F353033

General Info

Members Datasets Scaffolds Average Seq Length
240 91 480 244

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0199962|Ga0316574_0199962_390_1214
Length 274
Sequence MAGIDLYQAALRGVDVKEYSGERSPEAYTVSTLTWIVACGLLMSAIALVGSITLVLPAPTLDRLLLPLVAFAAGSLLGGAFFHMLPVAFSANPDTTVIGVAVVSGFTVFFVLEQFLHWHHCHLASGDCKQPMTYLLLVGDGLHNFLGGLAIAGIFLTDIRAGIAAWIAAALHEIPQELGDFGVLVRGGWAKPRALLFNVLSGLTFLLGGLVAYAVSFRSDLSWLIPFAAGNFIYIAAADLVPEVNKHGDADIRANLVHLVSFMLGLVLLLVVAP

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
37 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
38 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
39 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
40 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
41 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
42 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
43 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
44 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
45 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
46 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
47 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
48 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
49 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
50 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
51 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
52 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
53 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
54 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
68 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
69 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
70 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
71 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
72 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
73 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
74 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
77 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
78 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
79 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
80 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
81 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
85 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
86 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
87 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
88 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
89 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 0
Rhizoplane 0.83
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 9.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0199962 3300035398 Bacteria 1284
2 Ga0068869_100081412 3300005334 Bacteria 2418
3 Ga0070661_100098500 3300005344 Bacteria 2172
4 Ga0070668_100045938 3300005347 Bacteria 3352
5 Ga0070673_100101092 3300005364 Bacteria 2375
6 Ga0070663_100022827 3300005455 Bacteria 4187
7 Ga0070672_100267834 3300005543 Bacteria 1442
8 Ga0070665_100061942 3300005548 Bacteria 3751
9 Ga0070664_100233743 3300005564 Bacteria 1648
10 Ga0068854_100389742 3300005578 Bacteria 1150
11 Ga0068864_100031753 3300005618 Bacteria 4482
12 Ga0068861_100063274 3300005719 Bacteria 2844
13 Ga0068860_100097048 3300005843 Unclassified 2810
14 Ga0075365_10264317 3300006038 Bacteria 1210
15 Ga0075368_10014108 3300006042 Bacteria 2946
16 Ga0075368_10058176 3300006042 Bacteria 1544
17 Ga0075364_10126228 3300006051 Unclassified 1715
18 Ga0075362_10168063 3300006177 Bacteria 1058
19 Ga0075367_10014414 3300006178 Bacteria 4279
20 Ga0075367_10018577 3300006178 Bacteria 3840
21 Ga0075367_10020424 3300006178 Bacteria 3688
22 Ga0075366_10005122 3300006195 Bacteria 7090
23 Ga0075366_10043415 3300006195 Bacteria 2663
24 Ga0075366_10050696 3300006195 Bacteria 2465
25 Ga0075366_10078557 3300006195 Bacteria 1970
26 Ga0075370_10021282 3300006353 Bacteria 3553
27 Ga0105248_10021171 3300009177 Bacteria 7205
28 Ga0105238_10283766 3300009551 Bacteria 1637
29 Ga0105249_10864894 3300009553 Bacteria 970
30 Ga0157375_10164899 3300013308 Bacteria 2360
31 Ga0163163_10165085 3300014325 Bacteria 2260
32 Ga0163163_10727848 3300014325 Unclassified 1056
33 Ga0207691_10045231 3300025940 Bacteria 4047
34 Ga0207711_10119174 3300025941 Bacteria 2355
35 Ga0207679_10042065 3300025945 Bacteria 3281
36 Ga0207651_10077900 3300025960 Bacteria 2375
37 Ga0207651_10518000 3300025960 Unclassified 1033
38 Ga0207668_10184547 3300025972 Bacteria 1648
39 Ga0207678_10027681 3300026067 Bacteria 4948
40 Ga0207678_10211242 3300026067 Bacteria 1660
41 Ga0207675_100064966 3300026118 Bacteria 3411
42 Ga0209973_1002234 3300027252 Unclassified 1789
43 Ga0209974_10004790 3300027876 Bacteria 4800
44 Ga0268266_10078955 3300028379 Bacteria 2865
45 Ga0316575_10002665 3300031665 Bacteria 6013
46 Ga0316575_10070861 3300031665 Bacteria 1400
47 Ga0316579_10095526 3300031691 Bacteria 1421
48 Ga0316576_10005537 3300031727 Bacteria 7731
49 Ga0316576_10010909 3300031727 Bacteria 5926
50 Ga0316576_10022679 3300031727 Bacteria 4363
51 Ga0316576_10107251 3300031727 Bacteria 2092
52 Ga0316576_10123864 3300031727 Bacteria 1942
53 Ga0316576_10124261 3300031727 Archaea 1939
54 Ga0316576_10142939 3300031727 Unclassified 1802
55 Ga0316576_10180397 3300031727 Bacteria 1593
56 Ga0316576_10208298 3300031727 Bacteria 1472
57 Ga0316576_10250990 3300031727 Bacteria 1328
58 Ga0316578_10000934 3300031728 Bacteria 11095
59 Ga0316578_10073246 3300031728 Bacteria 2030
60 Ga0316578_10083365 3300031728 Bacteria 1904
61 Ga0316578_10085432 3300031728 Bacteria 1881
62 Ga0316578_10230099 3300031728 Unclassified 1114
63 Ga0316577_10027957 3300031733 Bacteria 3145
64 Ga0316577_10164610 3300031733 Bacteria 1251
65 Ga0316583_10007457 3300032133 Bacteria 3938
66 Ga0316585_10003220 3300032137 Bacteria 4465
67 Ga0316580_10117072 3300032139 Bacteria 816
68 Ga0316574_0010028 3300035398 Bacteria 5331
69 Ga0316574_0019797 3300035398 Bacteria 3976
70 Ga0316574_0039768 3300035398 Bacteria 2894
71 Ga0316574_0042258 3300035398 Bacteria 2812
72 Ga0316574_0049001 3300035398 Bacteria 2625
73 Ga0316574_0062900 3300035398 Bacteria 2333
74 Ga0316574_0082350 3300035398 Unclassified 2045
75 Ga0316574_0131414 3300035398 Bacteria 1611
76 Ga0316574_0186619 3300035398 Archaea 1334
77 Ga0316574_0230840 3300035398 Unclassified 1184
78 Ga0316574_0258797 3300035398 Bacteria 1111
79 Ga0373937_0180984 3300036401 Bacteria 1979
80 Ga0316582_0001240 3300036647 Bacteria 10997
81 Ga0316582_0102027 3300036647 Bacteria 1901
82 Ga0316582_0236158 3300036647 Bacteria 1252
83 Ga0316584_0000934 3300036712 Bacteria 16623
84 Ga0316584_0017035 3300036712 Bacteria 5217
85 Ga0316584_0041832 3300036712 Bacteria 3416
86 Ga0316584_0065381 3300036712 Bacteria 2724
87 Ga0316584_0083814 3300036712 Bacteria 2388
88 Ga0316584_0124322 3300036712 Bacteria 1927
89 Ga0316584_0229963 3300036712 Bacteria 1360
90 Ga0316584_0267040 3300036712 Bacteria 1246
91 Ga0316584_0307785 3300036712 Bacteria 1146
92 Ga0316584_0368330 3300036712 Bacteria 1029
93 Ga0316584_0375668 3300036712 Bacteria 1017
94 Ga0316584_0730972 3300036712 Bacteria 676
95 Ga0451807_1916620 3300041486 Bacteria 1468
96 Ga0450920_003347 3300042122 Bacteria 2770
97 Ga0450923_010536 3300042125 Unclassified 1643
98 Ga0450898_017486 3300042134 Bacteria 1234
99 Ga0450908_008436 3300042184 Unclassified 1931
100 Ga0450918_005019 3300042531 Unclassified 2384
101 Ga0496110_0429117 3300048913 Bacteria 1205
102 Ga0501031_0017169 3300049568 Bacteria 4703
103 Ga0501031_0398012 3300049568 Bacteria 891
104 Ga0501033_0054169 3300049570 Bacteria 2969
105 Ga0501033_0068062 3300049570 Bacteria 2618
106 Ga0501033_0082351 3300049570 Bacteria 2360
107 Ga0501033_0172927 3300049570 Bacteria 1551
108 Ga0501034_0099216 3300049571 Bacteria 2907
109 Ga0501036_0036806 3300049572 Bacteria 4140
110 Ga0501036_0041822 3300049572 Bacteria 3878
111 Ga0501036_0044856 3300049572 Bacteria 3746
112 Ga0501036_0108020 3300049572 Bacteria 2353
113 Ga0501037_0069932 3300049573 Bacteria 2555
114 Ga0501037_0187345 3300049573 Bacteria 1466
115 Ga0501037_0238968 3300049573 Bacteria 1274
116 Ga0501038_0005385 3300049574 Bacteria 11892
117 Ga0501038_0046484 3300049574 Bacteria 3763
118 Ga0501038_0124550 3300049574 Bacteria 2122
119 Ga0501038_0245143 3300049574 Bacteria 1421
120 Ga0501038_0326284 3300049574 Bacteria 1200
121 Ga0501039_0019918 3300049575 Bacteria 5143
122 Ga0501039_0038900 3300049575 Bacteria 3673
123 Ga0501039_0078191 3300049575 Bacteria 2573
124 Ga0501039_0080804 3300049575 Bacteria 2530
125 Ga0501039_0165124 3300049575 Bacteria 1741
126 Ga0501039_0405414 3300049575 Bacteria 1071
127 Ga0501040_0001066 3300049576 Bacteria 17355
128 Ga0501040_0011366 3300049576 Bacteria 5829
129 Ga0501040_0020683 3300049576 Bacteria 4388
130 Ga0501040_0029325 3300049576 Bacteria 3714
131 Ga0501040_0029710 3300049576 Bacteria 3690
132 Ga0501040_0378107 3300049576 Bacteria 1016
133 Ga0501041_0025160 3300049577 Bacteria 3578
134 Ga0501041_0061584 3300049577 Bacteria 2297
135 Ga0501041_0130358 3300049577 Bacteria 1566
136 Ga0501041_0158712 3300049577 Bacteria 1413
137 Ga0501041_0263019 3300049577 Bacteria 1085
138 Ga0501042_0000681 3300049578 Bacteria 18367
139 Ga0501042_0058839 3300049578 Bacteria 2743
140 Ga0501043_0104170 3300049579 Bacteria 2229
141 Ga0501046_0011111 3300049580 Bacteria 7710
142 Ga0501046_0037886 3300049580 Bacteria 3873
143 Ga0501046_0037906 3300049580 Bacteria 3872
144 Ga0501046_0043038 3300049580 Bacteria 3597
145 Ga0501046_0142220 3300049580 Bacteria 1815
146 Ga0501048_0098651 3300049582 Bacteria 2060
147 Ga0501048_0234837 3300049582 Bacteria 1301
148 Ga0501068_0018323 3300049584 Bacteria 4056
149 Ga0501068_0019696 3300049584 Unclassified 3922
150 Ga0501069_0143300 3300049585 Bacteria 1371
151 Ga0501070_0206631 3300049586 Bacteria 1612
152 Ga0501071_0043389 3300049587 Unclassified 3224
153 Ga0501071_0082956 3300049587 Bacteria 2348
154 Ga0501071_0140846 3300049587 Bacteria 1796
155 Ga0501071_0193965 3300049587 Bacteria 1524
156 Ga0501071_0264547 3300049587 Bacteria 1299
157 Ga0501071_0438394 3300049587 Unclassified 999
158 Ga0501072_0000963 3300049588 Bacteria 21237
159 Ga0501072_0008532 3300049588 Bacteria 7771
160 Ga0501072_0043285 3300049588 Bacteria 3538
161 Ga0501072_0197219 3300049588 Bacteria 1605
162 Ga0501072_0727824 3300049588 Bacteria 779
163 Ga0501073_0111198 3300049589 Bacteria 1900
164 Ga0501074_0010331 3300049590 Bacteria 6772
165 Ga0501074_0224428 3300049590 Bacteria 1337
166 Ga0501075_0000764 3300049591 Bacteria 20098
167 Ga0501075_0004954 3300049591 Bacteria 9075
168 Ga0501075_0112994 3300049591 Unclassified 2065
169 Ga0501075_0117708 3300049591 Bacteria 2020
170 Ga0501075_0162160 3300049591 Bacteria 1706
171 Ga0501075_0647973 3300049591 Unclassified 805
172 Ga0501076_0001139 3300049592 Bacteria 17608
173 Ga0501076_0002770 3300049592 Bacteria 12132
174 Ga0501076_0020853 3300049592 Bacteria 5018
175 Ga0501076_0058989 3300049592 Bacteria 3052
176 Ga0501076_0076528 3300049592 Bacteria 2684
177 Ga0501076_0173845 3300049592 Unclassified 1756
178 Ga0501076_0403746 3300049592 Bacteria 1124
179 Ga0501077_0000989 3300049593 Bacteria 17098
180 Ga0501077_0023368 3300049593 Bacteria 3920
181 Ga0501077_0049848 3300049593 Bacteria 2661
182 Ga0501077_0078253 3300049593 Bacteria 2096
183 Ga0501077_0353318 3300049593 Bacteria 938
184 Ga0501079_0000379 3300049741 Bacteria 28580
185 Ga0501079_0004461 3300049741 Bacteria 10377
186 Ga0501079_0008185 3300049741 Bacteria 7922
187 Ga0501079_0064214 3300049741 Bacteria 2832
188 Ga0501080_0021611 3300049742 Bacteria 5957
189 Ga0501080_0040128 3300049742 Bacteria 4367
190 Ga0501080_0047421 3300049742 Bacteria 3999
191 Ga0501080_0080337 3300049742 Bacteria 3031
192 Ga0501080_0875705 3300049742 Unclassified 784
193 Ga0501081_0000033 3300049743 Bacteria 51492
194 Ga0501081_0004696 3300049743 Bacteria 8786
195 Ga0501081_0014012 3300049743 Bacteria 5280
196 Ga0501081_0045838 3300049743 Bacteria 3003
197 Ga0501081_0095908 3300049743 Bacteria 2091
198 Ga0501081_0101041 3300049743 Bacteria 2039
199 Ga0501081_0263932 3300049743 Bacteria 1259
200 Ga0501081_0755174 3300049743 Bacteria 731
201 Ga0501083_0036076 3300049744 Bacteria 3374
202 Ga0501083_0083863 3300049744 Bacteria 2111
203 Ga0501083_0096079 3300049744 Bacteria 1955
204 Ga0501083_0219742 3300049744 Bacteria 1238
205 Ga0501035_0026063 3300049822 Bacteria 5354
206 Ga0501035_0140523 3300049822 Bacteria 2100
207 Ga0501035_0211700 3300049822 Bacteria 1658
208 Ga0501044_0518419 3300049823 Bacteria 1092
209 Ga0501045_0002885 3300049824 Bacteria 11740
210 Ga0501045_0014002 3300049824 Bacteria 5677
211 Ga0501045_0075799 3300049824 Bacteria 2477
212 Ga0501045_0085369 3300049824 Bacteria 2330
213 Ga0501045_0103742 3300049824 Bacteria 2106
214 Ga0501045_0155764 3300049824 Bacteria 1700
215 Ga0501045_0180494 3300049824 Bacteria 1573
216 nmdc:mga0k408_13390_c1 3300050493 Bacteria 4496
217 nmdc:mga0k408_15245_c1 3300050493 Bacteria 4248
218 nmdc:mga0k408_31688_c1 3300050493 Bacteria 3020
219 nmdc:mga06z11_15497_c1 3300050494 Bacteria 3404
220 nmdc:mga06z11_182198_c1 3300050494 Bacteria 1212
221 nmdc:mga06z11_86765_c1 3300050494 Bacteria 1691
222 nmdc:mga0n895_321788_c1 3300050512 Unclassified 1567
223 Ga0500641_0001041 3300053096 Bacteria 9871
224 Ga0501084_0008917 3300054114 Bacteria 8298
225 Ga0501084_0073942 3300054114 Bacteria 2853
226 Ga0501084_0184320 3300054114 Bacteria 1762
227 Ga0501084_0222155 3300054114 Bacteria 1594
228 Ga0590077_006054 3300059426 Bacteria 2481
229 Ga0501082_0001333 3300060353 Bacteria 21634
230 Ga0501082_0048996 3300060353 Bacteria 3642
231 Ga0501082_0114249 3300060353 Unclassified 2338
232 Ga0501082_0129465 3300060353 Bacteria 2189
233 Ga0501082_0250958 3300060353 Bacteria 1540
234 Ga0501082_0252700 3300060353 Bacteria 1534
235 Ga0501082_0262725 3300060353 Unclassified 1502
236 Ga0530510_0004682 3300061734 Bacteria 9462
237 Ga0530510_0006180 3300061734 Bacteria 8322
238 Ga0530510_0009598 3300061734 Bacteria 6786
239 Ga0530510_0141146 3300061734 Bacteria 1775
240 Ga0530510_0699320 3300061734 Unclassified 772
241 Ga0316574_0199962
242 Ga0068869_100081412
243 Ga0070661_100098500
244 Ga0070668_100045938
245 Ga0070673_100101092
246 Ga0070663_100022827
247 Ga0070672_100267834
248 Ga0070665_100061942
249 Ga0070664_100233743
250 Ga0068854_100389742
251 Ga0068864_100031753
252 Ga0068861_100063274
253 Ga0068860_100097048
254 Ga0075365_10264317
255 Ga0075368_10014108
256 Ga0075368_10058176
257 Ga0075364_10126228
258 Ga0075362_10168063
259 Ga0075367_10014414
260 Ga0075367_10018577
261 Ga0075367_10020424
262 Ga0075366_10005122
263 Ga0075366_10043415
264 Ga0075366_10050696
265 Ga0075366_10078557
266 Ga0075370_10021282
267 Ga0105248_10021171
268 Ga0105238_10283766
269 Ga0105249_10864894
270 Ga0157375_10164899
271 Ga0163163_10165085
272 Ga0163163_10727848
273 Ga0207691_10045231
274 Ga0207711_10119174
275 Ga0207679_10042065
276 Ga0207651_10077900
277 Ga0207651_10518000
278 Ga0207668_10184547
279 Ga0207678_10027681
280 Ga0207678_10211242
281 Ga0207675_100064966
282 Ga0209973_1002234
283 Ga0209974_10004790
284 Ga0268266_10078955
285 Ga0316575_10002665
286 Ga0316575_10070861
287 Ga0316579_10095526
288 Ga0316576_10005537
289 Ga0316576_10010909
290 Ga0316576_10022679
291 Ga0316576_10107251
292 Ga0316576_10123864
293 Ga0316576_10124261
294 Ga0316576_10142939
295 Ga0316576_10180397
296 Ga0316576_10208298
297 Ga0316576_10250990
298 Ga0316578_10000934
299 Ga0316578_10073246
300 Ga0316578_10083365
301 Ga0316578_10085432
302 Ga0316578_10230099
303 Ga0316577_10027957
304 Ga0316577_10164610
305 Ga0316583_10007457
306 Ga0316585_10003220
307 Ga0316580_10117072
308 Ga0316574_0010028
309 Ga0316574_0019797
310 Ga0316574_0039768
311 Ga0316574_0042258
312 Ga0316574_0049001
313 Ga0316574_0062900
314 Ga0316574_0082350
315 Ga0316574_0131414
316 Ga0316574_0186619
317 Ga0316574_0230840
318 Ga0316574_0258797
319 Ga0373937_0180984
320 Ga0316582_0001240
321 Ga0316582_0102027
322 Ga0316582_0236158
323 Ga0316584_0000934
324 Ga0316584_0017035
325 Ga0316584_0041832
326 Ga0316584_0065381
327 Ga0316584_0083814
328 Ga0316584_0124322
329 Ga0316584_0229963
330 Ga0316584_0267040
331 Ga0316584_0307785
332 Ga0316584_0368330
333 Ga0316584_0375668
334 Ga0316584_0730972
335 Ga0451807_1916620
336 Ga0450920_003347
337 Ga0450923_010536
338 Ga0450898_017486
339 Ga0450908_008436
340 Ga0450918_005019
341 Ga0496110_0429117
342 Ga0501031_0017169
343 Ga0501031_0398012
344 Ga0501033_0054169
345 Ga0501033_0068062
346 Ga0501033_0082351
347 Ga0501033_0172927
348 Ga0501034_0099216
349 Ga0501036_0036806
350 Ga0501036_0041822
351 Ga0501036_0044856
352 Ga0501036_0108020
353 Ga0501037_0069932
354 Ga0501037_0187345
355 Ga0501037_0238968
356 Ga0501038_0005385
357 Ga0501038_0046484
358 Ga0501038_0124550
359 Ga0501038_0245143
360 Ga0501038_0326284
361 Ga0501039_0019918
362 Ga0501039_0038900
363 Ga0501039_0078191
364 Ga0501039_0080804
365 Ga0501039_0165124
366 Ga0501039_0405414
367 Ga0501040_0001066
368 Ga0501040_0011366
369 Ga0501040_0020683
370 Ga0501040_0029325
371 Ga0501040_0029710
372 Ga0501040_0378107
373 Ga0501041_0025160
374 Ga0501041_0061584
375 Ga0501041_0130358
376 Ga0501041_0158712
377 Ga0501041_0263019
378 Ga0501042_0000681
379 Ga0501042_0058839
380 Ga0501043_0104170
381 Ga0501046_0011111
382 Ga0501046_0037886
383 Ga0501046_0037906
384 Ga0501046_0043038
385 Ga0501046_0142220
386 Ga0501048_0098651
387 Ga0501048_0234837
388 Ga0501068_0018323
389 Ga0501068_0019696
390 Ga0501069_0143300
391 Ga0501070_0206631
392 Ga0501071_0043389
393 Ga0501071_0082956
394 Ga0501071_0140846
395 Ga0501071_0193965
396 Ga0501071_0264547
397 Ga0501071_0438394
398 Ga0501072_0000963
399 Ga0501072_0008532
400 Ga0501072_0043285
401 Ga0501072_0197219
402 Ga0501072_0727824
403 Ga0501073_0111198
404 Ga0501074_0010331
405 Ga0501074_0224428
406 Ga0501075_0000764
407 Ga0501075_0004954
408 Ga0501075_0112994
409 Ga0501075_0117708
410 Ga0501075_0162160
411 Ga0501075_0647973
412 Ga0501076_0001139
413 Ga0501076_0002770
414 Ga0501076_0020853
415 Ga0501076_0058989
416 Ga0501076_0076528
417 Ga0501076_0173845
418 Ga0501076_0403746
419 Ga0501077_0000989
420 Ga0501077_0023368
421 Ga0501077_0049848
422 Ga0501077_0078253
423 Ga0501077_0353318
424 Ga0501079_0000379
425 Ga0501079_0004461
426 Ga0501079_0008185
427 Ga0501079_0064214
428 Ga0501080_0021611
429 Ga0501080_0040128
430 Ga0501080_0047421
431 Ga0501080_0080337
432 Ga0501080_0875705
433 Ga0501081_0000033
434 Ga0501081_0004696
435 Ga0501081_0014012
436 Ga0501081_0045838
437 Ga0501081_0095908
438 Ga0501081_0101041
439 Ga0501081_0263932
440 Ga0501081_0755174
441 Ga0501083_0036076
442 Ga0501083_0083863
443 Ga0501083_0096079
444 Ga0501083_0219742
445 Ga0501035_0026063
446 Ga0501035_0140523
447 Ga0501035_0211700
448 Ga0501044_0518419
449 Ga0501045_0002885
450 Ga0501045_0014002
451 Ga0501045_0075799
452 Ga0501045_0085369
453 Ga0501045_0103742
454 Ga0501045_0155764
455 Ga0501045_0180494
456 nmdc:mga0k408_13390_c1
457 nmdc:mga0k408_15245_c1
458 nmdc:mga0k408_31688_c1
459 nmdc:mga06z11_15497_c1
460 nmdc:mga06z11_182198_c1
461 nmdc:mga06z11_86765_c1
462 nmdc:mga0n895_321788_c1
463 Ga0500641_0001041
464 Ga0501084_0008917
465 Ga0501084_0073942
466 Ga0501084_0184320
467 Ga0501084_0222155
468 Ga0590077_006054
469 Ga0501082_0001333
470 Ga0501082_0048996
471 Ga0501082_0114249
472 Ga0501082_0129465
473 Ga0501082_0250958
474 Ga0501082_0252700
475 Ga0501082_0262725
476 Ga0530510_0004682
477 Ga0530510_0006180
478 Ga0530510_0009598
479 Ga0530510_0141146
480 Ga0530510_0699320

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02535

Zip

ZIP Zinc transporter

119

273

0.92

PF02535

Zip

ZIP Zinc transporter

32

132

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8czj-assembly1.cif.gz_A a bacteria zrt/irt-like protein in the apo state 0.8438 7 247
8czj-assembly1.cif.gz_B a bacteria zrt/irt-like protein in the apo state 0.8202 7 247
8czj-assembly1.cif.gz_A a bacteria zrt/irt-like protein in the apo state 0.8097 7 247
8czj-assembly1.cif.gz_B a bacteria zrt/irt-like protein in the apo state 0.7899 7 247
7z6m-assembly1.cif.gz_A-2 crystal structure of zn2+-transporter bbzip in a cadmium bound state 0.7698 6 247
ID Description Score Start End Superfamily
af_Q2FZP8_8_190_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3787 33 216 1.20.1250.20
af_Q01818_292_487_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3697 41 214 1.20.1250.20
af_P33580_28_239_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.3686 38 197 1.20.1250.10
af_Q54EX8_313_506_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3656 38 218 1.20.1250.20
3o7qA02 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3639 26 214 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A382SQZ0-F1-model_v4 ZIP zinc transporter 0.9684 6 220 GO:0016020
GO:0046873
AF-A0A2V8AF31-F1-model_v4 ZIP zinc transporter 0.9679 7 248 GO:0005385
GO:0006882
GO:0016020
AF-A0A2E7BMD4-F1-model_v4 ZIP zinc transporter 0.9645 2 248 GO:0016020
GO:0046873
AF-A0A3N5P169-F1-model_v4 ZIP family metal transporter 0.962 1 246 GO:0005385
GO:0005886
GO:0030003
GO:0071578
GO:0140410
AF-A0A2V8AF31-F1-model_v4 ZIP zinc transporter 0.96 7 248 GO:0005385
GO:0006882
GO:0016020

Map