F353015
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 152 | 239 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300032133|Ga0316583_10181562|Ga0316583_101815621 |
| Length | 119 |
| Sequence | VIVVTNRIPVAEGHQIDFEDRFKRRVHLVDQAPGFVRNEVHRPRPMKFDKGTWVDDKEKQGYYEVKTWWRSMEDFVAWTKSPAFGEAHRDRPPKEMFAGPNVLEVHEVFLSTDLDVGGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 2836160341 | Unclassified Planctomycetes Bin 134 | Isolate | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 96 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 97 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 99 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 100 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 101 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 102 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 103 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 104 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 105 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 108 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 109 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 110 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 112 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 113 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 114 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 118 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 119 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 120 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 121 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 122 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 123 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 124 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 125 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 152 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.25 |
| Nodule | 0 |
| Rhizoplane | 0.42 |
| Rhizosphere | 96.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F7QKVOU01CR06L | 2088090003 | Unclassified | 501 |
| 2 | Ga0065707_10883214 | 3300005295 | Unclassified | 572 |
| 3 | Ga0070676_10130193 | 3300005328 | Unclassified | 1590 |
| 4 | Ga0070676_10346873 | 3300005328 | Bacteria | 1020 |
| 5 | Ga0070680_101860123 | 3300005336 | Bacteria | 522 |
| 6 | Ga0068868_100597627 | 3300005338 | Bacteria | 977 |
| 7 | Ga0070689_100994599 | 3300005340 | Unclassified | 746 |
| 8 | Ga0070687_100751158 | 3300005343 | Bacteria | 686 |
| 9 | Ga0070668_102094323 | 3300005347 | Bacteria | 522 |
| 10 | Ga0070669_100353306 | 3300005353 | Bacteria | 1194 |
| 11 | Ga0070669_100454109 | 3300005353 | Unclassified | 1057 |
| 12 | Ga0070669_100818888 | 3300005353 | Bacteria | 792 |
| 13 | Ga0070669_101283306 | 3300005353 | Bacteria | 634 |
| 14 | Ga0070675_100545473 | 3300005354 | Bacteria | 1048 |
| 15 | Ga0070671_100876319 | 3300005355 | Bacteria | 784 |
| 16 | Ga0070673_100092646 | 3300005364 | Bacteria | 2472 |
| 17 | Ga0070688_100376515 | 3300005365 | Bacteria | 1045 |
| 18 | Ga0070659_100640442 | 3300005366 | Unclassified | 916 |
| 19 | Ga0070667_100186906 | 3300005367 | Bacteria | 1834 |
| 20 | Ga0070701_10412756 | 3300005438 | Bacteria | 858 |
| 21 | Ga0070711_100068359 | 3300005439 | Bacteria | 2496 |
| 22 | Ga0070705_100663023 | 3300005440 | Unclassified | 815 |
| 23 | Ga0070705_101193064 | 3300005440 | Bacteria | 627 |
| 24 | Ga0070705_101854732 | 3300005440 | Bacteria | 512 |
| 25 | Ga0070694_100211418 | 3300005444 | Bacteria | 1451 |
| 26 | Ga0070708_101831742 | 3300005445 | Unclassified | 563 |
| 27 | Ga0070678_100758540 | 3300005456 | Unclassified | 878 |
| 28 | Ga0070678_101077480 | 3300005456 | Bacteria | 741 |
| 29 | Ga0070678_101190361 | 3300005456 | Bacteria | 706 |
| 30 | Ga0070662_100564450 | 3300005457 | Bacteria | 955 |
| 31 | Ga0070662_101816486 | 3300005457 | Bacteria | 527 |
| 32 | Ga0070706_100486981 | 3300005467 | Bacteria | 1147 |
| 33 | Ga0070706_100772946 | 3300005467 | Unclassified | 890 |
| 34 | Ga0070706_101907679 | 3300005467 | Bacteria | 539 |
| 35 | Ga0070707_100114189 | 3300005468 | Bacteria | 2620 |
| 36 | Ga0070707_100938185 | 3300005468 | Unclassified | 830 |
| 37 | Ga0070707_101398879 | 3300005468 | Unclassified | 666 |
| 38 | Ga0070707_101637196 | 3300005468 | Bacteria | 611 |
| 39 | Ga0070699_100090108 | 3300005518 | Bacteria | 2680 |
| 40 | Ga0070699_100156474 | 3300005518 | Bacteria | 2017 |
| 41 | Ga0070699_100231244 | 3300005518 | Bacteria | 1649 |
| 42 | Ga0070697_100103775 | 3300005536 | Bacteria | 2364 |
| 43 | Ga0070697_100213652 | 3300005536 | Bacteria | 1643 |
| 44 | Ga0070697_100521097 | 3300005536 | Bacteria | 1041 |
| 45 | Ga0070697_100847058 | 3300005536 | Bacteria | 810 |
| 46 | Ga0070697_100907231 | 3300005536 | Unclassified | 782 |
| 47 | Ga0070697_101858222 | 3300005536 | Bacteria | 539 |
| 48 | Ga0070672_101186756 | 3300005543 | Unclassified | 680 |
| 49 | Ga0070696_100051887 | 3300005546 | Bacteria | 2853 |
| 50 | Ga0070693_100882302 | 3300005547 | Bacteria | 669 |
| 51 | Ga0070665_101170984 | 3300005548 | Bacteria | 780 |
| 52 | Ga0070704_100369269 | 3300005549 | Bacteria | 1216 |
| 53 | Ga0070704_100643171 | 3300005549 | Bacteria | 936 |
| 54 | Ga0070704_101141853 | 3300005549 | Bacteria | 709 |
| 55 | Ga0070664_101102068 | 3300005564 | Unclassified | 748 |
| 56 | Ga0068859_100929665 | 3300005617 | Bacteria | 954 |
| 57 | Ga0068866_10669854 | 3300005718 | Unclassified | 708 |
| 58 | Ga0068870_10163884 | 3300005840 | Bacteria | 1321 |
| 59 | Ga0068863_100574145 | 3300005841 | Bacteria | 1115 |
| 60 | Ga0068858_101339881 | 3300005842 | Bacteria | 705 |
| 61 | Ga0068858_101726259 | 3300005842 | Bacteria | 618 |
| 62 | Ga0068860_100962577 | 3300005843 | Bacteria | 871 |
| 63 | Ga0068862_100128678 | 3300005844 | Bacteria | 2238 |
| 64 | Ga0068862_100263203 | 3300005844 | Unclassified | 1575 |
| 65 | Ga0070715_10325351 | 3300006163 | Bacteria | 831 |
| 66 | Ga0070716_100130827 | 3300006173 | Bacteria | 1586 |
| 67 | Ga0070716_100238332 | 3300006173 | Bacteria | 1232 |
| 68 | Ga0070716_100340499 | 3300006173 | Bacteria | 1058 |
| 69 | Ga0070712_100431215 | 3300006175 | Bacteria | 1094 |
| 70 | Ga0070712_100526839 | 3300006175 | Bacteria | 993 |
| 71 | Ga0075366_10410406 | 3300006195 | Bacteria | 834 |
| 72 | Ga0075428_100500414 | 3300006844 | Unclassified | 1300 |
| 73 | Ga0075428_100711503 | 3300006844 | Bacteria | 1070 |
| 74 | Ga0075428_100716279 | 3300006844 | Unclassified | 1066 |
| 75 | Ga0075430_100127689 | 3300006846 | Bacteria | 2120 |
| 76 | Ga0075430_101371415 | 3300006846 | Unclassified | 581 |
| 77 | Ga0075431_100441454 | 3300006847 | Bacteria | 1298 |
| 78 | Ga0075431_101115455 | 3300006847 | Unclassified | 753 |
| 79 | Ga0075433_10157353 | 3300006852 | Bacteria | 2022 |
| 80 | Ga0075433_10239897 | 3300006852 | Unclassified | 1609 |
| 81 | Ga0075434_100061634 | 3300006871 | Bacteria | 3733 |
| 82 | Ga0075434_100660337 | 3300006871 | Bacteria | 1064 |
| 83 | Ga0075429_100554680 | 3300006880 | Bacteria | 1007 |
| 84 | Ga0075429_100971868 | 3300006880 | Unclassified | 743 |
| 85 | Ga0075436_100164750 | 3300006914 | Bacteria | 1564 |
| 86 | Ga0075436_100234690 | 3300006914 | Bacteria | 1303 |
| 87 | Ga0075436_101158398 | 3300006914 | Bacteria | 583 |
| 88 | Ga0097620_100929617 | 3300006931 | Bacteria | 954 |
| 89 | Ga0111539_10011251 | 3300009094 | Bacteria | 11242 |
| 90 | Ga0111539_10033995 | 3300009094 | Bacteria | 6185 |
| 91 | Ga0111539_10102010 | 3300009094 | Bacteria | 3368 |
| 92 | Ga0111539_10105126 | 3300009094 | Unclassified | 3312 |
| 93 | Ga0111539_11906672 | 3300009094 | Unclassified | 689 |
| 94 | Ga0114129_10429376 | 3300009147 | Bacteria | 1736 |
| 95 | Ga0114129_10928189 | 3300009147 | Bacteria | 1101 |
| 96 | Ga0114129_10957124 | 3300009147 | Bacteria | 1081 |
| 97 | Ga0114129_11396033 | 3300009147 | Unclassified | 864 |
| 98 | Ga0105249_13590261 | 3300009553 | Unclassified | 500 |
| 99 | Ga0157373_11519682 | 3300013100 | Bacteria | 511 |
| 100 | Ga0157378_11651037 | 3300013297 | Unclassified | 687 |
| 101 | Ga0163162_11505248 | 3300013306 | Unclassified | 767 |
| 102 | Ga0157375_10408383 | 3300013308 | Unclassified | 1524 |
| 103 | Ga0157375_10861981 | 3300013308 | Bacteria | 1052 |
| 104 | Ga0157380_10167659 | 3300014326 | Bacteria | 1915 |
| 105 | Ga0157380_11818841 | 3300014326 | Bacteria | 668 |
| 106 | Ga0157379_10000046 | 3300014968 | Bacteria | 75092 |
| 107 | Ga0207642_10448490 | 3300025899 | Unclassified | 781 |
| 108 | Ga0207685_10169103 | 3300025905 | Bacteria | 1004 |
| 109 | Ga0207685_10385794 | 3300025905 | Bacteria | 715 |
| 110 | Ga0207645_10148563 | 3300025907 | Unclassified | 1529 |
| 111 | Ga0207645_10197903 | 3300025907 | Bacteria | 1321 |
| 112 | Ga0207684_10143114 | 3300025910 | Bacteria | 2056 |
| 113 | Ga0207684_10380792 | 3300025910 | Bacteria | 1213 |
| 114 | Ga0207684_11281685 | 3300025910 | Unclassified | 604 |
| 115 | Ga0207693_10590563 | 3300025915 | Unclassified | 865 |
| 116 | Ga0207663_10498000 | 3300025916 | Bacteria | 946 |
| 117 | Ga0207662_10626616 | 3300025918 | Unclassified | 750 |
| 118 | Ga0207646_10108003 | 3300025922 | Bacteria | 2496 |
| 119 | Ga0207646_10752603 | 3300025922 | Unclassified | 869 |
| 120 | Ga0207646_10858878 | 3300025922 | Bacteria | 806 |
| 121 | Ga0207681_10270814 | 3300025923 | Bacteria | 1333 |
| 122 | Ga0207681_10755910 | 3300025923 | Bacteria | 810 |
| 123 | Ga0207681_10771211 | 3300025923 | Bacteria | 802 |
| 124 | Ga0207659_10374371 | 3300025926 | Bacteria | 1186 |
| 125 | Ga0207644_10422895 | 3300025931 | Bacteria | 1092 |
| 126 | Ga0207690_10277761 | 3300025932 | Unclassified | 1304 |
| 127 | Ga0207690_11745473 | 3300025932 | Bacteria | 520 |
| 128 | Ga0207706_10380539 | 3300025933 | Bacteria | 1225 |
| 129 | Ga0207670_11199402 | 3300025936 | Bacteria | 642 |
| 130 | Ga0207669_10233798 | 3300025937 | Bacteria | 1358 |
| 131 | Ga0207669_11088171 | 3300025937 | Bacteria | 674 |
| 132 | Ga0207665_10093078 | 3300025939 | Bacteria | 2092 |
| 133 | Ga0207665_10500610 | 3300025939 | Bacteria | 938 |
| 134 | Ga0207691_10134191 | 3300025940 | Bacteria | 2185 |
| 135 | Ga0207667_10881550 | 3300025949 | Unclassified | 888 |
| 136 | Ga0207651_10881257 | 3300025960 | Unclassified | 796 |
| 137 | Ga0207668_10301164 | 3300025972 | Unclassified | 1323 |
| 138 | Ga0207658_10129714 | 3300025986 | Bacteria | 2024 |
| 139 | Ga0207658_11835028 | 3300025986 | Bacteria | 553 |
| 140 | Ga0207677_10519207 | 3300026023 | Bacteria | 1033 |
| 141 | Ga0207703_10176409 | 3300026035 | Bacteria | 1883 |
| 142 | Ga0207703_11797381 | 3300026035 | Bacteria | 589 |
| 143 | Ga0207708_11309524 | 3300026075 | Bacteria | 635 |
| 144 | Ga0207641_10248106 | 3300026088 | Bacteria | 1662 |
| 145 | Ga0207674_10882211 | 3300026116 | Bacteria | 862 |
| 146 | Ga0207675_100414160 | 3300026118 | Bacteria | 1330 |
| 147 | Ga0207675_101504289 | 3300026118 | Unclassified | 694 |
| 148 | Ga0207683_10867687 | 3300026121 | Unclassified | 838 |
| 149 | Ga0207428_10036207 | 3300027907 | Bacteria | 4028 |
| 150 | Ga0207428_10155033 | 3300027907 | Unclassified | 1742 |
| 151 | Ga0268266_10435865 | 3300028379 | Bacteria | 1244 |
| 152 | Ga0268265_10094411 | 3300028380 | Bacteria | 2399 |
| 153 | Ga0268265_11022435 | 3300028380 | Unclassified | 817 |
| 154 | Ga0268264_10920357 | 3300028381 | Bacteria | 878 |
| 155 | Ga0265314_10350617 | 3300031711 | Unclassified | 812 |
| 156 | Ga0316576_11068804 | 3300031727 | Bacteria | 573 |
| 157 | Ga0316578_10878088 | 3300031728 | Unclassified | 518 |
| 158 | Ga0307405_12078197 | 3300031731 | Bacteria | 509 |
| 159 | Ga0307413_10678045 | 3300031824 | Bacteria | 854 |
| 160 | Ga0307407_10031805 | 3300031903 | Bacteria | 2862 |
| 161 | Ga0307409_100621942 | 3300031995 | Unclassified | 1070 |
| 162 | Ga0316583_10181562 | 3300032133 | Unclassified | 732 |
| 163 | Ga0373926_0034517 | 3300035083 | Bacteria | 1791 |
| 164 | Ga0373923_0355924 | 3300035111 | Unclassified | 700 |
| 165 | Ga0373939_0336845 | 3300035114 | Bacteria | 610 |
| 166 | Ga0373956_0006137 | 3300035119 | Bacteria | 4805 |
| 167 | Ga0373943_0070091 | 3300035170 | Bacteria | 1773 |
| 168 | Ga0373955_0077280 | 3300035172 | Bacteria | 1874 |
| 169 | Ga0373955_1009778 | 3300035172 | Bacteria | 512 |
| 170 | Ga0316574_0796274 | 3300035398 | Unclassified | 576 |
| 171 | Ga0373924_0354952 | 3300035410 | Unclassified | 654 |
| 172 | Ga0373931_0280223 | 3300035691 | Bacteria | 1023 |
| 173 | Ga0373935_0018386 | 3300035692 | Bacteria | 4251 |
| 174 | Ga0373935_0082314 | 3300035692 | Unclassified | 2094 |
| 175 | Ga0373935_1186805 | 3300035692 | Unclassified | 569 |
| 176 | Ga0373927_0008834 | 3300035695 | Bacteria | 6767 |
| 177 | Ga0373933_0482728 | 3300035724 | Unclassified | 811 |
| 178 | Ga0373933_0895166 | 3300035724 | Unclassified | 584 |
| 179 | Ga0373947_0020314 | 3300035725 | Bacteria | 3833 |
| 180 | Ga0373947_0237278 | 3300035725 | Bacteria | 1202 |
| 181 | Ga0373947_0384568 | 3300035725 | Bacteria | 945 |
| 182 | Ga0373937_0003425 | 3300036401 | Bacteria | 13313 |
| 183 | Ga0373937_0172154 | 3300036401 | Bacteria | 2032 |
| 184 | Ga0373937_0517230 | 3300036401 | Bacteria | 1134 |
| 185 | Ga0373937_0594806 | 3300036401 | Bacteria | 1050 |
| 186 | Ga0373925_0014607 | 3300037068 | Bacteria | 5674 |
| 187 | Ga0373925_0014699 | 3300037068 | Bacteria | 5655 |
| 188 | Ga0373925_1043608 | 3300037068 | Unclassified | 673 |
| 189 | Ga0400490_44197 | 3300038726 | Bacteria | 17375 |
| 190 | Ga0400491_16147 | 3300038727 | Bacteria | 3110 |
| 191 | Ga0439436_0102806 | 3300041404 | Bacteria | 797 |
| 192 | Ga0439465_0128463 | 3300041413 | Bacteria | 893 |
| 193 | Ga0451841_0964905 | 3300041498 | Bacteria | 587 |
| 194 | Ga0439431_0030850 | 3300041997 | Bacteria | 1330 |
| 195 | Ga0439445_0070671 | 3300042004 | Bacteria | 965 |
| 196 | Ga0451577_0718223 | 3300042876 | Bacteria | 905 |
| 197 | Ga0453683_0085007 | 3300044673 | Bacteria | 1982 |
| 198 | Ga0453683_0871652 | 3300044673 | Bacteria | 594 |
| 199 | Ga0451576_0903324 | 3300045051 | Unclassified | 927 |
| 200 | Ga0495580_0012474 | 3300046472 | Bacteria | 6514 |
| 201 | Ga0495640_0198876 | 3300046533 | Bacteria | 1271 |
| 202 | Ga0495613_0316584 | 3300046689 | Bacteria | 1078 |
| 203 | Ga0496108_1661816 | 3300048911 | Bacteria | 527 |
| 204 | Ga0501033_0051533 | 3300049570 | Bacteria | 3051 |
| 205 | Ga0501034_0012473 | 3300049571 | Bacteria | 8779 |
| 206 | Ga0501034_0104384 | 3300049571 | Unclassified | 2827 |
| 207 | Ga0501043_0294482 | 3300049579 | Bacteria | 1241 |
| 208 | Ga0501046_0015888 | 3300049580 | Bacteria | 6315 |
| 209 | Ga0501046_0024930 | 3300049580 | Bacteria | 4900 |
| 210 | Ga0501047_0035145 | 3300049581 | Bacteria | 4841 |
| 211 | Ga0501047_0044293 | 3300049581 | Bacteria | 4299 |
| 212 | Ga0501047_0131565 | 3300049581 | Unclassified | 2382 |
| 213 | Ga0501048_0735334 | 3300049582 | Unclassified | 709 |
| 214 | Ga0501067_0583329 | 3300049583 | Bacteria | 627 |
| 215 | Ga0501070_0001850 | 3300049586 | Bacteria | 18685 |
| 216 | Ga0501083_0561101 | 3300049744 | Bacteria | 743 |
| 217 | Ga0501044_0043179 | 3300049823 | Bacteria | 4685 |
| 218 | nmdc:mga05p37_920579_c1 | 3300050507 | Unclassified | 940 |
| 219 | nmdc:mga09592_701632_c1 | 3300050508 | Unclassified | 861 |
| 220 | nmdc:mga09592_761614_c1 | 3300050508 | Bacteria | 821 |
| 221 | nmdc:mga0qj67_119409_c1 | 3300050509 | Bacteria | 2132 |
| 222 | nmdc:mga06r32_432223_c1 | 3300050510 | Bacteria | 1297 |
| 223 | nmdc:mga08y16_106281_c1 | 3300050511 | Bacteria | 2922 |
| 224 | nmdc:mga08y16_114693_c1 | 3300050511 | Unclassified | 2805 |
| 225 | nmdc:mga08y16_28049_c1 | 3300050511 | Bacteria | 5935 |
| 226 | nmdc:mga0n895_1526625_c1 | 3300050512 | Bacteria | 634 |
| 227 | nmdc:mga0n895_667416_c1 | 3300050512 | Bacteria | 1037 |
| 228 | nmdc:mga0n895_87109_c1 | 3300050512 | Bacteria | 3120 |
| 229 | nmdc:mga0rr50_1014279_c1 | 3300050513 | Bacteria | 707 |
| 230 | nmdc:mga0rr50_188441_c1 | 3300050513 | Bacteria | 1689 |
| 231 | nmdc:mga0rr50_283714_c1 | 3300050513 | Bacteria | 1382 |
| 232 | nmdc:mga08x19_1113471_c1 | 3300050514 | Bacteria | 560 |
| 233 | nmdc:mga08x19_46564_c1 | 3300050514 | Bacteria | 2774 |
| 234 | nmdc:mga0a205_1179238_c1 | 3300050515 | Unclassified | 613 |
| 235 | nmdc:mga0a205_289492_c1 | 3300050515 | Unclassified | 1512 |
| 236 | nmdc:mga0a205_895084_c1 | 3300050515 | Bacteria | 734 |
| 237 | Ga0495601_0777088 | 3300053077 | Unclassified | 609 |
| 238 | Ga0500650_0380330 | 3300053098 | Unclassified | 613 |
| 239 | Ga0500555_026333 | 3300053103 | Bacteria | 1662 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_100068359 | Ga0070711_1000683592 | 113 |
| 2 | 3300006175 | Ga0070712_100526839 | Ga0070712_1005268391 | 113 |
| 3 | 3300025905 | Ga0207685_10385794 | Ga0207685_103857942 | 113 |
| 4 | 3300025915 | Ga0207693_10590563 | Ga0207693_105905632 | 113 |
| 5 | 3300025916 | Ga0207663_10498000 | Ga0207663_104980002 | 113 |
| 6 | 3300035119 | Ga0373956_0006137 | Ga0373956_0006137_3225_3584 | 113 |
| 7 | 3300035172 | Ga0373955_0077280 | Ga0373955_0077280_1356_1715 | 113 |
| 8 | 3300035692 | Ga0373935_1186805 | Ga0373935_1186805_132_491 | 113 |
| 9 | 3300035724 | Ga0373933_0482728 | Ga0373933_0482728_380_739 | 113 |
| 10 | 3300035725 | Ga0373947_0384568 | Ga0373947_0384568_505_864 | 113 |
| 11 | 3300036401 | Ga0373937_0003425 | Ga0373937_0003425_8332_8691 | 113 |
| 12 | 3300037068 | Ga0373925_1043608 | Ga0373925_1043608_208_567 | 113 |
| 13 | 3300046689 | Ga0495613_0316584 | Ga0495613_0316584_96_455 | 113 |
| 14 | 3300053077 | Ga0495601_0777088 | Ga0495601_0777088_61_420 | 113 |
| 15 | iso_pu_bacteria | 2836160341 | 2836164680 | 113 |
| 16 | 3300025949 | Ga0207667_10881550 | Ga0207667_108815502 | 114 |
| 17 | 3300005536 | Ga0070697_100213652 | Ga0070697_1002136523 | 116 |
| 18 | 3300032133 | Ga0316583_10181562 | Ga0316583_101815621 | 116 |
| 19 | 3300049571 | Ga0501034_0104384 | Ga0501034_0104384_904_1257 | 117 |
| 20 | 3300049579 | Ga0501043_0294482 | Ga0501043_0294482_184_537 | 117 |
| 21 | 3300049580 | Ga0501046_0024930 | Ga0501046_0024930_2515_2868 | 117 |
| 22 | 3300049581 | Ga0501047_0044293 | Ga0501047_0044293_2274_2627 | 117 |
| 23 | 3300049582 | Ga0501048_0735334 | Ga0501048_0735334_78_431 | 117 |
| 24 | 3300049586 | Ga0501070_0001850 | Ga0501070_0001850_15765_16118 | 117 |
| 25 | 2088090003 | LJN_F7QKVOU01CR06L | LJN_00607140 | 118 |
| 26 | 3300005295 | Ga0065707_10883214 | Ga0065707_108832141 | 118 |
| 27 | 3300005328 | Ga0070676_10130193 | Ga0070676_101301932 | 118 |
| 28 | 3300005328 | Ga0070676_10346873 | Ga0070676_103468732 | 118 |
| 29 | 3300005336 | Ga0070680_101860123 | Ga0070680_1018601231 | 118 |
| 30 | 3300005338 | Ga0068868_100597627 | Ga0068868_1005976271 | 118 |
| 31 | 3300005340 | Ga0070689_100994599 | Ga0070689_1009945992 | 118 |
| 32 | 3300005343 | Ga0070687_100751158 | Ga0070687_1007511581 | 118 |
| 33 | 3300005347 | Ga0070668_102094323 | Ga0070668_1020943231 | 118 |
| 34 | 3300005353 | Ga0070669_100353306 | Ga0070669_1003533062 | 118 |
| 35 | 3300005353 | Ga0070669_100454109 | Ga0070669_1004541091 | 118 |
| 36 | 3300005353 | Ga0070669_100818888 | Ga0070669_1008188882 | 118 |
| 37 | 3300005353 | Ga0070669_101283306 | Ga0070669_1012833062 | 118 |
| 38 | 3300005354 | Ga0070675_100545473 | Ga0070675_1005454731 | 118 |
| 39 | 3300005355 | Ga0070671_100876319 | Ga0070671_1008763191 | 118 |
| 40 | 3300005364 | Ga0070673_100092646 | Ga0070673_1000926461 | 118 |
| 41 | 3300005365 | Ga0070688_100376515 | Ga0070688_1003765152 | 118 |
| 42 | 3300005366 | Ga0070659_100640442 | Ga0070659_1006404422 | 118 |
| 43 | 3300005367 | Ga0070667_100186906 | Ga0070667_1001869063 | 118 |
| 44 | 3300005438 | Ga0070701_10412756 | Ga0070701_104127562 | 118 |
| 45 | 3300005440 | Ga0070705_100663023 | Ga0070705_1006630231 | 118 |
| 46 | 3300005440 | Ga0070705_101193064 | Ga0070705_1011930641 | 118 |
| 47 | 3300005440 | Ga0070705_101854732 | Ga0070705_1018547321 | 118 |
| 48 | 3300005444 | Ga0070694_100211418 | Ga0070694_1002114183 | 118 |
| 49 | 3300005445 | Ga0070708_101831742 | Ga0070708_1018317421 | 118 |
| 50 | 3300005456 | Ga0070678_100758540 | Ga0070678_1007585401 | 118 |
| 51 | 3300005456 | Ga0070678_101077480 | Ga0070678_1010774802 | 118 |
| 52 | 3300005456 | Ga0070678_101190361 | Ga0070678_1011903611 | 118 |
| 53 | 3300005457 | Ga0070662_100564450 | Ga0070662_1005644502 | 118 |
| 54 | 3300005457 | Ga0070662_101816486 | Ga0070662_1018164861 | 118 |
| 55 | 3300005467 | Ga0070706_100486981 | Ga0070706_1004869812 | 118 |
| 56 | 3300005467 | Ga0070706_100772946 | Ga0070706_1007729462 | 118 |
| 57 | 3300005467 | Ga0070706_101907679 | Ga0070706_1019076791 | 118 |
| 58 | 3300005468 | Ga0070707_100114189 | Ga0070707_1001141892 | 118 |
| 59 | 3300005468 | Ga0070707_100938185 | Ga0070707_1009381851 | 118 |
| 60 | 3300005468 | Ga0070707_101398879 | Ga0070707_1013988791 | 118 |
| 61 | 3300005468 | Ga0070707_101637196 | Ga0070707_1016371961 | 118 |
| 62 | 3300005518 | Ga0070699_100090108 | Ga0070699_1000901082 | 118 |
| 63 | 3300005518 | Ga0070699_100156474 | Ga0070699_1001564743 | 118 |
| 64 | 3300005518 | Ga0070699_100231244 | Ga0070699_1002312443 | 118 |
| 65 | 3300005536 | Ga0070697_100103775 | Ga0070697_1001037752 | 118 |
| 66 | 3300005536 | Ga0070697_100521097 | Ga0070697_1005210972 | 118 |
| 67 | 3300005536 | Ga0070697_100847058 | Ga0070697_1008470582 | 118 |
| 68 | 3300005536 | Ga0070697_100907231 | Ga0070697_1009072312 | 118 |
| 69 | 3300005536 | Ga0070697_101858222 | Ga0070697_1018582221 | 118 |
| 70 | 3300005543 | Ga0070672_101186756 | Ga0070672_1011867561 | 118 |
| 71 | 3300005546 | Ga0070696_100051887 | Ga0070696_1000518873 | 118 |
| 72 | 3300005547 | Ga0070693_100882302 | Ga0070693_1008823022 | 118 |
| 73 | 3300005548 | Ga0070665_101170984 | Ga0070665_1011709841 | 118 |
| 74 | 3300005549 | Ga0070704_100369269 | Ga0070704_1003692692 | 118 |
| 75 | 3300005549 | Ga0070704_100643171 | Ga0070704_1006431712 | 118 |
| 76 | 3300005549 | Ga0070704_101141853 | Ga0070704_1011418531 | 118 |
| 77 | 3300005564 | Ga0070664_101102068 | Ga0070664_1011020682 | 118 |
| 78 | 3300005617 | Ga0068859_100929665 | Ga0068859_1009296652 | 118 |
| 79 | 3300005718 | Ga0068866_10669854 | Ga0068866_106698541 | 118 |
| 80 | 3300005840 | Ga0068870_10163884 | Ga0068870_101638842 | 118 |
| 81 | 3300005841 | Ga0068863_100574145 | Ga0068863_1005741452 | 118 |
| 82 | 3300005842 | Ga0068858_101339881 | Ga0068858_1013398812 | 118 |
| 83 | 3300005842 | Ga0068858_101726259 | Ga0068858_1017262592 | 118 |
| 84 | 3300005843 | Ga0068860_100962577 | Ga0068860_1009625772 | 118 |
| 85 | 3300005844 | Ga0068862_100128678 | Ga0068862_1001286782 | 118 |
| 86 | 3300005844 | Ga0068862_100263203 | Ga0068862_1002632033 | 118 |
| 87 | 3300006163 | Ga0070715_10325351 | Ga0070715_103253512 | 118 |
| 88 | 3300006173 | Ga0070716_100130827 | Ga0070716_1001308272 | 118 |
| 89 | 3300006173 | Ga0070716_100238332 | Ga0070716_1002383322 | 118 |
| 90 | 3300006173 | Ga0070716_100340499 | Ga0070716_1003404991 | 118 |
| 91 | 3300006175 | Ga0070712_100431215 | Ga0070712_1004312152 | 118 |
| 92 | 3300006195 | Ga0075366_10410406 | Ga0075366_104104062 | 118 |
| 93 | 3300006844 | Ga0075428_100500414 | Ga0075428_1005004143 | 118 |
| 94 | 3300006844 | Ga0075428_100711503 | Ga0075428_1007115033 | 118 |
| 95 | 3300006844 | Ga0075428_100716279 | Ga0075428_1007162792 | 118 |
| 96 | 3300006846 | Ga0075430_100127689 | Ga0075430_1001276892 | 118 |
| 97 | 3300006846 | Ga0075430_101371415 | Ga0075430_1013714152 | 118 |
| 98 | 3300006847 | Ga0075431_100441454 | Ga0075431_1004414542 | 118 |
| 99 | 3300006847 | Ga0075431_101115455 | Ga0075431_1011154552 | 118 |
| 100 | 3300006852 | Ga0075433_10157353 | Ga0075433_101573533 | 118 |
| 101 | 3300006852 | Ga0075433_10239897 | Ga0075433_102398973 | 118 |
| 102 | 3300006871 | Ga0075434_100061634 | Ga0075434_1000616341 | 118 |
| 103 | 3300006871 | Ga0075434_100660337 | Ga0075434_1006603372 | 118 |
| 104 | 3300006880 | Ga0075429_100554680 | Ga0075429_1005546802 | 118 |
| 105 | 3300006880 | Ga0075429_100971868 | Ga0075429_1009718682 | 118 |
| 106 | 3300006914 | Ga0075436_100164750 | Ga0075436_1001647502 | 118 |
| 107 | 3300006914 | Ga0075436_100234690 | Ga0075436_1002346902 | 118 |
| 108 | 3300006914 | Ga0075436_101158398 | Ga0075436_1011583981 | 118 |
| 109 | 3300006931 | Ga0097620_100929617 | Ga0097620_1009296172 | 118 |
| 110 | 3300009094 | Ga0111539_10011251 | Ga0111539_1001125111 | 118 |
| 111 | 3300009094 | Ga0111539_10033995 | Ga0111539_100339952 | 118 |
| 112 | 3300009094 | Ga0111539_10102010 | Ga0111539_101020102 | 118 |
| 113 | 3300009094 | Ga0111539_10105126 | Ga0111539_101051263 | 118 |
| 114 | 3300009094 | Ga0111539_11906672 | Ga0111539_119066721 | 118 |
| 115 | 3300009147 | Ga0114129_10429376 | Ga0114129_104293763 | 118 |
| 116 | 3300009147 | Ga0114129_10928189 | Ga0114129_109281892 | 118 |
| 117 | 3300009147 | Ga0114129_10957124 | Ga0114129_109571242 | 118 |
| 118 | 3300009147 | Ga0114129_11396033 | Ga0114129_113960332 | 118 |
| 119 | 3300009553 | Ga0105249_13590261 | Ga0105249_135902612 | 118 |
| 120 | 3300013100 | Ga0157373_11519682 | Ga0157373_115196821 | 118 |
| 121 | 3300013297 | Ga0157378_11651037 | Ga0157378_116510372 | 118 |
| 122 | 3300013306 | Ga0163162_11505248 | Ga0163162_115052482 | 118 |
| 123 | 3300013308 | Ga0157375_10408383 | Ga0157375_104083832 | 118 |
| 124 | 3300013308 | Ga0157375_10861981 | Ga0157375_108619812 | 118 |
| 125 | 3300014326 | Ga0157380_10167659 | Ga0157380_101676591 | 118 |
| 126 | 3300014326 | Ga0157380_11818841 | Ga0157380_118188412 | 118 |
| 127 | 3300014968 | Ga0157379_10000046 | Ga0157379_1000004624 | 118 |
| 128 | 3300025899 | Ga0207642_10448490 | Ga0207642_104484901 | 118 |
| 129 | 3300025905 | Ga0207685_10169103 | Ga0207685_101691031 | 118 |
| 130 | 3300025907 | Ga0207645_10148563 | Ga0207645_101485632 | 118 |
| 131 | 3300025907 | Ga0207645_10197903 | Ga0207645_101979032 | 118 |
| 132 | 3300025910 | Ga0207684_10143114 | Ga0207684_101431143 | 118 |
| 133 | 3300025910 | Ga0207684_10380792 | Ga0207684_103807922 | 118 |
| 134 | 3300025910 | Ga0207684_11281685 | Ga0207684_112816851 | 118 |
| 135 | 3300025918 | Ga0207662_10626616 | Ga0207662_106266162 | 118 |
| 136 | 3300025922 | Ga0207646_10108003 | Ga0207646_101080032 | 118 |
| 137 | 3300025922 | Ga0207646_10752603 | Ga0207646_107526032 | 118 |
| 138 | 3300025922 | Ga0207646_10858878 | Ga0207646_108588781 | 118 |
| 139 | 3300025923 | Ga0207681_10270814 | Ga0207681_102708143 | 118 |
| 140 | 3300025923 | Ga0207681_10755910 | Ga0207681_107559102 | 118 |
| 141 | 3300025923 | Ga0207681_10771211 | Ga0207681_107712112 | 118 |
| 142 | 3300025926 | Ga0207659_10374371 | Ga0207659_103743712 | 118 |
| 143 | 3300025931 | Ga0207644_10422895 | Ga0207644_104228951 | 118 |
| 144 | 3300025932 | Ga0207690_10277761 | Ga0207690_102777612 | 118 |
| 145 | 3300025932 | Ga0207690_11745473 | Ga0207690_117454732 | 118 |
| 146 | 3300025933 | Ga0207706_10380539 | Ga0207706_103805393 | 118 |
| 147 | 3300025936 | Ga0207670_11199402 | Ga0207670_111994021 | 118 |
| 148 | 3300025937 | Ga0207669_10233798 | Ga0207669_102337982 | 118 |
| 149 | 3300025937 | Ga0207669_11088171 | Ga0207669_110881712 | 118 |
| 150 | 3300025939 | Ga0207665_10093078 | Ga0207665_100930784 | 118 |
| 151 | 3300025939 | Ga0207665_10500610 | Ga0207665_105006102 | 118 |
| 152 | 3300025940 | Ga0207691_10134191 | Ga0207691_101341912 | 118 |
| 153 | 3300025960 | Ga0207651_10881257 | Ga0207651_108812572 | 118 |
| 154 | 3300025972 | Ga0207668_10301164 | Ga0207668_103011642 | 118 |
| 155 | 3300025986 | Ga0207658_10129714 | Ga0207658_101297142 | 118 |
| 156 | 3300025986 | Ga0207658_11835028 | Ga0207658_118350281 | 118 |
| 157 | 3300026023 | Ga0207677_10519207 | Ga0207677_105192072 | 118 |
| 158 | 3300026035 | Ga0207703_10176409 | Ga0207703_101764092 | 118 |
| 159 | 3300026035 | Ga0207703_11797381 | Ga0207703_117973812 | 118 |
| 160 | 3300026075 | Ga0207708_11309524 | Ga0207708_113095242 | 118 |
| 161 | 3300026088 | Ga0207641_10248106 | Ga0207641_102481062 | 118 |
| 162 | 3300026116 | Ga0207674_10882211 | Ga0207674_108822111 | 118 |
| 163 | 3300026118 | Ga0207675_100414160 | Ga0207675_1004141601 | 118 |
| 164 | 3300026118 | Ga0207675_101504289 | Ga0207675_1015042892 | 118 |
| 165 | 3300026121 | Ga0207683_10867687 | Ga0207683_108676872 | 118 |
| 166 | 3300027907 | Ga0207428_10036207 | Ga0207428_100362073 | 118 |
| 167 | 3300027907 | Ga0207428_10155033 | Ga0207428_101550333 | 118 |
| 168 | 3300028379 | Ga0268266_10435865 | Ga0268266_104358652 | 118 |
| 169 | 3300028380 | Ga0268265_10094411 | Ga0268265_100944113 | 118 |
| 170 | 3300028380 | Ga0268265_11022435 | Ga0268265_110224352 | 118 |
| 171 | 3300028381 | Ga0268264_10920357 | Ga0268264_109203572 | 118 |
| 172 | 3300031711 | Ga0265314_10350617 | Ga0265314_103506171 | 118 |
| 173 | 3300031727 | Ga0316576_11068804 | Ga0316576_110688042 | 118 |
| 174 | 3300031728 | Ga0316578_10878088 | Ga0316578_108780881 | 118 |
| 175 | 3300031731 | Ga0307405_12078197 | Ga0307405_120781971 | 118 |
| 176 | 3300031824 | Ga0307413_10678045 | Ga0307413_106780452 | 118 |
| 177 | 3300031903 | Ga0307407_10031805 | Ga0307407_100318053 | 118 |
| 178 | 3300031995 | Ga0307409_100621942 | Ga0307409_1006219422 | 118 |
| 179 | 3300035083 | Ga0373926_0034517 | Ga0373926_0034517_334_693 | 118 |
| 180 | 3300035111 | Ga0373923_0355924 | Ga0373923_0355924_79_438 | 118 |
| 181 | 3300035114 | Ga0373939_0336845 | Ga0373939_0336845_171_536 | 118 |
| 182 | 3300035170 | Ga0373943_0070091 | Ga0373943_0070091_1038_1403 | 118 |
| 183 | 3300035172 | Ga0373955_1009778 | Ga0373955_1009778_62_436 | 118 |
| 184 | 3300035398 | Ga0316574_0796274 | Ga0316574_0796274_168_527 | 118 |
| 185 | 3300035410 | Ga0373924_0354952 | Ga0373924_0354952_206_565 | 118 |
| 186 | 3300035691 | Ga0373931_0280223 | Ga0373931_0280223_499_864 | 118 |
| 187 | 3300035692 | Ga0373935_0018386 | Ga0373935_0018386_410_775 | 118 |
| 188 | 3300035692 | Ga0373935_0082314 | Ga0373935_0082314_1716_2075 | 118 |
| 189 | 3300035695 | Ga0373927_0008834 | Ga0373927_0008834_2689_3048 | 118 |
| 190 | 3300035724 | Ga0373933_0895166 | Ga0373933_0895166_141_500 | 118 |
| 191 | 3300035725 | Ga0373947_0020314 | Ga0373947_0020314_520_879 | 118 |
| 192 | 3300035725 | Ga0373947_0237278 | Ga0373947_0237278_364_729 | 118 |
| 193 | 3300036401 | Ga0373937_0172154 | Ga0373937_0172154_790_1164 | 118 |
| 194 | 3300036401 | Ga0373937_0517230 | Ga0373937_0517230_313_672 | 118 |
| 195 | 3300036401 | Ga0373937_0594806 | Ga0373937_0594806_194_553 | 118 |
| 196 | 3300037068 | Ga0373925_0014607 | Ga0373925_0014607_4745_5110 | 118 |
| 197 | 3300037068 | Ga0373925_0014699 | Ga0373925_0014699_4376_4735 | 118 |
| 198 | 3300038726 | Ga0400490_44197 | Ga0400490_44197_15297_15686 | 118 |
| 199 | 3300038727 | Ga0400491_16147 | Ga0400491_16147_1548_1937 | 118 |
| 200 | 3300041404 | Ga0439436_0102806 | Ga0439436_0102806_23_379 | 118 |
| 201 | 3300041413 | Ga0439465_0128463 | Ga0439465_0128463_151_519 | 118 |
| 202 | 3300041498 | Ga0451841_0964905 | Ga0451841_0964905_17_373 | 118 |
| 203 | 3300041997 | Ga0439431_0030850 | Ga0439431_0030850_640_1008 | 118 |
| 204 | 3300042004 | Ga0439445_0070671 | Ga0439445_0070671_280_648 | 118 |
| 205 | 3300042876 | Ga0451577_0718223 | Ga0451577_0718223_374_733 | 118 |
| 206 | 3300044673 | Ga0453683_0085007 | Ga0453683_0085007_1554_1919 | 118 |
| 207 | 3300044673 | Ga0453683_0871652 | Ga0453683_0871652_47_406 | 118 |
| 208 | 3300045051 | Ga0451576_0903324 | Ga0451576_0903324_482_841 | 118 |
| 209 | 3300046472 | Ga0495580_0012474 | Ga0495580_0012474_5231_5596 | 118 |
| 210 | 3300046533 | Ga0495640_0198876 | Ga0495640_0198876_712_1086 | 118 |
| 211 | 3300048911 | Ga0496108_1661816 | Ga0496108_1661816_40_399 | 118 |
| 212 | 3300049570 | Ga0501033_0051533 | Ga0501033_0051533_1416_1778 | 118 |
| 213 | 3300049571 | Ga0501034_0012473 | Ga0501034_0012473_7398_7760 | 118 |
| 214 | 3300049580 | Ga0501046_0015888 | Ga0501046_0015888_791_1153 | 118 |
| 215 | 3300049581 | Ga0501047_0035145 | Ga0501047_0035145_3665_4027 | 118 |
| 216 | 3300049581 | Ga0501047_0131565 | Ga0501047_0131565_26_388 | 118 |
| 217 | 3300049583 | Ga0501067_0583329 | Ga0501067_0583329_102_467 | 118 |
| 218 | 3300049744 | Ga0501083_0561101 | Ga0501083_0561101_13_369 | 118 |
| 219 | 3300049823 | Ga0501044_0043179 | Ga0501044_0043179_1142_1504 | 118 |
| 220 | 3300050507 | nmdc:mga05p37_920579_c1 | nmdc:mga05p37_920579_c1_458_835 | 118 |
| 221 | 3300050508 | nmdc:mga09592_701632_c1 | nmdc:mga09592_701632_c1_173_529 | 118 |
| 222 | 3300050508 | nmdc:mga09592_761614_c1 | nmdc:mga09592_761614_c1_233_619 | 118 |
| 223 | 3300050509 | nmdc:mga0qj67_119409_c1 | nmdc:mga0qj67_119409_c1_458_814 | 118 |
| 224 | 3300050510 | nmdc:mga06r32_432223_c1 | nmdc:mga06r32_432223_c1_627_983 | 118 |
| 225 | 3300050511 | nmdc:mga08y16_106281_c1 | nmdc:mga08y16_106281_c1_180_539 | 118 |
| 226 | 3300050511 | nmdc:mga08y16_114693_c1 | nmdc:mga08y16_114693_c1_2031_2414 | 118 |
| 227 | 3300050511 | nmdc:mga08y16_28049_c1 | nmdc:mga08y16_28049_c1_35_394 | 118 |
| 228 | 3300050512 | nmdc:mga0n895_1526625_c1 | nmdc:mga0n895_1526625_c1_223_591 | 118 |
| 229 | 3300050512 | nmdc:mga0n895_667416_c1 | nmdc:mga0n895_667416_c1_375_740 | 118 |
| 230 | 3300050512 | nmdc:mga0n895_87109_c1 | nmdc:mga0n895_87109_c1_613_981 | 118 |
| 231 | 3300050513 | nmdc:mga0rr50_1014279_c1 | nmdc:mga0rr50_1014279_c1_173_541 | 118 |
| 232 | 3300050513 | nmdc:mga0rr50_188441_c1 | nmdc:mga0rr50_188441_c1_562_927 | 118 |
| 233 | 3300050513 | nmdc:mga0rr50_283714_c1 | nmdc:mga0rr50_283714_c1_974_1342 | 118 |
| 234 | 3300050514 | nmdc:mga08x19_1113471_c1 | nmdc:mga08x19_1113471_c1_131_517 | 118 |
| 235 | 3300050514 | nmdc:mga08x19_46564_c1 | nmdc:mga08x19_46564_c1_1042_1410 | 118 |
| 236 | 3300050515 | nmdc:mga0a205_1179238_c1 | nmdc:mga0a205_1179238_c1_150_509 | 118 |
| 237 | 3300050515 | nmdc:mga0a205_289492_c1 | nmdc:mga0a205_289492_c1_85_441 | 118 |
| 238 | 3300050515 | nmdc:mga0a205_895084_c1 | nmdc:mga0a205_895084_c1_261_626 | 118 |
| 239 | 3300053098 | Ga0500650_0380330 | Ga0500650_0380330_17_379 | 118 |
| 240 | 3300053103 | Ga0500555_026333 | Ga0500555_026333_259_624 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1iuj-assembly1.cif.gz_B | the structure of tt1380 protein from thermus thermophilus | 0.926 | 1 | 115 |
| 1iuj-assembly1.cif.gz_B | the structure of tt1380 protein from thermus thermophilus | 0.9088 | 1 | 115 |
| 3tvz-assembly1.cif.gz_A | structure of bacillus subtilis hmob | 0.896 | 2 | 107 |
| 3tvz-assembly3.cif.gz_C | structure of bacillus subtilis hmob | 0.8759 | 2 | 80 |
| 5uq4-assembly1.cif.gz_B | crystal structure of heme-degrading protein rv3592 from mycobacterium tuberculosis - heme free with cleaved protein | 0.8745 | 2 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1iujA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.92 | 1 | 115 | 3.30.70.100 |
| 1iujA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9114 | 1 | 115 | 3.30.70.100 |
| 4fvcE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8691 | 2 | 107 | 3.30.70.100 |
| 3kg1A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8367 | 2 | 116 | 3.30.70.100 |
| 3hx9B00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8273 | 1 | 113 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E9JHI4-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9597 | 2 | 118 |
GO:0004497
|
| AF-A0A850BGG5-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9576 | 1 | 118 |
GO:0004497
|
| AF-A0A850BGG5-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9498 | 1 | 118 |
GO:0004497
|
| AF-A0A524Q9V6-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9497 | 1 | 104 |
GO:0004497
|
| AF-A0A831ZHH2-F1-model_v4 | deleted | 0.945 | 1 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar