F353015

General Info

Members Datasets Scaffolds Average Seq Length
240 152 239 120

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10181562|Ga0316583_101815621
Length 119
Sequence VIVVTNRIPVAEGHQIDFEDRFKRRVHLVDQAPGFVRNEVHRPRPMKFDKGTWVDDKEKQGYYEVKTWWRSMEDFVAWTKSPAFGEAHRDRPPKEMFAGPNVLEVHEVFLSTDLDVGGS

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
118 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
119 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
152 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 0.42
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01CR06L 2088090003 Unclassified 501
2 Ga0065707_10883214 3300005295 Unclassified 572
3 Ga0070676_10130193 3300005328 Unclassified 1590
4 Ga0070676_10346873 3300005328 Bacteria 1020
5 Ga0070680_101860123 3300005336 Bacteria 522
6 Ga0068868_100597627 3300005338 Bacteria 977
7 Ga0070689_100994599 3300005340 Unclassified 746
8 Ga0070687_100751158 3300005343 Bacteria 686
9 Ga0070668_102094323 3300005347 Bacteria 522
10 Ga0070669_100353306 3300005353 Bacteria 1194
11 Ga0070669_100454109 3300005353 Unclassified 1057
12 Ga0070669_100818888 3300005353 Bacteria 792
13 Ga0070669_101283306 3300005353 Bacteria 634
14 Ga0070675_100545473 3300005354 Bacteria 1048
15 Ga0070671_100876319 3300005355 Bacteria 784
16 Ga0070673_100092646 3300005364 Bacteria 2472
17 Ga0070688_100376515 3300005365 Bacteria 1045
18 Ga0070659_100640442 3300005366 Unclassified 916
19 Ga0070667_100186906 3300005367 Bacteria 1834
20 Ga0070701_10412756 3300005438 Bacteria 858
21 Ga0070711_100068359 3300005439 Bacteria 2496
22 Ga0070705_100663023 3300005440 Unclassified 815
23 Ga0070705_101193064 3300005440 Bacteria 627
24 Ga0070705_101854732 3300005440 Bacteria 512
25 Ga0070694_100211418 3300005444 Bacteria 1451
26 Ga0070708_101831742 3300005445 Unclassified 563
27 Ga0070678_100758540 3300005456 Unclassified 878
28 Ga0070678_101077480 3300005456 Bacteria 741
29 Ga0070678_101190361 3300005456 Bacteria 706
30 Ga0070662_100564450 3300005457 Bacteria 955
31 Ga0070662_101816486 3300005457 Bacteria 527
32 Ga0070706_100486981 3300005467 Bacteria 1147
33 Ga0070706_100772946 3300005467 Unclassified 890
34 Ga0070706_101907679 3300005467 Bacteria 539
35 Ga0070707_100114189 3300005468 Bacteria 2620
36 Ga0070707_100938185 3300005468 Unclassified 830
37 Ga0070707_101398879 3300005468 Unclassified 666
38 Ga0070707_101637196 3300005468 Bacteria 611
39 Ga0070699_100090108 3300005518 Bacteria 2680
40 Ga0070699_100156474 3300005518 Bacteria 2017
41 Ga0070699_100231244 3300005518 Bacteria 1649
42 Ga0070697_100103775 3300005536 Bacteria 2364
43 Ga0070697_100213652 3300005536 Bacteria 1643
44 Ga0070697_100521097 3300005536 Bacteria 1041
45 Ga0070697_100847058 3300005536 Bacteria 810
46 Ga0070697_100907231 3300005536 Unclassified 782
47 Ga0070697_101858222 3300005536 Bacteria 539
48 Ga0070672_101186756 3300005543 Unclassified 680
49 Ga0070696_100051887 3300005546 Bacteria 2853
50 Ga0070693_100882302 3300005547 Bacteria 669
51 Ga0070665_101170984 3300005548 Bacteria 780
52 Ga0070704_100369269 3300005549 Bacteria 1216
53 Ga0070704_100643171 3300005549 Bacteria 936
54 Ga0070704_101141853 3300005549 Bacteria 709
55 Ga0070664_101102068 3300005564 Unclassified 748
56 Ga0068859_100929665 3300005617 Bacteria 954
57 Ga0068866_10669854 3300005718 Unclassified 708
58 Ga0068870_10163884 3300005840 Bacteria 1321
59 Ga0068863_100574145 3300005841 Bacteria 1115
60 Ga0068858_101339881 3300005842 Bacteria 705
61 Ga0068858_101726259 3300005842 Bacteria 618
62 Ga0068860_100962577 3300005843 Bacteria 871
63 Ga0068862_100128678 3300005844 Bacteria 2238
64 Ga0068862_100263203 3300005844 Unclassified 1575
65 Ga0070715_10325351 3300006163 Bacteria 831
66 Ga0070716_100130827 3300006173 Bacteria 1586
67 Ga0070716_100238332 3300006173 Bacteria 1232
68 Ga0070716_100340499 3300006173 Bacteria 1058
69 Ga0070712_100431215 3300006175 Bacteria 1094
70 Ga0070712_100526839 3300006175 Bacteria 993
71 Ga0075366_10410406 3300006195 Bacteria 834
72 Ga0075428_100500414 3300006844 Unclassified 1300
73 Ga0075428_100711503 3300006844 Bacteria 1070
74 Ga0075428_100716279 3300006844 Unclassified 1066
75 Ga0075430_100127689 3300006846 Bacteria 2120
76 Ga0075430_101371415 3300006846 Unclassified 581
77 Ga0075431_100441454 3300006847 Bacteria 1298
78 Ga0075431_101115455 3300006847 Unclassified 753
79 Ga0075433_10157353 3300006852 Bacteria 2022
80 Ga0075433_10239897 3300006852 Unclassified 1609
81 Ga0075434_100061634 3300006871 Bacteria 3733
82 Ga0075434_100660337 3300006871 Bacteria 1064
83 Ga0075429_100554680 3300006880 Bacteria 1007
84 Ga0075429_100971868 3300006880 Unclassified 743
85 Ga0075436_100164750 3300006914 Bacteria 1564
86 Ga0075436_100234690 3300006914 Bacteria 1303
87 Ga0075436_101158398 3300006914 Bacteria 583
88 Ga0097620_100929617 3300006931 Bacteria 954
89 Ga0111539_10011251 3300009094 Bacteria 11242
90 Ga0111539_10033995 3300009094 Bacteria 6185
91 Ga0111539_10102010 3300009094 Bacteria 3368
92 Ga0111539_10105126 3300009094 Unclassified 3312
93 Ga0111539_11906672 3300009094 Unclassified 689
94 Ga0114129_10429376 3300009147 Bacteria 1736
95 Ga0114129_10928189 3300009147 Bacteria 1101
96 Ga0114129_10957124 3300009147 Bacteria 1081
97 Ga0114129_11396033 3300009147 Unclassified 864
98 Ga0105249_13590261 3300009553 Unclassified 500
99 Ga0157373_11519682 3300013100 Bacteria 511
100 Ga0157378_11651037 3300013297 Unclassified 687
101 Ga0163162_11505248 3300013306 Unclassified 767
102 Ga0157375_10408383 3300013308 Unclassified 1524
103 Ga0157375_10861981 3300013308 Bacteria 1052
104 Ga0157380_10167659 3300014326 Bacteria 1915
105 Ga0157380_11818841 3300014326 Bacteria 668
106 Ga0157379_10000046 3300014968 Bacteria 75092
107 Ga0207642_10448490 3300025899 Unclassified 781
108 Ga0207685_10169103 3300025905 Bacteria 1004
109 Ga0207685_10385794 3300025905 Bacteria 715
110 Ga0207645_10148563 3300025907 Unclassified 1529
111 Ga0207645_10197903 3300025907 Bacteria 1321
112 Ga0207684_10143114 3300025910 Bacteria 2056
113 Ga0207684_10380792 3300025910 Bacteria 1213
114 Ga0207684_11281685 3300025910 Unclassified 604
115 Ga0207693_10590563 3300025915 Unclassified 865
116 Ga0207663_10498000 3300025916 Bacteria 946
117 Ga0207662_10626616 3300025918 Unclassified 750
118 Ga0207646_10108003 3300025922 Bacteria 2496
119 Ga0207646_10752603 3300025922 Unclassified 869
120 Ga0207646_10858878 3300025922 Bacteria 806
121 Ga0207681_10270814 3300025923 Bacteria 1333
122 Ga0207681_10755910 3300025923 Bacteria 810
123 Ga0207681_10771211 3300025923 Bacteria 802
124 Ga0207659_10374371 3300025926 Bacteria 1186
125 Ga0207644_10422895 3300025931 Bacteria 1092
126 Ga0207690_10277761 3300025932 Unclassified 1304
127 Ga0207690_11745473 3300025932 Bacteria 520
128 Ga0207706_10380539 3300025933 Bacteria 1225
129 Ga0207670_11199402 3300025936 Bacteria 642
130 Ga0207669_10233798 3300025937 Bacteria 1358
131 Ga0207669_11088171 3300025937 Bacteria 674
132 Ga0207665_10093078 3300025939 Bacteria 2092
133 Ga0207665_10500610 3300025939 Bacteria 938
134 Ga0207691_10134191 3300025940 Bacteria 2185
135 Ga0207667_10881550 3300025949 Unclassified 888
136 Ga0207651_10881257 3300025960 Unclassified 796
137 Ga0207668_10301164 3300025972 Unclassified 1323
138 Ga0207658_10129714 3300025986 Bacteria 2024
139 Ga0207658_11835028 3300025986 Bacteria 553
140 Ga0207677_10519207 3300026023 Bacteria 1033
141 Ga0207703_10176409 3300026035 Bacteria 1883
142 Ga0207703_11797381 3300026035 Bacteria 589
143 Ga0207708_11309524 3300026075 Bacteria 635
144 Ga0207641_10248106 3300026088 Bacteria 1662
145 Ga0207674_10882211 3300026116 Bacteria 862
146 Ga0207675_100414160 3300026118 Bacteria 1330
147 Ga0207675_101504289 3300026118 Unclassified 694
148 Ga0207683_10867687 3300026121 Unclassified 838
149 Ga0207428_10036207 3300027907 Bacteria 4028
150 Ga0207428_10155033 3300027907 Unclassified 1742
151 Ga0268266_10435865 3300028379 Bacteria 1244
152 Ga0268265_10094411 3300028380 Bacteria 2399
153 Ga0268265_11022435 3300028380 Unclassified 817
154 Ga0268264_10920357 3300028381 Bacteria 878
155 Ga0265314_10350617 3300031711 Unclassified 812
156 Ga0316576_11068804 3300031727 Bacteria 573
157 Ga0316578_10878088 3300031728 Unclassified 518
158 Ga0307405_12078197 3300031731 Bacteria 509
159 Ga0307413_10678045 3300031824 Bacteria 854
160 Ga0307407_10031805 3300031903 Bacteria 2862
161 Ga0307409_100621942 3300031995 Unclassified 1070
162 Ga0316583_10181562 3300032133 Unclassified 732
163 Ga0373926_0034517 3300035083 Bacteria 1791
164 Ga0373923_0355924 3300035111 Unclassified 700
165 Ga0373939_0336845 3300035114 Bacteria 610
166 Ga0373956_0006137 3300035119 Bacteria 4805
167 Ga0373943_0070091 3300035170 Bacteria 1773
168 Ga0373955_0077280 3300035172 Bacteria 1874
169 Ga0373955_1009778 3300035172 Bacteria 512
170 Ga0316574_0796274 3300035398 Unclassified 576
171 Ga0373924_0354952 3300035410 Unclassified 654
172 Ga0373931_0280223 3300035691 Bacteria 1023
173 Ga0373935_0018386 3300035692 Bacteria 4251
174 Ga0373935_0082314 3300035692 Unclassified 2094
175 Ga0373935_1186805 3300035692 Unclassified 569
176 Ga0373927_0008834 3300035695 Bacteria 6767
177 Ga0373933_0482728 3300035724 Unclassified 811
178 Ga0373933_0895166 3300035724 Unclassified 584
179 Ga0373947_0020314 3300035725 Bacteria 3833
180 Ga0373947_0237278 3300035725 Bacteria 1202
181 Ga0373947_0384568 3300035725 Bacteria 945
182 Ga0373937_0003425 3300036401 Bacteria 13313
183 Ga0373937_0172154 3300036401 Bacteria 2032
184 Ga0373937_0517230 3300036401 Bacteria 1134
185 Ga0373937_0594806 3300036401 Bacteria 1050
186 Ga0373925_0014607 3300037068 Bacteria 5674
187 Ga0373925_0014699 3300037068 Bacteria 5655
188 Ga0373925_1043608 3300037068 Unclassified 673
189 Ga0400490_44197 3300038726 Bacteria 17375
190 Ga0400491_16147 3300038727 Bacteria 3110
191 Ga0439436_0102806 3300041404 Bacteria 797
192 Ga0439465_0128463 3300041413 Bacteria 893
193 Ga0451841_0964905 3300041498 Bacteria 587
194 Ga0439431_0030850 3300041997 Bacteria 1330
195 Ga0439445_0070671 3300042004 Bacteria 965
196 Ga0451577_0718223 3300042876 Bacteria 905
197 Ga0453683_0085007 3300044673 Bacteria 1982
198 Ga0453683_0871652 3300044673 Bacteria 594
199 Ga0451576_0903324 3300045051 Unclassified 927
200 Ga0495580_0012474 3300046472 Bacteria 6514
201 Ga0495640_0198876 3300046533 Bacteria 1271
202 Ga0495613_0316584 3300046689 Bacteria 1078
203 Ga0496108_1661816 3300048911 Bacteria 527
204 Ga0501033_0051533 3300049570 Bacteria 3051
205 Ga0501034_0012473 3300049571 Bacteria 8779
206 Ga0501034_0104384 3300049571 Unclassified 2827
207 Ga0501043_0294482 3300049579 Bacteria 1241
208 Ga0501046_0015888 3300049580 Bacteria 6315
209 Ga0501046_0024930 3300049580 Bacteria 4900
210 Ga0501047_0035145 3300049581 Bacteria 4841
211 Ga0501047_0044293 3300049581 Bacteria 4299
212 Ga0501047_0131565 3300049581 Unclassified 2382
213 Ga0501048_0735334 3300049582 Unclassified 709
214 Ga0501067_0583329 3300049583 Bacteria 627
215 Ga0501070_0001850 3300049586 Bacteria 18685
216 Ga0501083_0561101 3300049744 Bacteria 743
217 Ga0501044_0043179 3300049823 Bacteria 4685
218 nmdc:mga05p37_920579_c1 3300050507 Unclassified 940
219 nmdc:mga09592_701632_c1 3300050508 Unclassified 861
220 nmdc:mga09592_761614_c1 3300050508 Bacteria 821
221 nmdc:mga0qj67_119409_c1 3300050509 Bacteria 2132
222 nmdc:mga06r32_432223_c1 3300050510 Bacteria 1297
223 nmdc:mga08y16_106281_c1 3300050511 Bacteria 2922
224 nmdc:mga08y16_114693_c1 3300050511 Unclassified 2805
225 nmdc:mga08y16_28049_c1 3300050511 Bacteria 5935
226 nmdc:mga0n895_1526625_c1 3300050512 Bacteria 634
227 nmdc:mga0n895_667416_c1 3300050512 Bacteria 1037
228 nmdc:mga0n895_87109_c1 3300050512 Bacteria 3120
229 nmdc:mga0rr50_1014279_c1 3300050513 Bacteria 707
230 nmdc:mga0rr50_188441_c1 3300050513 Bacteria 1689
231 nmdc:mga0rr50_283714_c1 3300050513 Bacteria 1382
232 nmdc:mga08x19_1113471_c1 3300050514 Bacteria 560
233 nmdc:mga08x19_46564_c1 3300050514 Bacteria 2774
234 nmdc:mga0a205_1179238_c1 3300050515 Unclassified 613
235 nmdc:mga0a205_289492_c1 3300050515 Unclassified 1512
236 nmdc:mga0a205_895084_c1 3300050515 Bacteria 734
237 Ga0495601_0777088 3300053077 Unclassified 609
238 Ga0500650_0380330 3300053098 Unclassified 613
239 Ga0500555_026333 3300053103 Bacteria 1662

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_100068359 Ga0070711_1000683592 113
2 3300006175 Ga0070712_100526839 Ga0070712_1005268391 113
3 3300025905 Ga0207685_10385794 Ga0207685_103857942 113
4 3300025915 Ga0207693_10590563 Ga0207693_105905632 113
5 3300025916 Ga0207663_10498000 Ga0207663_104980002 113
6 3300035119 Ga0373956_0006137 Ga0373956_0006137_3225_3584 113
7 3300035172 Ga0373955_0077280 Ga0373955_0077280_1356_1715 113
8 3300035692 Ga0373935_1186805 Ga0373935_1186805_132_491 113
9 3300035724 Ga0373933_0482728 Ga0373933_0482728_380_739 113
10 3300035725 Ga0373947_0384568 Ga0373947_0384568_505_864 113
11 3300036401 Ga0373937_0003425 Ga0373937_0003425_8332_8691 113
12 3300037068 Ga0373925_1043608 Ga0373925_1043608_208_567 113
13 3300046689 Ga0495613_0316584 Ga0495613_0316584_96_455 113
14 3300053077 Ga0495601_0777088 Ga0495601_0777088_61_420 113
15 iso_pu_bacteria 2836160341 2836164680 113
16 3300025949 Ga0207667_10881550 Ga0207667_108815502 114
17 3300005536 Ga0070697_100213652 Ga0070697_1002136523 116
18 3300032133 Ga0316583_10181562 Ga0316583_101815621 116
19 3300049571 Ga0501034_0104384 Ga0501034_0104384_904_1257 117
20 3300049579 Ga0501043_0294482 Ga0501043_0294482_184_537 117
21 3300049580 Ga0501046_0024930 Ga0501046_0024930_2515_2868 117
22 3300049581 Ga0501047_0044293 Ga0501047_0044293_2274_2627 117
23 3300049582 Ga0501048_0735334 Ga0501048_0735334_78_431 117
24 3300049586 Ga0501070_0001850 Ga0501070_0001850_15765_16118 117
25 2088090003 LJN_F7QKVOU01CR06L LJN_00607140 118
26 3300005295 Ga0065707_10883214 Ga0065707_108832141 118
27 3300005328 Ga0070676_10130193 Ga0070676_101301932 118
28 3300005328 Ga0070676_10346873 Ga0070676_103468732 118
29 3300005336 Ga0070680_101860123 Ga0070680_1018601231 118
30 3300005338 Ga0068868_100597627 Ga0068868_1005976271 118
31 3300005340 Ga0070689_100994599 Ga0070689_1009945992 118
32 3300005343 Ga0070687_100751158 Ga0070687_1007511581 118
33 3300005347 Ga0070668_102094323 Ga0070668_1020943231 118
34 3300005353 Ga0070669_100353306 Ga0070669_1003533062 118
35 3300005353 Ga0070669_100454109 Ga0070669_1004541091 118
36 3300005353 Ga0070669_100818888 Ga0070669_1008188882 118
37 3300005353 Ga0070669_101283306 Ga0070669_1012833062 118
38 3300005354 Ga0070675_100545473 Ga0070675_1005454731 118
39 3300005355 Ga0070671_100876319 Ga0070671_1008763191 118
40 3300005364 Ga0070673_100092646 Ga0070673_1000926461 118
41 3300005365 Ga0070688_100376515 Ga0070688_1003765152 118
42 3300005366 Ga0070659_100640442 Ga0070659_1006404422 118
43 3300005367 Ga0070667_100186906 Ga0070667_1001869063 118
44 3300005438 Ga0070701_10412756 Ga0070701_104127562 118
45 3300005440 Ga0070705_100663023 Ga0070705_1006630231 118
46 3300005440 Ga0070705_101193064 Ga0070705_1011930641 118
47 3300005440 Ga0070705_101854732 Ga0070705_1018547321 118
48 3300005444 Ga0070694_100211418 Ga0070694_1002114183 118
49 3300005445 Ga0070708_101831742 Ga0070708_1018317421 118
50 3300005456 Ga0070678_100758540 Ga0070678_1007585401 118
51 3300005456 Ga0070678_101077480 Ga0070678_1010774802 118
52 3300005456 Ga0070678_101190361 Ga0070678_1011903611 118
53 3300005457 Ga0070662_100564450 Ga0070662_1005644502 118
54 3300005457 Ga0070662_101816486 Ga0070662_1018164861 118
55 3300005467 Ga0070706_100486981 Ga0070706_1004869812 118
56 3300005467 Ga0070706_100772946 Ga0070706_1007729462 118
57 3300005467 Ga0070706_101907679 Ga0070706_1019076791 118
58 3300005468 Ga0070707_100114189 Ga0070707_1001141892 118
59 3300005468 Ga0070707_100938185 Ga0070707_1009381851 118
60 3300005468 Ga0070707_101398879 Ga0070707_1013988791 118
61 3300005468 Ga0070707_101637196 Ga0070707_1016371961 118
62 3300005518 Ga0070699_100090108 Ga0070699_1000901082 118
63 3300005518 Ga0070699_100156474 Ga0070699_1001564743 118
64 3300005518 Ga0070699_100231244 Ga0070699_1002312443 118
65 3300005536 Ga0070697_100103775 Ga0070697_1001037752 118
66 3300005536 Ga0070697_100521097 Ga0070697_1005210972 118
67 3300005536 Ga0070697_100847058 Ga0070697_1008470582 118
68 3300005536 Ga0070697_100907231 Ga0070697_1009072312 118
69 3300005536 Ga0070697_101858222 Ga0070697_1018582221 118
70 3300005543 Ga0070672_101186756 Ga0070672_1011867561 118
71 3300005546 Ga0070696_100051887 Ga0070696_1000518873 118
72 3300005547 Ga0070693_100882302 Ga0070693_1008823022 118
73 3300005548 Ga0070665_101170984 Ga0070665_1011709841 118
74 3300005549 Ga0070704_100369269 Ga0070704_1003692692 118
75 3300005549 Ga0070704_100643171 Ga0070704_1006431712 118
76 3300005549 Ga0070704_101141853 Ga0070704_1011418531 118
77 3300005564 Ga0070664_101102068 Ga0070664_1011020682 118
78 3300005617 Ga0068859_100929665 Ga0068859_1009296652 118
79 3300005718 Ga0068866_10669854 Ga0068866_106698541 118
80 3300005840 Ga0068870_10163884 Ga0068870_101638842 118
81 3300005841 Ga0068863_100574145 Ga0068863_1005741452 118
82 3300005842 Ga0068858_101339881 Ga0068858_1013398812 118
83 3300005842 Ga0068858_101726259 Ga0068858_1017262592 118
84 3300005843 Ga0068860_100962577 Ga0068860_1009625772 118
85 3300005844 Ga0068862_100128678 Ga0068862_1001286782 118
86 3300005844 Ga0068862_100263203 Ga0068862_1002632033 118
87 3300006163 Ga0070715_10325351 Ga0070715_103253512 118
88 3300006173 Ga0070716_100130827 Ga0070716_1001308272 118
89 3300006173 Ga0070716_100238332 Ga0070716_1002383322 118
90 3300006173 Ga0070716_100340499 Ga0070716_1003404991 118
91 3300006175 Ga0070712_100431215 Ga0070712_1004312152 118
92 3300006195 Ga0075366_10410406 Ga0075366_104104062 118
93 3300006844 Ga0075428_100500414 Ga0075428_1005004143 118
94 3300006844 Ga0075428_100711503 Ga0075428_1007115033 118
95 3300006844 Ga0075428_100716279 Ga0075428_1007162792 118
96 3300006846 Ga0075430_100127689 Ga0075430_1001276892 118
97 3300006846 Ga0075430_101371415 Ga0075430_1013714152 118
98 3300006847 Ga0075431_100441454 Ga0075431_1004414542 118
99 3300006847 Ga0075431_101115455 Ga0075431_1011154552 118
100 3300006852 Ga0075433_10157353 Ga0075433_101573533 118
101 3300006852 Ga0075433_10239897 Ga0075433_102398973 118
102 3300006871 Ga0075434_100061634 Ga0075434_1000616341 118
103 3300006871 Ga0075434_100660337 Ga0075434_1006603372 118
104 3300006880 Ga0075429_100554680 Ga0075429_1005546802 118
105 3300006880 Ga0075429_100971868 Ga0075429_1009718682 118
106 3300006914 Ga0075436_100164750 Ga0075436_1001647502 118
107 3300006914 Ga0075436_100234690 Ga0075436_1002346902 118
108 3300006914 Ga0075436_101158398 Ga0075436_1011583981 118
109 3300006931 Ga0097620_100929617 Ga0097620_1009296172 118
110 3300009094 Ga0111539_10011251 Ga0111539_1001125111 118
111 3300009094 Ga0111539_10033995 Ga0111539_100339952 118
112 3300009094 Ga0111539_10102010 Ga0111539_101020102 118
113 3300009094 Ga0111539_10105126 Ga0111539_101051263 118
114 3300009094 Ga0111539_11906672 Ga0111539_119066721 118
115 3300009147 Ga0114129_10429376 Ga0114129_104293763 118
116 3300009147 Ga0114129_10928189 Ga0114129_109281892 118
117 3300009147 Ga0114129_10957124 Ga0114129_109571242 118
118 3300009147 Ga0114129_11396033 Ga0114129_113960332 118
119 3300009553 Ga0105249_13590261 Ga0105249_135902612 118
120 3300013100 Ga0157373_11519682 Ga0157373_115196821 118
121 3300013297 Ga0157378_11651037 Ga0157378_116510372 118
122 3300013306 Ga0163162_11505248 Ga0163162_115052482 118
123 3300013308 Ga0157375_10408383 Ga0157375_104083832 118
124 3300013308 Ga0157375_10861981 Ga0157375_108619812 118
125 3300014326 Ga0157380_10167659 Ga0157380_101676591 118
126 3300014326 Ga0157380_11818841 Ga0157380_118188412 118
127 3300014968 Ga0157379_10000046 Ga0157379_1000004624 118
128 3300025899 Ga0207642_10448490 Ga0207642_104484901 118
129 3300025905 Ga0207685_10169103 Ga0207685_101691031 118
130 3300025907 Ga0207645_10148563 Ga0207645_101485632 118
131 3300025907 Ga0207645_10197903 Ga0207645_101979032 118
132 3300025910 Ga0207684_10143114 Ga0207684_101431143 118
133 3300025910 Ga0207684_10380792 Ga0207684_103807922 118
134 3300025910 Ga0207684_11281685 Ga0207684_112816851 118
135 3300025918 Ga0207662_10626616 Ga0207662_106266162 118
136 3300025922 Ga0207646_10108003 Ga0207646_101080032 118
137 3300025922 Ga0207646_10752603 Ga0207646_107526032 118
138 3300025922 Ga0207646_10858878 Ga0207646_108588781 118
139 3300025923 Ga0207681_10270814 Ga0207681_102708143 118
140 3300025923 Ga0207681_10755910 Ga0207681_107559102 118
141 3300025923 Ga0207681_10771211 Ga0207681_107712112 118
142 3300025926 Ga0207659_10374371 Ga0207659_103743712 118
143 3300025931 Ga0207644_10422895 Ga0207644_104228951 118
144 3300025932 Ga0207690_10277761 Ga0207690_102777612 118
145 3300025932 Ga0207690_11745473 Ga0207690_117454732 118
146 3300025933 Ga0207706_10380539 Ga0207706_103805393 118
147 3300025936 Ga0207670_11199402 Ga0207670_111994021 118
148 3300025937 Ga0207669_10233798 Ga0207669_102337982 118
149 3300025937 Ga0207669_11088171 Ga0207669_110881712 118
150 3300025939 Ga0207665_10093078 Ga0207665_100930784 118
151 3300025939 Ga0207665_10500610 Ga0207665_105006102 118
152 3300025940 Ga0207691_10134191 Ga0207691_101341912 118
153 3300025960 Ga0207651_10881257 Ga0207651_108812572 118
154 3300025972 Ga0207668_10301164 Ga0207668_103011642 118
155 3300025986 Ga0207658_10129714 Ga0207658_101297142 118
156 3300025986 Ga0207658_11835028 Ga0207658_118350281 118
157 3300026023 Ga0207677_10519207 Ga0207677_105192072 118
158 3300026035 Ga0207703_10176409 Ga0207703_101764092 118
159 3300026035 Ga0207703_11797381 Ga0207703_117973812 118
160 3300026075 Ga0207708_11309524 Ga0207708_113095242 118
161 3300026088 Ga0207641_10248106 Ga0207641_102481062 118
162 3300026116 Ga0207674_10882211 Ga0207674_108822111 118
163 3300026118 Ga0207675_100414160 Ga0207675_1004141601 118
164 3300026118 Ga0207675_101504289 Ga0207675_1015042892 118
165 3300026121 Ga0207683_10867687 Ga0207683_108676872 118
166 3300027907 Ga0207428_10036207 Ga0207428_100362073 118
167 3300027907 Ga0207428_10155033 Ga0207428_101550333 118
168 3300028379 Ga0268266_10435865 Ga0268266_104358652 118
169 3300028380 Ga0268265_10094411 Ga0268265_100944113 118
170 3300028380 Ga0268265_11022435 Ga0268265_110224352 118
171 3300028381 Ga0268264_10920357 Ga0268264_109203572 118
172 3300031711 Ga0265314_10350617 Ga0265314_103506171 118
173 3300031727 Ga0316576_11068804 Ga0316576_110688042 118
174 3300031728 Ga0316578_10878088 Ga0316578_108780881 118
175 3300031731 Ga0307405_12078197 Ga0307405_120781971 118
176 3300031824 Ga0307413_10678045 Ga0307413_106780452 118
177 3300031903 Ga0307407_10031805 Ga0307407_100318053 118
178 3300031995 Ga0307409_100621942 Ga0307409_1006219422 118
179 3300035083 Ga0373926_0034517 Ga0373926_0034517_334_693 118
180 3300035111 Ga0373923_0355924 Ga0373923_0355924_79_438 118
181 3300035114 Ga0373939_0336845 Ga0373939_0336845_171_536 118
182 3300035170 Ga0373943_0070091 Ga0373943_0070091_1038_1403 118
183 3300035172 Ga0373955_1009778 Ga0373955_1009778_62_436 118
184 3300035398 Ga0316574_0796274 Ga0316574_0796274_168_527 118
185 3300035410 Ga0373924_0354952 Ga0373924_0354952_206_565 118
186 3300035691 Ga0373931_0280223 Ga0373931_0280223_499_864 118
187 3300035692 Ga0373935_0018386 Ga0373935_0018386_410_775 118
188 3300035692 Ga0373935_0082314 Ga0373935_0082314_1716_2075 118
189 3300035695 Ga0373927_0008834 Ga0373927_0008834_2689_3048 118
190 3300035724 Ga0373933_0895166 Ga0373933_0895166_141_500 118
191 3300035725 Ga0373947_0020314 Ga0373947_0020314_520_879 118
192 3300035725 Ga0373947_0237278 Ga0373947_0237278_364_729 118
193 3300036401 Ga0373937_0172154 Ga0373937_0172154_790_1164 118
194 3300036401 Ga0373937_0517230 Ga0373937_0517230_313_672 118
195 3300036401 Ga0373937_0594806 Ga0373937_0594806_194_553 118
196 3300037068 Ga0373925_0014607 Ga0373925_0014607_4745_5110 118
197 3300037068 Ga0373925_0014699 Ga0373925_0014699_4376_4735 118
198 3300038726 Ga0400490_44197 Ga0400490_44197_15297_15686 118
199 3300038727 Ga0400491_16147 Ga0400491_16147_1548_1937 118
200 3300041404 Ga0439436_0102806 Ga0439436_0102806_23_379 118
201 3300041413 Ga0439465_0128463 Ga0439465_0128463_151_519 118
202 3300041498 Ga0451841_0964905 Ga0451841_0964905_17_373 118
203 3300041997 Ga0439431_0030850 Ga0439431_0030850_640_1008 118
204 3300042004 Ga0439445_0070671 Ga0439445_0070671_280_648 118
205 3300042876 Ga0451577_0718223 Ga0451577_0718223_374_733 118
206 3300044673 Ga0453683_0085007 Ga0453683_0085007_1554_1919 118
207 3300044673 Ga0453683_0871652 Ga0453683_0871652_47_406 118
208 3300045051 Ga0451576_0903324 Ga0451576_0903324_482_841 118
209 3300046472 Ga0495580_0012474 Ga0495580_0012474_5231_5596 118
210 3300046533 Ga0495640_0198876 Ga0495640_0198876_712_1086 118
211 3300048911 Ga0496108_1661816 Ga0496108_1661816_40_399 118
212 3300049570 Ga0501033_0051533 Ga0501033_0051533_1416_1778 118
213 3300049571 Ga0501034_0012473 Ga0501034_0012473_7398_7760 118
214 3300049580 Ga0501046_0015888 Ga0501046_0015888_791_1153 118
215 3300049581 Ga0501047_0035145 Ga0501047_0035145_3665_4027 118
216 3300049581 Ga0501047_0131565 Ga0501047_0131565_26_388 118
217 3300049583 Ga0501067_0583329 Ga0501067_0583329_102_467 118
218 3300049744 Ga0501083_0561101 Ga0501083_0561101_13_369 118
219 3300049823 Ga0501044_0043179 Ga0501044_0043179_1142_1504 118
220 3300050507 nmdc:mga05p37_920579_c1 nmdc:mga05p37_920579_c1_458_835 118
221 3300050508 nmdc:mga09592_701632_c1 nmdc:mga09592_701632_c1_173_529 118
222 3300050508 nmdc:mga09592_761614_c1 nmdc:mga09592_761614_c1_233_619 118
223 3300050509 nmdc:mga0qj67_119409_c1 nmdc:mga0qj67_119409_c1_458_814 118
224 3300050510 nmdc:mga06r32_432223_c1 nmdc:mga06r32_432223_c1_627_983 118
225 3300050511 nmdc:mga08y16_106281_c1 nmdc:mga08y16_106281_c1_180_539 118
226 3300050511 nmdc:mga08y16_114693_c1 nmdc:mga08y16_114693_c1_2031_2414 118
227 3300050511 nmdc:mga08y16_28049_c1 nmdc:mga08y16_28049_c1_35_394 118
228 3300050512 nmdc:mga0n895_1526625_c1 nmdc:mga0n895_1526625_c1_223_591 118
229 3300050512 nmdc:mga0n895_667416_c1 nmdc:mga0n895_667416_c1_375_740 118
230 3300050512 nmdc:mga0n895_87109_c1 nmdc:mga0n895_87109_c1_613_981 118
231 3300050513 nmdc:mga0rr50_1014279_c1 nmdc:mga0rr50_1014279_c1_173_541 118
232 3300050513 nmdc:mga0rr50_188441_c1 nmdc:mga0rr50_188441_c1_562_927 118
233 3300050513 nmdc:mga0rr50_283714_c1 nmdc:mga0rr50_283714_c1_974_1342 118
234 3300050514 nmdc:mga08x19_1113471_c1 nmdc:mga08x19_1113471_c1_131_517 118
235 3300050514 nmdc:mga08x19_46564_c1 nmdc:mga08x19_46564_c1_1042_1410 118
236 3300050515 nmdc:mga0a205_1179238_c1 nmdc:mga0a205_1179238_c1_150_509 118
237 3300050515 nmdc:mga0a205_289492_c1 nmdc:mga0a205_289492_c1_85_441 118
238 3300050515 nmdc:mga0a205_895084_c1 nmdc:mga0a205_895084_c1_261_626 118
239 3300053098 Ga0500650_0380330 Ga0500650_0380330_17_379 118
240 3300053103 Ga0500555_026333 Ga0500555_026333_259_624 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

1

90

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iuj-assembly1.cif.gz_B the structure of tt1380 protein from thermus thermophilus 0.926 1 115
1iuj-assembly1.cif.gz_B the structure of tt1380 protein from thermus thermophilus 0.9088 1 115
3tvz-assembly1.cif.gz_A structure of bacillus subtilis hmob 0.896 2 107
3tvz-assembly3.cif.gz_C structure of bacillus subtilis hmob 0.8759 2 80
5uq4-assembly1.cif.gz_B crystal structure of heme-degrading protein rv3592 from mycobacterium tuberculosis - heme free with cleaved protein 0.8745 2 113
ID Description Score Start End Superfamily
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.92 1 115 3.30.70.100
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9114 1 115 3.30.70.100
4fvcE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8691 2 107 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8367 2 116 3.30.70.100
3hx9B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8273 1 113 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2E9JHI4-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9597 2 118 GO:0004497
AF-A0A850BGG5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9576 1 118 GO:0004497
AF-A0A850BGG5-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9498 1 118 GO:0004497
AF-A0A524Q9V6-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9497 1 104 GO:0004497
AF-A0A831ZHH2-F1-model_v4 deleted 0.945 1 118

Feature Viewer

pLDDT pTM Quality
92.56 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map