F353033
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 91 | 480 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0199962|Ga0316574_0199962_390_1214 |
| Length | 274 |
| Sequence | MAGIDLYQAALRGVDVKEYSGERSPEAYTVSTLTWIVACGLLMSAIALVGSITLVLPAPTLDRLLLPLVAFAAGSLLGGAFFHMLPVAFSANPDTTVIGVAVVSGFTVFFVLEQFLHWHHCHLASGDCKQPMTYLLLVGDGLHNFLGGLAIAGIFLTDIRAGIAAWIAAALHEIPQELGDFGVLVRGGWAKPRALLFNVLSGLTFLLGGLVAYAVSFRSDLSWLIPFAAGNFIYIAAADLVPEVNKHGDADIRANLVHLVSFMLGLVLLLVVAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 11 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 12 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 13 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 14 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 15 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 16 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 17 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 18 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 19 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 20 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 21 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 37 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 38 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 39 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 40 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 41 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 42 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 43 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 44 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 45 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 46 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 47 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 48 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 49 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 50 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 51 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 52 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 53 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 54 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 55 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 56 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 57 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 58 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 59 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 60 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 61 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 62 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 63 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 64 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 65 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 66 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 67 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 69 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 70 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 71 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 72 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 73 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 74 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 75 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 76 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 77 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 78 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 79 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 80 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 81 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 82 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 83 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 84 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 85 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 86 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 87 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 88 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 89 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 90 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 91 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.33 |
| Nodule | 0 |
| Rhizoplane | 0.83 |
| Rhizosphere | 90.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316574_0199962 | 3300035398 | Bacteria | 1284 |
| 2 | Ga0068869_100081412 | 3300005334 | Bacteria | 2418 |
| 3 | Ga0070661_100098500 | 3300005344 | Bacteria | 2172 |
| 4 | Ga0070668_100045938 | 3300005347 | Bacteria | 3352 |
| 5 | Ga0070673_100101092 | 3300005364 | Bacteria | 2375 |
| 6 | Ga0070663_100022827 | 3300005455 | Bacteria | 4187 |
| 7 | Ga0070672_100267834 | 3300005543 | Bacteria | 1442 |
| 8 | Ga0070665_100061942 | 3300005548 | Bacteria | 3751 |
| 9 | Ga0070664_100233743 | 3300005564 | Bacteria | 1648 |
| 10 | Ga0068854_100389742 | 3300005578 | Bacteria | 1150 |
| 11 | Ga0068864_100031753 | 3300005618 | Bacteria | 4482 |
| 12 | Ga0068861_100063274 | 3300005719 | Bacteria | 2844 |
| 13 | Ga0068860_100097048 | 3300005843 | Unclassified | 2810 |
| 14 | Ga0075365_10264317 | 3300006038 | Bacteria | 1210 |
| 15 | Ga0075368_10014108 | 3300006042 | Bacteria | 2946 |
| 16 | Ga0075368_10058176 | 3300006042 | Bacteria | 1544 |
| 17 | Ga0075364_10126228 | 3300006051 | Unclassified | 1715 |
| 18 | Ga0075362_10168063 | 3300006177 | Bacteria | 1058 |
| 19 | Ga0075367_10014414 | 3300006178 | Bacteria | 4279 |
| 20 | Ga0075367_10018577 | 3300006178 | Bacteria | 3840 |
| 21 | Ga0075367_10020424 | 3300006178 | Bacteria | 3688 |
| 22 | Ga0075366_10005122 | 3300006195 | Bacteria | 7090 |
| 23 | Ga0075366_10043415 | 3300006195 | Bacteria | 2663 |
| 24 | Ga0075366_10050696 | 3300006195 | Bacteria | 2465 |
| 25 | Ga0075366_10078557 | 3300006195 | Bacteria | 1970 |
| 26 | Ga0075370_10021282 | 3300006353 | Bacteria | 3553 |
| 27 | Ga0105248_10021171 | 3300009177 | Bacteria | 7205 |
| 28 | Ga0105238_10283766 | 3300009551 | Bacteria | 1637 |
| 29 | Ga0105249_10864894 | 3300009553 | Bacteria | 970 |
| 30 | Ga0157375_10164899 | 3300013308 | Bacteria | 2360 |
| 31 | Ga0163163_10165085 | 3300014325 | Bacteria | 2260 |
| 32 | Ga0163163_10727848 | 3300014325 | Unclassified | 1056 |
| 33 | Ga0207691_10045231 | 3300025940 | Bacteria | 4047 |
| 34 | Ga0207711_10119174 | 3300025941 | Bacteria | 2355 |
| 35 | Ga0207679_10042065 | 3300025945 | Bacteria | 3281 |
| 36 | Ga0207651_10077900 | 3300025960 | Bacteria | 2375 |
| 37 | Ga0207651_10518000 | 3300025960 | Unclassified | 1033 |
| 38 | Ga0207668_10184547 | 3300025972 | Bacteria | 1648 |
| 39 | Ga0207678_10027681 | 3300026067 | Bacteria | 4948 |
| 40 | Ga0207678_10211242 | 3300026067 | Bacteria | 1660 |
| 41 | Ga0207675_100064966 | 3300026118 | Bacteria | 3411 |
| 42 | Ga0209973_1002234 | 3300027252 | Unclassified | 1789 |
| 43 | Ga0209974_10004790 | 3300027876 | Bacteria | 4800 |
| 44 | Ga0268266_10078955 | 3300028379 | Bacteria | 2865 |
| 45 | Ga0316575_10002665 | 3300031665 | Bacteria | 6013 |
| 46 | Ga0316575_10070861 | 3300031665 | Bacteria | 1400 |
| 47 | Ga0316579_10095526 | 3300031691 | Bacteria | 1421 |
| 48 | Ga0316576_10005537 | 3300031727 | Bacteria | 7731 |
| 49 | Ga0316576_10010909 | 3300031727 | Bacteria | 5926 |
| 50 | Ga0316576_10022679 | 3300031727 | Bacteria | 4363 |
| 51 | Ga0316576_10107251 | 3300031727 | Bacteria | 2092 |
| 52 | Ga0316576_10123864 | 3300031727 | Bacteria | 1942 |
| 53 | Ga0316576_10124261 | 3300031727 | Archaea | 1939 |
| 54 | Ga0316576_10142939 | 3300031727 | Unclassified | 1802 |
| 55 | Ga0316576_10180397 | 3300031727 | Bacteria | 1593 |
| 56 | Ga0316576_10208298 | 3300031727 | Bacteria | 1472 |
| 57 | Ga0316576_10250990 | 3300031727 | Bacteria | 1328 |
| 58 | Ga0316578_10000934 | 3300031728 | Bacteria | 11095 |
| 59 | Ga0316578_10073246 | 3300031728 | Bacteria | 2030 |
| 60 | Ga0316578_10083365 | 3300031728 | Bacteria | 1904 |
| 61 | Ga0316578_10085432 | 3300031728 | Bacteria | 1881 |
| 62 | Ga0316578_10230099 | 3300031728 | Unclassified | 1114 |
| 63 | Ga0316577_10027957 | 3300031733 | Bacteria | 3145 |
| 64 | Ga0316577_10164610 | 3300031733 | Bacteria | 1251 |
| 65 | Ga0316583_10007457 | 3300032133 | Bacteria | 3938 |
| 66 | Ga0316585_10003220 | 3300032137 | Bacteria | 4465 |
| 67 | Ga0316580_10117072 | 3300032139 | Bacteria | 816 |
| 68 | Ga0316574_0010028 | 3300035398 | Bacteria | 5331 |
| 69 | Ga0316574_0019797 | 3300035398 | Bacteria | 3976 |
| 70 | Ga0316574_0039768 | 3300035398 | Bacteria | 2894 |
| 71 | Ga0316574_0042258 | 3300035398 | Bacteria | 2812 |
| 72 | Ga0316574_0049001 | 3300035398 | Bacteria | 2625 |
| 73 | Ga0316574_0062900 | 3300035398 | Bacteria | 2333 |
| 74 | Ga0316574_0082350 | 3300035398 | Unclassified | 2045 |
| 75 | Ga0316574_0131414 | 3300035398 | Bacteria | 1611 |
| 76 | Ga0316574_0186619 | 3300035398 | Archaea | 1334 |
| 77 | Ga0316574_0230840 | 3300035398 | Unclassified | 1184 |
| 78 | Ga0316574_0258797 | 3300035398 | Bacteria | 1111 |
| 79 | Ga0373937_0180984 | 3300036401 | Bacteria | 1979 |
| 80 | Ga0316582_0001240 | 3300036647 | Bacteria | 10997 |
| 81 | Ga0316582_0102027 | 3300036647 | Bacteria | 1901 |
| 82 | Ga0316582_0236158 | 3300036647 | Bacteria | 1252 |
| 83 | Ga0316584_0000934 | 3300036712 | Bacteria | 16623 |
| 84 | Ga0316584_0017035 | 3300036712 | Bacteria | 5217 |
| 85 | Ga0316584_0041832 | 3300036712 | Bacteria | 3416 |
| 86 | Ga0316584_0065381 | 3300036712 | Bacteria | 2724 |
| 87 | Ga0316584_0083814 | 3300036712 | Bacteria | 2388 |
| 88 | Ga0316584_0124322 | 3300036712 | Bacteria | 1927 |
| 89 | Ga0316584_0229963 | 3300036712 | Bacteria | 1360 |
| 90 | Ga0316584_0267040 | 3300036712 | Bacteria | 1246 |
| 91 | Ga0316584_0307785 | 3300036712 | Bacteria | 1146 |
| 92 | Ga0316584_0368330 | 3300036712 | Bacteria | 1029 |
| 93 | Ga0316584_0375668 | 3300036712 | Bacteria | 1017 |
| 94 | Ga0316584_0730972 | 3300036712 | Bacteria | 676 |
| 95 | Ga0451807_1916620 | 3300041486 | Bacteria | 1468 |
| 96 | Ga0450920_003347 | 3300042122 | Bacteria | 2770 |
| 97 | Ga0450923_010536 | 3300042125 | Unclassified | 1643 |
| 98 | Ga0450898_017486 | 3300042134 | Bacteria | 1234 |
| 99 | Ga0450908_008436 | 3300042184 | Unclassified | 1931 |
| 100 | Ga0450918_005019 | 3300042531 | Unclassified | 2384 |
| 101 | Ga0496110_0429117 | 3300048913 | Bacteria | 1205 |
| 102 | Ga0501031_0017169 | 3300049568 | Bacteria | 4703 |
| 103 | Ga0501031_0398012 | 3300049568 | Bacteria | 891 |
| 104 | Ga0501033_0054169 | 3300049570 | Bacteria | 2969 |
| 105 | Ga0501033_0068062 | 3300049570 | Bacteria | 2618 |
| 106 | Ga0501033_0082351 | 3300049570 | Bacteria | 2360 |
| 107 | Ga0501033_0172927 | 3300049570 | Bacteria | 1551 |
| 108 | Ga0501034_0099216 | 3300049571 | Bacteria | 2907 |
| 109 | Ga0501036_0036806 | 3300049572 | Bacteria | 4140 |
| 110 | Ga0501036_0041822 | 3300049572 | Bacteria | 3878 |
| 111 | Ga0501036_0044856 | 3300049572 | Bacteria | 3746 |
| 112 | Ga0501036_0108020 | 3300049572 | Bacteria | 2353 |
| 113 | Ga0501037_0069932 | 3300049573 | Bacteria | 2555 |
| 114 | Ga0501037_0187345 | 3300049573 | Bacteria | 1466 |
| 115 | Ga0501037_0238968 | 3300049573 | Bacteria | 1274 |
| 116 | Ga0501038_0005385 | 3300049574 | Bacteria | 11892 |
| 117 | Ga0501038_0046484 | 3300049574 | Bacteria | 3763 |
| 118 | Ga0501038_0124550 | 3300049574 | Bacteria | 2122 |
| 119 | Ga0501038_0245143 | 3300049574 | Bacteria | 1421 |
| 120 | Ga0501038_0326284 | 3300049574 | Bacteria | 1200 |
| 121 | Ga0501039_0019918 | 3300049575 | Bacteria | 5143 |
| 122 | Ga0501039_0038900 | 3300049575 | Bacteria | 3673 |
| 123 | Ga0501039_0078191 | 3300049575 | Bacteria | 2573 |
| 124 | Ga0501039_0080804 | 3300049575 | Bacteria | 2530 |
| 125 | Ga0501039_0165124 | 3300049575 | Bacteria | 1741 |
| 126 | Ga0501039_0405414 | 3300049575 | Bacteria | 1071 |
| 127 | Ga0501040_0001066 | 3300049576 | Bacteria | 17355 |
| 128 | Ga0501040_0011366 | 3300049576 | Bacteria | 5829 |
| 129 | Ga0501040_0020683 | 3300049576 | Bacteria | 4388 |
| 130 | Ga0501040_0029325 | 3300049576 | Bacteria | 3714 |
| 131 | Ga0501040_0029710 | 3300049576 | Bacteria | 3690 |
| 132 | Ga0501040_0378107 | 3300049576 | Bacteria | 1016 |
| 133 | Ga0501041_0025160 | 3300049577 | Bacteria | 3578 |
| 134 | Ga0501041_0061584 | 3300049577 | Bacteria | 2297 |
| 135 | Ga0501041_0130358 | 3300049577 | Bacteria | 1566 |
| 136 | Ga0501041_0158712 | 3300049577 | Bacteria | 1413 |
| 137 | Ga0501041_0263019 | 3300049577 | Bacteria | 1085 |
| 138 | Ga0501042_0000681 | 3300049578 | Bacteria | 18367 |
| 139 | Ga0501042_0058839 | 3300049578 | Bacteria | 2743 |
| 140 | Ga0501043_0104170 | 3300049579 | Bacteria | 2229 |
| 141 | Ga0501046_0011111 | 3300049580 | Bacteria | 7710 |
| 142 | Ga0501046_0037886 | 3300049580 | Bacteria | 3873 |
| 143 | Ga0501046_0037906 | 3300049580 | Bacteria | 3872 |
| 144 | Ga0501046_0043038 | 3300049580 | Bacteria | 3597 |
| 145 | Ga0501046_0142220 | 3300049580 | Bacteria | 1815 |
| 146 | Ga0501048_0098651 | 3300049582 | Bacteria | 2060 |
| 147 | Ga0501048_0234837 | 3300049582 | Bacteria | 1301 |
| 148 | Ga0501068_0018323 | 3300049584 | Bacteria | 4056 |
| 149 | Ga0501068_0019696 | 3300049584 | Unclassified | 3922 |
| 150 | Ga0501069_0143300 | 3300049585 | Bacteria | 1371 |
| 151 | Ga0501070_0206631 | 3300049586 | Bacteria | 1612 |
| 152 | Ga0501071_0043389 | 3300049587 | Unclassified | 3224 |
| 153 | Ga0501071_0082956 | 3300049587 | Bacteria | 2348 |
| 154 | Ga0501071_0140846 | 3300049587 | Bacteria | 1796 |
| 155 | Ga0501071_0193965 | 3300049587 | Bacteria | 1524 |
| 156 | Ga0501071_0264547 | 3300049587 | Bacteria | 1299 |
| 157 | Ga0501071_0438394 | 3300049587 | Unclassified | 999 |
| 158 | Ga0501072_0000963 | 3300049588 | Bacteria | 21237 |
| 159 | Ga0501072_0008532 | 3300049588 | Bacteria | 7771 |
| 160 | Ga0501072_0043285 | 3300049588 | Bacteria | 3538 |
| 161 | Ga0501072_0197219 | 3300049588 | Bacteria | 1605 |
| 162 | Ga0501072_0727824 | 3300049588 | Bacteria | 779 |
| 163 | Ga0501073_0111198 | 3300049589 | Bacteria | 1900 |
| 164 | Ga0501074_0010331 | 3300049590 | Bacteria | 6772 |
| 165 | Ga0501074_0224428 | 3300049590 | Bacteria | 1337 |
| 166 | Ga0501075_0000764 | 3300049591 | Bacteria | 20098 |
| 167 | Ga0501075_0004954 | 3300049591 | Bacteria | 9075 |
| 168 | Ga0501075_0112994 | 3300049591 | Unclassified | 2065 |
| 169 | Ga0501075_0117708 | 3300049591 | Bacteria | 2020 |
| 170 | Ga0501075_0162160 | 3300049591 | Bacteria | 1706 |
| 171 | Ga0501075_0647973 | 3300049591 | Unclassified | 805 |
| 172 | Ga0501076_0001139 | 3300049592 | Bacteria | 17608 |
| 173 | Ga0501076_0002770 | 3300049592 | Bacteria | 12132 |
| 174 | Ga0501076_0020853 | 3300049592 | Bacteria | 5018 |
| 175 | Ga0501076_0058989 | 3300049592 | Bacteria | 3052 |
| 176 | Ga0501076_0076528 | 3300049592 | Bacteria | 2684 |
| 177 | Ga0501076_0173845 | 3300049592 | Unclassified | 1756 |
| 178 | Ga0501076_0403746 | 3300049592 | Bacteria | 1124 |
| 179 | Ga0501077_0000989 | 3300049593 | Bacteria | 17098 |
| 180 | Ga0501077_0023368 | 3300049593 | Bacteria | 3920 |
| 181 | Ga0501077_0049848 | 3300049593 | Bacteria | 2661 |
| 182 | Ga0501077_0078253 | 3300049593 | Bacteria | 2096 |
| 183 | Ga0501077_0353318 | 3300049593 | Bacteria | 938 |
| 184 | Ga0501079_0000379 | 3300049741 | Bacteria | 28580 |
| 185 | Ga0501079_0004461 | 3300049741 | Bacteria | 10377 |
| 186 | Ga0501079_0008185 | 3300049741 | Bacteria | 7922 |
| 187 | Ga0501079_0064214 | 3300049741 | Bacteria | 2832 |
| 188 | Ga0501080_0021611 | 3300049742 | Bacteria | 5957 |
| 189 | Ga0501080_0040128 | 3300049742 | Bacteria | 4367 |
| 190 | Ga0501080_0047421 | 3300049742 | Bacteria | 3999 |
| 191 | Ga0501080_0080337 | 3300049742 | Bacteria | 3031 |
| 192 | Ga0501080_0875705 | 3300049742 | Unclassified | 784 |
| 193 | Ga0501081_0000033 | 3300049743 | Bacteria | 51492 |
| 194 | Ga0501081_0004696 | 3300049743 | Bacteria | 8786 |
| 195 | Ga0501081_0014012 | 3300049743 | Bacteria | 5280 |
| 196 | Ga0501081_0045838 | 3300049743 | Bacteria | 3003 |
| 197 | Ga0501081_0095908 | 3300049743 | Bacteria | 2091 |
| 198 | Ga0501081_0101041 | 3300049743 | Bacteria | 2039 |
| 199 | Ga0501081_0263932 | 3300049743 | Bacteria | 1259 |
| 200 | Ga0501081_0755174 | 3300049743 | Bacteria | 731 |
| 201 | Ga0501083_0036076 | 3300049744 | Bacteria | 3374 |
| 202 | Ga0501083_0083863 | 3300049744 | Bacteria | 2111 |
| 203 | Ga0501083_0096079 | 3300049744 | Bacteria | 1955 |
| 204 | Ga0501083_0219742 | 3300049744 | Bacteria | 1238 |
| 205 | Ga0501035_0026063 | 3300049822 | Bacteria | 5354 |
| 206 | Ga0501035_0140523 | 3300049822 | Bacteria | 2100 |
| 207 | Ga0501035_0211700 | 3300049822 | Bacteria | 1658 |
| 208 | Ga0501044_0518419 | 3300049823 | Bacteria | 1092 |
| 209 | Ga0501045_0002885 | 3300049824 | Bacteria | 11740 |
| 210 | Ga0501045_0014002 | 3300049824 | Bacteria | 5677 |
| 211 | Ga0501045_0075799 | 3300049824 | Bacteria | 2477 |
| 212 | Ga0501045_0085369 | 3300049824 | Bacteria | 2330 |
| 213 | Ga0501045_0103742 | 3300049824 | Bacteria | 2106 |
| 214 | Ga0501045_0155764 | 3300049824 | Bacteria | 1700 |
| 215 | Ga0501045_0180494 | 3300049824 | Bacteria | 1573 |
| 216 | nmdc:mga0k408_13390_c1 | 3300050493 | Bacteria | 4496 |
| 217 | nmdc:mga0k408_15245_c1 | 3300050493 | Bacteria | 4248 |
| 218 | nmdc:mga0k408_31688_c1 | 3300050493 | Bacteria | 3020 |
| 219 | nmdc:mga06z11_15497_c1 | 3300050494 | Bacteria | 3404 |
| 220 | nmdc:mga06z11_182198_c1 | 3300050494 | Bacteria | 1212 |
| 221 | nmdc:mga06z11_86765_c1 | 3300050494 | Bacteria | 1691 |
| 222 | nmdc:mga0n895_321788_c1 | 3300050512 | Unclassified | 1567 |
| 223 | Ga0500641_0001041 | 3300053096 | Bacteria | 9871 |
| 224 | Ga0501084_0008917 | 3300054114 | Bacteria | 8298 |
| 225 | Ga0501084_0073942 | 3300054114 | Bacteria | 2853 |
| 226 | Ga0501084_0184320 | 3300054114 | Bacteria | 1762 |
| 227 | Ga0501084_0222155 | 3300054114 | Bacteria | 1594 |
| 228 | Ga0590077_006054 | 3300059426 | Bacteria | 2481 |
| 229 | Ga0501082_0001333 | 3300060353 | Bacteria | 21634 |
| 230 | Ga0501082_0048996 | 3300060353 | Bacteria | 3642 |
| 231 | Ga0501082_0114249 | 3300060353 | Unclassified | 2338 |
| 232 | Ga0501082_0129465 | 3300060353 | Bacteria | 2189 |
| 233 | Ga0501082_0250958 | 3300060353 | Bacteria | 1540 |
| 234 | Ga0501082_0252700 | 3300060353 | Bacteria | 1534 |
| 235 | Ga0501082_0262725 | 3300060353 | Unclassified | 1502 |
| 236 | Ga0530510_0004682 | 3300061734 | Bacteria | 9462 |
| 237 | Ga0530510_0006180 | 3300061734 | Bacteria | 8322 |
| 238 | Ga0530510_0009598 | 3300061734 | Bacteria | 6786 |
| 239 | Ga0530510_0141146 | 3300061734 | Bacteria | 1775 |
| 240 | Ga0530510_0699320 | 3300061734 | Unclassified | 772 |
| 241 | Ga0316574_0199962 | |||
| 242 | Ga0068869_100081412 | |||
| 243 | Ga0070661_100098500 | |||
| 244 | Ga0070668_100045938 | |||
| 245 | Ga0070673_100101092 | |||
| 246 | Ga0070663_100022827 | |||
| 247 | Ga0070672_100267834 | |||
| 248 | Ga0070665_100061942 | |||
| 249 | Ga0070664_100233743 | |||
| 250 | Ga0068854_100389742 | |||
| 251 | Ga0068864_100031753 | |||
| 252 | Ga0068861_100063274 | |||
| 253 | Ga0068860_100097048 | |||
| 254 | Ga0075365_10264317 | |||
| 255 | Ga0075368_10014108 | |||
| 256 | Ga0075368_10058176 | |||
| 257 | Ga0075364_10126228 | |||
| 258 | Ga0075362_10168063 | |||
| 259 | Ga0075367_10014414 | |||
| 260 | Ga0075367_10018577 | |||
| 261 | Ga0075367_10020424 | |||
| 262 | Ga0075366_10005122 | |||
| 263 | Ga0075366_10043415 | |||
| 264 | Ga0075366_10050696 | |||
| 265 | Ga0075366_10078557 | |||
| 266 | Ga0075370_10021282 | |||
| 267 | Ga0105248_10021171 | |||
| 268 | Ga0105238_10283766 | |||
| 269 | Ga0105249_10864894 | |||
| 270 | Ga0157375_10164899 | |||
| 271 | Ga0163163_10165085 | |||
| 272 | Ga0163163_10727848 | |||
| 273 | Ga0207691_10045231 | |||
| 274 | Ga0207711_10119174 | |||
| 275 | Ga0207679_10042065 | |||
| 276 | Ga0207651_10077900 | |||
| 277 | Ga0207651_10518000 | |||
| 278 | Ga0207668_10184547 | |||
| 279 | Ga0207678_10027681 | |||
| 280 | Ga0207678_10211242 | |||
| 281 | Ga0207675_100064966 | |||
| 282 | Ga0209973_1002234 | |||
| 283 | Ga0209974_10004790 | |||
| 284 | Ga0268266_10078955 | |||
| 285 | Ga0316575_10002665 | |||
| 286 | Ga0316575_10070861 | |||
| 287 | Ga0316579_10095526 | |||
| 288 | Ga0316576_10005537 | |||
| 289 | Ga0316576_10010909 | |||
| 290 | Ga0316576_10022679 | |||
| 291 | Ga0316576_10107251 | |||
| 292 | Ga0316576_10123864 | |||
| 293 | Ga0316576_10124261 | |||
| 294 | Ga0316576_10142939 | |||
| 295 | Ga0316576_10180397 | |||
| 296 | Ga0316576_10208298 | |||
| 297 | Ga0316576_10250990 | |||
| 298 | Ga0316578_10000934 | |||
| 299 | Ga0316578_10073246 | |||
| 300 | Ga0316578_10083365 | |||
| 301 | Ga0316578_10085432 | |||
| 302 | Ga0316578_10230099 | |||
| 303 | Ga0316577_10027957 | |||
| 304 | Ga0316577_10164610 | |||
| 305 | Ga0316583_10007457 | |||
| 306 | Ga0316585_10003220 | |||
| 307 | Ga0316580_10117072 | |||
| 308 | Ga0316574_0010028 | |||
| 309 | Ga0316574_0019797 | |||
| 310 | Ga0316574_0039768 | |||
| 311 | Ga0316574_0042258 | |||
| 312 | Ga0316574_0049001 | |||
| 313 | Ga0316574_0062900 | |||
| 314 | Ga0316574_0082350 | |||
| 315 | Ga0316574_0131414 | |||
| 316 | Ga0316574_0186619 | |||
| 317 | Ga0316574_0230840 | |||
| 318 | Ga0316574_0258797 | |||
| 319 | Ga0373937_0180984 | |||
| 320 | Ga0316582_0001240 | |||
| 321 | Ga0316582_0102027 | |||
| 322 | Ga0316582_0236158 | |||
| 323 | Ga0316584_0000934 | |||
| 324 | Ga0316584_0017035 | |||
| 325 | Ga0316584_0041832 | |||
| 326 | Ga0316584_0065381 | |||
| 327 | Ga0316584_0083814 | |||
| 328 | Ga0316584_0124322 | |||
| 329 | Ga0316584_0229963 | |||
| 330 | Ga0316584_0267040 | |||
| 331 | Ga0316584_0307785 | |||
| 332 | Ga0316584_0368330 | |||
| 333 | Ga0316584_0375668 | |||
| 334 | Ga0316584_0730972 | |||
| 335 | Ga0451807_1916620 | |||
| 336 | Ga0450920_003347 | |||
| 337 | Ga0450923_010536 | |||
| 338 | Ga0450898_017486 | |||
| 339 | Ga0450908_008436 | |||
| 340 | Ga0450918_005019 | |||
| 341 | Ga0496110_0429117 | |||
| 342 | Ga0501031_0017169 | |||
| 343 | Ga0501031_0398012 | |||
| 344 | Ga0501033_0054169 | |||
| 345 | Ga0501033_0068062 | |||
| 346 | Ga0501033_0082351 | |||
| 347 | Ga0501033_0172927 | |||
| 348 | Ga0501034_0099216 | |||
| 349 | Ga0501036_0036806 | |||
| 350 | Ga0501036_0041822 | |||
| 351 | Ga0501036_0044856 | |||
| 352 | Ga0501036_0108020 | |||
| 353 | Ga0501037_0069932 | |||
| 354 | Ga0501037_0187345 | |||
| 355 | Ga0501037_0238968 | |||
| 356 | Ga0501038_0005385 | |||
| 357 | Ga0501038_0046484 | |||
| 358 | Ga0501038_0124550 | |||
| 359 | Ga0501038_0245143 | |||
| 360 | Ga0501038_0326284 | |||
| 361 | Ga0501039_0019918 | |||
| 362 | Ga0501039_0038900 | |||
| 363 | Ga0501039_0078191 | |||
| 364 | Ga0501039_0080804 | |||
| 365 | Ga0501039_0165124 | |||
| 366 | Ga0501039_0405414 | |||
| 367 | Ga0501040_0001066 | |||
| 368 | Ga0501040_0011366 | |||
| 369 | Ga0501040_0020683 | |||
| 370 | Ga0501040_0029325 | |||
| 371 | Ga0501040_0029710 | |||
| 372 | Ga0501040_0378107 | |||
| 373 | Ga0501041_0025160 | |||
| 374 | Ga0501041_0061584 | |||
| 375 | Ga0501041_0130358 | |||
| 376 | Ga0501041_0158712 | |||
| 377 | Ga0501041_0263019 | |||
| 378 | Ga0501042_0000681 | |||
| 379 | Ga0501042_0058839 | |||
| 380 | Ga0501043_0104170 | |||
| 381 | Ga0501046_0011111 | |||
| 382 | Ga0501046_0037886 | |||
| 383 | Ga0501046_0037906 | |||
| 384 | Ga0501046_0043038 | |||
| 385 | Ga0501046_0142220 | |||
| 386 | Ga0501048_0098651 | |||
| 387 | Ga0501048_0234837 | |||
| 388 | Ga0501068_0018323 | |||
| 389 | Ga0501068_0019696 | |||
| 390 | Ga0501069_0143300 | |||
| 391 | Ga0501070_0206631 | |||
| 392 | Ga0501071_0043389 | |||
| 393 | Ga0501071_0082956 | |||
| 394 | Ga0501071_0140846 | |||
| 395 | Ga0501071_0193965 | |||
| 396 | Ga0501071_0264547 | |||
| 397 | Ga0501071_0438394 | |||
| 398 | Ga0501072_0000963 | |||
| 399 | Ga0501072_0008532 | |||
| 400 | Ga0501072_0043285 | |||
| 401 | Ga0501072_0197219 | |||
| 402 | Ga0501072_0727824 | |||
| 403 | Ga0501073_0111198 | |||
| 404 | Ga0501074_0010331 | |||
| 405 | Ga0501074_0224428 | |||
| 406 | Ga0501075_0000764 | |||
| 407 | Ga0501075_0004954 | |||
| 408 | Ga0501075_0112994 | |||
| 409 | Ga0501075_0117708 | |||
| 410 | Ga0501075_0162160 | |||
| 411 | Ga0501075_0647973 | |||
| 412 | Ga0501076_0001139 | |||
| 413 | Ga0501076_0002770 | |||
| 414 | Ga0501076_0020853 | |||
| 415 | Ga0501076_0058989 | |||
| 416 | Ga0501076_0076528 | |||
| 417 | Ga0501076_0173845 | |||
| 418 | Ga0501076_0403746 | |||
| 419 | Ga0501077_0000989 | |||
| 420 | Ga0501077_0023368 | |||
| 421 | Ga0501077_0049848 | |||
| 422 | Ga0501077_0078253 | |||
| 423 | Ga0501077_0353318 | |||
| 424 | Ga0501079_0000379 | |||
| 425 | Ga0501079_0004461 | |||
| 426 | Ga0501079_0008185 | |||
| 427 | Ga0501079_0064214 | |||
| 428 | Ga0501080_0021611 | |||
| 429 | Ga0501080_0040128 | |||
| 430 | Ga0501080_0047421 | |||
| 431 | Ga0501080_0080337 | |||
| 432 | Ga0501080_0875705 | |||
| 433 | Ga0501081_0000033 | |||
| 434 | Ga0501081_0004696 | |||
| 435 | Ga0501081_0014012 | |||
| 436 | Ga0501081_0045838 | |||
| 437 | Ga0501081_0095908 | |||
| 438 | Ga0501081_0101041 | |||
| 439 | Ga0501081_0263932 | |||
| 440 | Ga0501081_0755174 | |||
| 441 | Ga0501083_0036076 | |||
| 442 | Ga0501083_0083863 | |||
| 443 | Ga0501083_0096079 | |||
| 444 | Ga0501083_0219742 | |||
| 445 | Ga0501035_0026063 | |||
| 446 | Ga0501035_0140523 | |||
| 447 | Ga0501035_0211700 | |||
| 448 | Ga0501044_0518419 | |||
| 449 | Ga0501045_0002885 | |||
| 450 | Ga0501045_0014002 | |||
| 451 | Ga0501045_0075799 | |||
| 452 | Ga0501045_0085369 | |||
| 453 | Ga0501045_0103742 | |||
| 454 | Ga0501045_0155764 | |||
| 455 | Ga0501045_0180494 | |||
| 456 | nmdc:mga0k408_13390_c1 | |||
| 457 | nmdc:mga0k408_15245_c1 | |||
| 458 | nmdc:mga0k408_31688_c1 | |||
| 459 | nmdc:mga06z11_15497_c1 | |||
| 460 | nmdc:mga06z11_182198_c1 | |||
| 461 | nmdc:mga06z11_86765_c1 | |||
| 462 | nmdc:mga0n895_321788_c1 | |||
| 463 | Ga0500641_0001041 | |||
| 464 | Ga0501084_0008917 | |||
| 465 | Ga0501084_0073942 | |||
| 466 | Ga0501084_0184320 | |||
| 467 | Ga0501084_0222155 | |||
| 468 | Ga0590077_006054 | |||
| 469 | Ga0501082_0001333 | |||
| 470 | Ga0501082_0048996 | |||
| 471 | Ga0501082_0114249 | |||
| 472 | Ga0501082_0129465 | |||
| 473 | Ga0501082_0250958 | |||
| 474 | Ga0501082_0252700 | |||
| 475 | Ga0501082_0262725 | |||
| 476 | Ga0530510_0004682 | |||
| 477 | Ga0530510_0006180 | |||
| 478 | Ga0530510_0009598 | |||
| 479 | Ga0530510_0141146 | |||
| 480 | Ga0530510_0699320 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8czj-assembly1.cif.gz_A | a bacteria zrt/irt-like protein in the apo state | 0.8438 | 7 | 247 |
| 8czj-assembly1.cif.gz_B | a bacteria zrt/irt-like protein in the apo state | 0.8202 | 7 | 247 |
| 8czj-assembly1.cif.gz_A | a bacteria zrt/irt-like protein in the apo state | 0.8097 | 7 | 247 |
| 8czj-assembly1.cif.gz_B | a bacteria zrt/irt-like protein in the apo state | 0.7899 | 7 | 247 |
| 7z6m-assembly1.cif.gz_A-2 | crystal structure of zn2+-transporter bbzip in a cadmium bound state | 0.7698 | 6 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZP8_8_190_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3787 | 33 | 216 | 1.20.1250.20 |
| af_Q01818_292_487_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3697 | 41 | 214 | 1.20.1250.20 |
| af_P33580_28_239_1.20.1250.10 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; | 0.3686 | 38 | 197 | 1.20.1250.10 |
| af_Q54EX8_313_506_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3656 | 38 | 218 | 1.20.1250.20 |
| 3o7qA02 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3639 | 26 | 214 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382SQZ0-F1-model_v4 | ZIP zinc transporter | 0.9684 | 6 | 220 |
GO:0016020
GO:0046873 |
| AF-A0A2V8AF31-F1-model_v4 | ZIP zinc transporter | 0.9679 | 7 | 248 |
GO:0005385
GO:0006882 GO:0016020 |
| AF-A0A2E7BMD4-F1-model_v4 | ZIP zinc transporter | 0.9645 | 2 | 248 |
GO:0016020
GO:0046873 |
| AF-A0A3N5P169-F1-model_v4 | ZIP family metal transporter | 0.962 | 1 | 246 |
GO:0005385
GO:0005886 GO:0030003 GO:0071578 GO:0140410 |
| AF-A0A2V8AF31-F1-model_v4 | ZIP zinc transporter | 0.96 | 7 | 248 |
GO:0005385
GO:0006882 GO:0016020 |