3300025926 Ga0207659_10003420 Ga0207659_100034207 257
68 3300025931 Ga0207644_10306493 Ga0207644_103064931 257
69 3300025940 Ga0207691_10026020 Ga0207691_100260203 257
70 3300025942 Ga0207689_10032536 Ga0207689_100325365 257
71 3300025960 Ga0207651_10007148 Ga0207651_100071482 257
72 3300025986 Ga0207658_10532678 Ga0207658_105326782 257
73 3300026023 Ga0207677_10207845 Ga0207677_102078452 257
74 3300026089 Ga0207648_10021517 Ga0207648_100215176 257
75 3300026116 Ga0207674_10110768 Ga0207674_101107684 257
76 3300047469 Ga0495673_0102107 Ga0495673_0102107_273_1064 257
77 iso_pu_bacteria 2585428058 2587732091 257
78 iso_pu_bacteria 2588253510 2588291148 257
79 iso_pu_bacteria 2643221592 2643969215 257
80 iso_pu_bacteria 2643221625 2644140789 257
81 iso_pu_bacteria 2643221648 2644272166 257
82 iso_pu_bacteria 2643221654 2644303927 257
83 3300037471 Ga0395905_0032480 Ga0395905_0032480_3924_4718 258
84 iso_pu_bacteria 2585428057 2587730671 258
85 3300009098 Ga0105245_10406148 Ga0105245_104061482 259
86 3300025940 Ga0207691_10034907 Ga0207691_100349074 259
87 3300047321 Ga0495676_0127978 Ga0495676_0127978_469_1266 259
88 3300050490 nmdc:mga03n38_37848_c1 nmdc:mga03n38_37848_c1_625_1434 259
89 3300050493 nmdc:mga0k408_4689_c1 nmdc:mga0k408_4689_c1_6252_7061 259
90 3300050493 nmdc:mga0k408_98709_c1 nmdc:mga0k408_98709_c1_226_1035 259
91 3300050496 nmdc:mga07m45_14492_c1 nmdc:mga07m45_14492_c1_628_1443 259
92 3300050496 nmdc:mga07m45_273055_c1 nmdc:mga07m45_273055_c1_10_819 259
93 3300050496 nmdc:mga07m45_97315_c1 nmdc:mga07m45_97315_c1_341_1150 259
94 3300050516 nmdc:mga0sz30_4916_c1 nmdc:mga0sz30_4916_c1_206_1015 259
95 iso_pu_bacteria 2585428062 2587758881 259
96 3300005331 Ga0070670_100101689 Ga0070670_1001016893 260
97 3300005335 Ga0070666_10280515 Ga0070666_102805152 260
98 3300005355 Ga0070671_100039304 Ga0070671_1000393042 260
99 3300005367 Ga0070667_100001541 Ga0070667_10000154118 260
100 3300005548 Ga0070665_100098554 Ga0070665_1000985545 260
101 3300005617 Ga0068859_100288614 Ga0068859_1002886142 260
102 3300005618 Ga0068864_100011625 Ga0068864_1000116256 260
103 3300005841 Ga0068863_100281444 Ga0068863_1002814442 260
104 3300006042 Ga0075368_10050437 Ga0075368_100504372 260
105 3300006178 Ga0075367_10039959 Ga0075367_100399592 260
106 3300006195 Ga0075366_10003828 Ga0075366_100038285 260
107 3300006195 Ga0075366_10005896 Ga0075366_100058965 260
108 3300006353 Ga0075370_10000058 Ga0075370_1000005826 260
109 3300006353 Ga0075370_10110239 Ga0075370_101102392 260
110 3300006353 Ga0075370_10169534 Ga0075370_101695341 260
111 3300006931 Ga0097620_100288605 Ga0097620_1002886052 260
112 3300009098 Ga0105245_10063034 Ga0105245_100630343 260
113 3300013297 Ga0157378_10206840 Ga0157378_102068403 260
114 3300013308 Ga0157375_10072461 Ga0157375_100724613 260
115 3300013308 Ga0157375_10361881 Ga0157375_103618813 260
116 3300014968 Ga0157379_10032799 Ga0157379_100327994 260
117 3300025927 Ga0207687_10042877 Ga0207687_100428773 260
118 3300025986 Ga0207658_10000856 Ga0207658_1000085611 260
119 3300028379 Ga0268266_10055007 Ga0268266_100550074 260
120 3300028786 Ga0307517_10003456 Ga0307517_100034564 260
121 3300028786 Ga0307517_10066413 Ga0307517_100664132 260
122 3300028786 Ga0307517_10239390 Ga0307517_102393901 260
123 3300028794 Ga0307515_10027522 Ga0307515_100275227 260
124 3300028794 Ga0307515_10119820 Ga0307515_101198202 260
125 3300028794 Ga0307515_10246653 Ga0307515_102466533 260
126 3300030522 Ga0307512_10087965 Ga0307512_100879653 260
127 3300031456 Ga0307513_10196640 Ga0307513_101966402 260
128 3300031507 Ga0307509_10011055 Ga0307509_100110552 260
129 3300031507 Ga0307509_10023641 Ga0307509_100236414 260
130 3300031507 Ga0307509_10034698 Ga0307509_100346984 260
131 3300031507 Ga0307509_10047897 Ga0307509_100478972 260
132 3300031507 Ga0307509_10137066 Ga0307509_101370662 260
133 3300031616 Ga0307508_10001470 Ga0307508_1000147022 260
134 3300031616 Ga0307508_10092039 Ga0307508_100920394 260
135 3300031616 Ga0307508_10201078 Ga0307508_102010782 260
136 3300031649 Ga0307514_10060430 Ga0307514_100604304 260
137 3300033180 Ga0307510_10014813 Ga0307510_100148138 260
138 3300046524 Ga0495648_0082178 Ga0495648_0082178_848_1648 260
139 3300048917 Ga0496114_0323126 Ga0496114_0323126_527_1327 260
140 3300050493 nmdc:mga0k408_1874_c2 nmdc:mga0k408_1874_c2_4007_4828 260
141 3300050493 nmdc:mga0k408_4962_c1 nmdc:mga0k408_4962_c1_2353_3174 260
142 3300050496 nmdc:mga07m45_57_c1 nmdc:mga07m45_57_c1_34209_35030 260
143 3300053086 Ga0500578_0009546 Ga0500578_0009546_2384_3181 260
144 3300053730 Ga0500645_003083 Ga0500645_003083_439_1236 260
145 3300003791 Ga0055530_10010859 Ga0055530_100108594 261
146 3300005262 Ga0065165_1002987 Ga0065165_10029878 261
147 3300005334 Ga0068869_100304033 Ga0068869_1003040332 261
148 3300005338 Ga0068868_100276869 Ga0068868_1002768692 261
149 3300005354 Ga0070675_100310250 Ga0070675_1003102502 261
150 3300005455 Ga0070663_100236991 Ga0070663_1002369912 261
151 3300005577 Ga0068857_100013202 Ga0068857_1000132025 261
152 3300005578 Ga0068854_100039147 Ga0068854_1000391472 261
153 3300005616 Ga0068852_100069901 Ga0068852_1000699014 261
154 3300005617 Ga0068859_100398122 Ga0068859_1003981222 261
155 3300006051 Ga0075364_10046917 Ga0075364_100469174 261
156 3300006177 Ga0075362_10085508 Ga0075362_100855083 261
157 3300006178 Ga0075367_10078855 Ga0075367_100788553 261
158 3300006178 Ga0075367_10084140 Ga0075367_100841403 261
159 3300006195 Ga0075366_10131828 Ga0075366_101318282 261
160 3300006195 Ga0075366_10216928 Ga0075366_102169282 261
161 3300006353 Ga0075370_10002893 Ga0075370_100028937 261
162 3300006353 Ga0075370_10168369 Ga0075370_101683692 261
163 3300006931 Ga0097620_100398139 Ga0097620_1003981392 261
164 3300009093 Ga0105240_10221417 Ga0105240_102214172 261
165 3300009148 Ga0105243_10256845 Ga0105243_102568452 261
166 3300009545 Ga0105237_10004239 Ga0105237_100042394 261
167 3300010375 Ga0105239_10215813 Ga0105239_102158133 261
168 3300025298 Ga0209050_1002192 Ga0209050_100219215 261
169 3300025913 Ga0207695_10263941 Ga0207695_102639412 261
170 3300025914 Ga0207671_10008882 Ga0207671_1000888210 261
171 3300025926 Ga0207659_10438672 Ga0207659_104386722 261
172 3300025935 Ga0207709_10052037 Ga0207709_100520372 261
173 3300025942 Ga0207689_10065499 Ga0207689_100654994 261
174 3300025986 Ga0207658_10577271 Ga0207658_105772711 261
175 3300026067 Ga0207678_10064563 Ga0207678_100645632 261
176 3300026095 Ga0207676_10334989 Ga0207676_103349892 261
177 3300026116 Ga0207674_10017514 Ga0207674_100175141 261
178 3300026142 Ga0207698_10144892 Ga0207698_101448923 261
179 3300028786 Ga0307517_10129992 Ga0307517_101299922 261
180 3300028794 Ga0307515_10325392 Ga0307515_103253922 261
181 3300031456 Ga0307513_10078590 Ga0307513_100785902 261
182 3300031456 Ga0307513_10308958 Ga0307513_103089582 261
183 3300033180 Ga0307510_10320946 Ga0307510_103209461 261
184 3300041452 Ga0451793_0782982 Ga0451793_0782982_273_1142 261
185 3300046460 Ga0495638_0027323 Ga0495638_0027323_2090_2884 261
186 3300046519 Ga0495632_0001710 Ga0495632_0001710_5046_5840 261
187 3300046519 Ga0495632_0022293 Ga0495632_0022293_187_1011 261
188 3300046660 Ga0495625_0074517 Ga0495625_0074517_55_888 261
189 3300046694 Ga0495649_0001974 Ga0495649_0001974_3344_4168 261
190 3300046810 Ga0495660_0032460 Ga0495660_0032460_687_1511 261
191 3300048091 Ga0495626_0043650 Ga0495626_0043650_1002_1826 261
192 3300050489 nmdc:mga03683_103011_c1 nmdc:mga03683_103011_c1_400_1224 261
193 3300050494 nmdc:mga06z11_14858_c1 nmdc:mga06z11_14858_c1_195_1019 261
194 3300053086 Ga0500578_0000224 Ga0500578_0000224_18589_19383 261
195 3300003215 JGI25153J46596_10001167 JGI25153J46596_1000116715 262
196 3300003215 JGI25153J46596_10007747 JGI25153J46596_100077474 262
197 3300003316 rootH1_10016854 rootH1_100168543 262
198 3300003771 Ga0055526_1007397 Ga0055526_10073976 262
199 3300005445 Ga0070708_100066375 Ga0070708_1000663754 262
200 3300005467 Ga0070706_100000761 Ga0070706_10000076123 262
201 3300005468 Ga0070707_100103020 Ga0070707_1001030202 262
202 3300005614 Ga0068856_100008360 Ga0068856_1000083603 262
203 3300006177 Ga0075362_10169941 Ga0075362_101699412 262
204 3300006195 Ga0075366_10014303 Ga0075366_100143034 262
205 3300006353 Ga0075370_10003344 Ga0075370_100033442 262
206 3300006353 Ga0075370_10004875 Ga0075370_100048753 262
207 3300025245 Ga0207425_1000511 Ga0207425_10005115 262
208 3300025258 Ga0209129_1000225 Ga0209129_100022538 262
209 3300025295 Ga0209564_1000196 Ga0209564_100019692 262
210 3300025297 Ga0209758_1000181 Ga0209758_100018138 262
211 3300025297 Ga0209758_1000207 Ga0209758_100020787 262
212 3300025910 Ga0207684_10002593 Ga0207684_1000259315 262
213 3300025922 Ga0207646_10167090 Ga0207646_101670902 262
214 3300026078 Ga0207702_10006680 Ga0207702_1000668010 262
215 3300027876 Ga0209974_10000953 Ga0209974_100009534 262
216 3300028794 Ga0307515_10000347 Ga0307515_10000347101 262
217 3300028794 Ga0307515_10002435 Ga0307515_1000243523 262
218 3300028794 Ga0307515_10012248 Ga0307515_1001224813 262
219 3300030522 Ga0307512_10114199 Ga0307512_101141992 262
220 3300031456 Ga0307513_10045648 Ga0307513_100456484 262
221 3300031507 Ga0307509_10017568 Ga0307509_100175688 262
222 3300031616 Ga0307508_10000392 Ga0307508_1000039217 262
223 3300031649 Ga0307514_10018273 Ga0307514_100182738 262
224 3300031730 Ga0307516_10001538 Ga0307516_100015384 262
225 3300041459 Ga0451800_0599260 Ga0451800_0599260_197_1015 262
226 3300046454 Ga0495592_0291411 Ga0495592_0291411_48_851 262
227 3300046512 Ga0495610_0021265 Ga0495610_0021265_2466_3284 262
228 3300046515 Ga0495620_0094272 Ga0495620_0094272_288_1106 262
229 3300046519 Ga0495632_0011271 Ga0495632_0011271_1523_2341 262
230 3300046519 Ga0495632_0142073 Ga0495632_0142073_137_934 262
231 3300046522 Ga0495643_0028812 Ga0495643_0028812_390_1208 262
232 3300046660 Ga0495625_0015039 Ga0495625_0015039_4558_5376 262
233 3300047472 Ga0495686_0073910 Ga0495686_0073910_967_1785 262
234 3300048905 Ga0496102_0028412 Ga0496102_0028412_483_1298 262
235 3300048928 Ga0496125_0005663 Ga0496125_0005663_6274_7077 262
236 3300048929 Ga0496126_0077294 Ga0496126_0077294_2102_2905 262
237 3300053117 Ga0500593_001750 Ga0500593_001750_2072_2887 262
238 3300053134 Ga0500658_0010242 Ga0500658_0010242_480_1298 262
239 3300053154 Ga0500619_000078 Ga0500619_000078_16071_16916 262
240 3300053739 Ga0500587_001305 Ga0500587_001305_83_901 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13723

Ketoacyl-synt_2

Beta-ketoacyl synthase, N-terminal domain

23

230

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qsp-assembly1.cif.gz_B ketosynthase (apeo) in complex with its chain length factor (apec) from xenorhabdus doucetiae 0.7191 1 258
6qsp-assembly1.cif.gz_B ketosynthase (apeo) in complex with its chain length factor (apec) from xenorhabdus doucetiae 0.7138 1 258
6et9-assembly1.cif.gz_C structure of the acetoacetyl-coa-thiolase/hmg-coa-synthase complex from methanothermococcus thermolithotrophicus at 2.75 a 0.695 1 167
6smo-assembly1.cif.gz_C antde:antf (apo): type ii pks acyl-carrier protein in complex with its ketosynthase bound to the hexaketide 0.6902 1 262
6smo-assembly1.cif.gz_C antde:antf (apo): type ii pks acyl-carrier protein in complex with its ketosynthase bound to the hexaketide 0.6879 1 262
ID Description Score Start End Superfamily
af_I1N0K0_10_263_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.681 4 190 3.40.47.10
af_O06586_1_415_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.6697 2 262 3.40.47.10
1dd8A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.6686 6 191 3.40.47.10
af_O06586_1_415_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.6654 2 262 3.40.47.10
af_I1K678_47_489_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.6595 3 262 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A6L3MK84-F1-model_v4 3-oxoacyl-ACP synthase 0.9395 5 63
AF-A0A259Q057-F1-model_v4 Uncharacterized protein 0.9021 177 262
AF-A0A838SJN2-F1-model_v4 Uncharacterized protein 0.9005 190 262
AF-A0A1G0DA70-F1-model_v4 Beta-ketoacyl synthase-like N-terminal domain-containing protein 0.8726 3 262 GO:0016746
AF-A0A1G0DA70-F1-model_v4 Beta-ketoacyl synthase-like N-terminal domain-containing protein 0.8633 3 262 GO:0016746

Feature Viewer

pLDDT pTM Quality
83.95 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map