F352978

General Info

Members Datasets Scaffolds Average Seq Length
240 136 480 209

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10078016|Ga0265338_100780163
Length 220
Sequence LSARDSILERVRDAIAGASAGPIPRDYRRAVLSSDRVELFCERVSDYRADVRVISVGQEAEEIATVCVELGARRLVVPEGLPVHLRPVGVEFVEDADLTSHELAALDGVVTGCTVAIAETGTIVLTAAPDEGRRAITLVPDLHICIVQELRIVTLVPEAIARVKRAVGASRRPVTFISGPSATSDIELSRVEGVHGPRKLVVLVCLADLRTVPSASTDED

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
73 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
76 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
77 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
84 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
135 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
136 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.08
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10078016 3300028800 Bacteria 2796
2 Ga0070682_100640064 3300005337 Bacteria 845
3 Ga0070687_100180288 3300005343 Bacteria 1265
4 Ga0070669_100761528 3300005353 Bacteria 821
5 Ga0070671_100444360 3300005355 Bacteria 1112
6 Ga0070674_100263106 3300005356 Bacteria 1360
7 Ga0070674_100310608 3300005356 Bacteria 1260
8 Ga0070688_100534888 3300005365 Bacteria 889
9 Ga0070659_100110982 3300005366 Bacteria 2214
10 Ga0070659_100346967 3300005366 Bacteria 1245
11 Ga0070701_10157264 3300005438 Bacteria 1314
12 Ga0070701_10238296 3300005438 Bacteria 1093
13 Ga0070711_100740777 3300005439 Bacteria 830
14 Ga0070708_100153066 3300005445 Bacteria 2146
15 Ga0070678_100262226 3300005456 Bacteria 1454
16 Ga0068867_100095086 3300005459 Bacteria 2267
17 Ga0068867_100171919 3300005459 Bacteria 1717
18 Ga0070684_100323449 3300005535 Bacteria 1417
19 Ga0070696_100418600 3300005546 Bacteria 1051
20 Ga0070665_100193540 3300005548 Bacteria 2034
21 Ga0070665_101031537 3300005548 Bacteria 834
22 Ga0070664_100090447 3300005564 Bacteria 2649
23 Ga0068854_100165917 3300005578 Bacteria 1714
24 Ga0068856_100467398 3300005614 Bacteria 1282
25 Ga0068856_100884741 3300005614 Bacteria 912
26 Ga0068856_100983692 3300005614 Bacteria 862
27 Ga0070702_100108417 3300005615 Bacteria 1717
28 Ga0068852_100064469 3300005616 Bacteria 3194
29 Ga0068859_100149443 3300005617 Bacteria 2412
30 Ga0068866_10180681 3300005718 Bacteria 1246
31 Ga0068861_100093569 3300005719 Bacteria 2377
32 Ga0068851_10186091 3300005834 Bacteria 1152
33 Ga0081455_10032672 3300005937 Bacteria 4687
34 Ga0070716_100420427 3300006173 Unclassified 966
35 Ga0075434_100011904 3300006871 Bacteria 8226
36 Ga0075436_100353642 3300006914 Bacteria 1059
37 Ga0097620_100149457 3300006931 Bacteria 2412
38 Ga0075435_100006915 3300007076 Bacteria 8048
39 Ga0111539_10063063 3300009094 Bacteria 4386
40 Ga0105245_10151692 3300009098 Bacteria 2192
41 Ga0105245_10818809 3300009098 Bacteria 970
42 Ga0105243_10009668 3300009148 Bacteria 7341
43 Ga0105243_10350012 3300009148 Bacteria 1356
44 Ga0105242_10234069 3300009176 Bacteria 1648
45 Ga0105239_10022953 3300010375 Bacteria 6879
46 Ga0105246_10008032 3300011119 Bacteria 6475
47 Ga0163162_10478554 3300013306 Bacteria 1376
48 Ga0157375_10210814 3300013308 Bacteria 2100
49 Ga0163163_10031392 3300014325 Bacteria 5127
50 Ga0163163_10360998 3300014325 Bacteria 1509
51 Ga0157380_10068858 3300014326 Bacteria 2854
52 Ga0182008_10309935 3300014497 Bacteria 828
53 Ga0157379_10106952 3300014968 Bacteria 2511
54 Ga0157376_10014230 3300014969 Bacteria 5966
55 Ga0157376_10161997 3300014969 Bacteria 2029
56 Ga0157376_10843763 3300014969 Bacteria 931
57 Ga0163161_10102934 3300017792 Bacteria 2127
58 Ga0207657_10097951 3300025919 Bacteria 2438
59 Ga0207687_10499842 3300025927 Bacteria 1015
60 Ga0207664_10621442 3300025929 Unclassified 971
61 Ga0207690_10077537 3300025932 Bacteria 2310
62 Ga0207709_10018854 3300025935 Bacteria 3870
63 Ga0207669_10044993 3300025937 Bacteria 2598
64 Ga0207704_10357485 3300025938 Bacteria 1139
65 Ga0207691_10027454 3300025940 Bacteria 5336
66 Ga0207711_10206779 3300025941 Bacteria 1792
67 Ga0207661_10400958 3300025944 Bacteria 1244
68 Ga0207679_10848918 3300025945 Bacteria 834
69 Ga0207640_10161517 3300025981 Bacteria 1658
70 Ga0207703_10613184 3300026035 Bacteria 1030
71 Ga0207702_10007683 3300026078 Bacteria 9166
72 Ga0207648_10033591 3300026089 Bacteria 4524
73 Ga0207675_100034911 3300026118 Bacteria 4689
74 Ga0207675_101078492 3300026118 Bacteria 823
75 Ga0207683_10092976 3300026121 Bacteria 2687
76 Ga0207683_10662436 3300026121 Bacteria 967
77 Ga0207683_11036895 3300026121 Bacteria 761
78 Ga0207698_10186097 3300026142 Bacteria 1845
79 Ga0207428_10023154 3300027907 Bacteria 5226
80 Ga0268266_10136843 3300028379 Bacteria 2195
81 Ga0268266_10729642 3300028379 Bacteria 956
82 Ga0265319_1041505 3300028563 Bacteria 1552
83 Ga0395900_0029656 3300037418 Bacteria 5613
84 Ga0395900_0135432 3300037418 Bacteria 2523
85 Ga0395898_0015888 3300037466 Bacteria 7713
86 Ga0395898_0019245 3300037466 Bacteria 6950
87 Ga0395901_0015821 3300038443 Bacteria 7687
88 Ga0395901_0363956 3300038443 Bacteria 1491
89 Ga0439439_0002945 3300041406 Bacteria 3697
90 Ga0451853_1465929 3300041512 Bacteria 804
91 Ga0439431_0027031 3300041997 Bacteria 1409
92 Ga0439433_0014497 3300041999 Bacteria 1736
93 Ga0439449_0060630 3300042007 Bacteria 1396
94 Ga0439457_031754 3300042014 Bacteria 1171
95 Ga0450920_006104 3300042122 Bacteria 2158
96 Ga0439446_0000697 3300042156 Bacteria 6994
97 Ga0466969_0016892 3300044656 Bacteria 3816
98 Ga0466968_0074673 3300044735 Bacteria 1481
99 Ga0466957_0258425 3300044842 Bacteria 1160
100 Ga0495603_0122548 3300046455 Bacteria 1515
101 Ga0495605_0111064 3300046474 Bacteria 1251
102 Ga0495588_0110477 3300046674 Bacteria 1448
103 Ga0495670_0339299 3300046691 Bacteria 808
104 Ga0496100_0192388 3300048903 Bacteria 1482
105 Ga0496101_0002594 3300048904 Bacteria 11106
106 Ga0496101_0053451 3300048904 Bacteria 2914
107 Ga0496101_0071838 3300048904 Bacteria 2538
108 Ga0496101_0122245 3300048904 Bacteria 1969
109 Ga0496102_0198680 3300048905 Bacteria 1890
110 Ga0496104_0013017 3300048907 Bacteria 7491
111 Ga0496104_0080196 3300048907 Bacteria 3112
112 Ga0496104_0904712 3300048907 Bacteria 787
113 Ga0496105_0196424 3300048908 Bacteria 1648
114 Ga0496105_0525332 3300048908 Bacteria 926
115 Ga0496105_0588043 3300048908 Bacteria 865
116 Ga0496105_0655476 3300048908 Bacteria 810
117 Ga0496106_0111173 3300048909 Bacteria 2133
118 Ga0496106_0188432 3300048909 Bacteria 1639
119 Ga0496106_1390186 3300048909 Bacteria 543
120 Ga0496107_0070002 3300048910 Bacteria 2547
121 Ga0496108_0141467 3300048911 Bacteria 2073
122 Ga0496109_0258660 3300048912 Bacteria 1640
123 Ga0496110_0092797 3300048913 Bacteria 2702
124 Ga0496110_0100014 3300048913 Bacteria 2599
125 Ga0496110_0147719 3300048913 Bacteria 2127
126 Ga0496110_0239584 3300048913 Bacteria 1650
127 Ga0496111_0277342 3300048914 Bacteria 1243
128 Ga0496114_0097169 3300048917 Bacteria 2508
129 Ga0496114_0125418 3300048917 Bacteria 2213
130 Ga0496114_0213708 3300048917 Bacteria 1692
131 Ga0496114_0251528 3300048917 Bacteria 1555
132 Ga0496114_0542964 3300048917 Bacteria 1027
133 Ga0501031_0006829 3300049568 Bacteria 7446
134 Ga0501031_0011672 3300049568 Bacteria 5731
135 Ga0501031_0015857 3300049568 Bacteria 4892
136 Ga0501031_0065009 3300049568 Bacteria 2376
137 Ga0501032_0012079 3300049569 Bacteria 6183
138 Ga0501036_0025304 3300049572 Bacteria 5007
139 Ga0501036_0028152 3300049572 Bacteria 4750
140 Ga0501036_0281543 3300049572 Bacteria 1391
141 Ga0501036_0731522 3300049572 Bacteria 817
142 Ga0501038_0098831 3300049574 Bacteria 2433
143 Ga0501038_0157323 3300049574 Bacteria 1849
144 Ga0501039_0018001 3300049575 Bacteria 5419
145 Ga0501039_0026684 3300049575 Bacteria 4439
146 Ga0501040_0027626 3300049576 Bacteria 3821
147 Ga0501040_0082746 3300049576 Bacteria 2225
148 Ga0501040_0125945 3300049576 Bacteria 1799
149 Ga0501041_0000621 3300049577 Bacteria 18532
150 Ga0501041_0059314 3300049577 Bacteria 2342
151 Ga0501041_0314519 3300049577 Bacteria 987
152 Ga0501041_0461943 3300049577 Bacteria 806
153 Ga0501042_0040983 3300049578 Bacteria 3291
154 Ga0501042_0050764 3300049578 Bacteria 2958
155 Ga0501042_0058352 3300049578 Bacteria 2755
156 Ga0501043_0115639 3300049579 Bacteria 2105
157 Ga0501043_0159153 3300049579 Bacteria 1765
158 Ga0501046_0022883 3300049580 Bacteria 5146
159 Ga0501046_0716719 3300049580 Bacteria 704
160 Ga0501047_0107687 3300049581 Bacteria 2669
161 Ga0501047_0138708 3300049581 Bacteria 2311
162 Ga0501047_0216942 3300049581 Bacteria 1770
163 Ga0501048_0008138 3300049582 Bacteria 7932
164 Ga0501048_0020762 3300049582 Bacteria 4813
165 Ga0501067_0014933 3300049583 Bacteria 4297
166 Ga0501067_0359997 3300049583 Bacteria 811
167 Ga0501068_0050690 3300049584 Bacteria 2509
168 Ga0501068_0076456 3300049584 Bacteria 2049
169 Ga0501068_0138747 3300049584 Bacteria 1523
170 Ga0501069_0019370 3300049585 Bacteria 3679
171 Ga0501070_0016483 3300049586 Bacteria 6208
172 Ga0501070_0027868 3300049586 Bacteria 4738
173 Ga0501071_0010447 3300049587 Bacteria 6222
174 Ga0501071_0018853 3300049587 Bacteria 4784
175 Ga0501071_0032505 3300049587 Bacteria 3705
176 Ga0501071_0218343 3300049587 Bacteria 1434
177 Ga0501071_0778905 3300049587 Bacteria 737
178 Ga0501072_0015612 3300049588 Bacteria 5820
179 Ga0501072_0025056 3300049588 Bacteria 4644
180 Ga0501072_0242778 3300049588 Bacteria 1435
181 Ga0501072_0316055 3300049588 Bacteria 1241
182 Ga0501073_0081339 3300049589 Bacteria 2253
183 Ga0501074_0014554 3300049590 Bacteria 5723
184 Ga0501074_0022818 3300049590 Bacteria 4550
185 Ga0501074_0075362 3300049590 Bacteria 2422
186 Ga0501075_0018328 3300049591 Bacteria 5065
187 Ga0501075_0031833 3300049591 Bacteria 3917
188 Ga0501076_0008356 3300049592 Bacteria 7586
189 Ga0501076_0027759 3300049592 Bacteria 4389
190 Ga0501076_0030960 3300049592 Bacteria 4169
191 Ga0501076_0060942 3300049592 Bacteria 3003
192 Ga0501076_0072884 3300049592 Bacteria 2749
193 Ga0501077_0005736 3300049593 Bacteria 7561
194 Ga0501077_0056635 3300049593 Bacteria 2488
195 Ga0501077_0191435 3300049593 Bacteria 1299
196 Ga0501079_0008916 3300049741 Bacteria 7595
197 Ga0501079_0012257 3300049741 Bacteria 6542
198 Ga0501079_0470383 3300049741 Bacteria 987
199 Ga0501080_0027644 3300049742 Bacteria 5275
200 Ga0501080_0044768 3300049742 Bacteria 4119
201 Ga0501080_0718167 3300049742 Bacteria 880
202 Ga0501080_0768518 3300049742 Bacteria 846
203 Ga0501081_0004211 3300049743 Bacteria 9223
204 Ga0501081_0004371 3300049743 Bacteria 9060
205 Ga0501081_0057965 3300049743 Bacteria 2679
206 Ga0501081_0072831 3300049743 Bacteria 2395
207 Ga0501081_0193191 3300049743 Bacteria 1474
208 Ga0501081_0447795 3300049743 Bacteria 959
209 Ga0501083_0018665 3300049744 Bacteria 4831
210 Ga0501083_0297524 3300049744 Bacteria 1050
211 Ga0501035_0010671 3300049822 Bacteria 8504
212 Ga0501035_0043290 3300049822 Bacteria 4058
213 Ga0501044_0093310 3300049823 Bacteria 3035
214 Ga0501044_0145000 3300049823 Bacteria 2361
215 Ga0501044_0186802 3300049823 Bacteria 2037
216 Ga0501044_0440996 3300049823 Bacteria 1210
217 Ga0501045_0002656 3300049824 Bacteria 12191
218 Ga0501045_0020235 3300049824 Bacteria 4751
219 Ga0501045_0058243 3300049824 Bacteria 2828
220 Ga0501045_0334967 3300049824 Bacteria 1126
221 Ga0501045_0959387 3300049824 Bacteria 627
222 nmdc:mga05p37_541311_c1 3300050507 Bacteria 1327
223 nmdc:mga0n895_29982_c1 3300050512 Bacteria 5194
224 nmdc:mga0rr50_170982_c1 3300050513 Bacteria 1771
225 nmdc:mga08x19_257425_c1 3300050514 Bacteria 1206
226 nmdc:mga0a205_195968_c1 3300050515 Bacteria 1911
227 Ga0501084_0014292 3300054114 Bacteria 6575
228 Ga0501084_0021551 3300054114 Bacteria 5371
229 Ga0501084_0031950 3300054114 Bacteria 4402
230 Ga0501084_0104291 3300054114 Bacteria 2381
231 Ga0501084_0350419 3300054114 Bacteria 1247
232 Ga0501082_0040507 3300060353 Bacteria 4018
233 Ga0501082_0099062 3300060353 Bacteria 2520
234 Ga0501082_0107410 3300060353 Bacteria 2414
235 Ga0501082_0202965 3300060353 Bacteria 1725
236 Ga0501082_0378531 3300060353 Unclassified 1235
237 Ga0530510_0011148 3300061734 Bacteria 6306
238 Ga0530510_0437858 3300061734 Bacteria 987
239 2875397981 2875391855 Bacteria 7600475
240 2919716471 2919713450 Bacteria 7431245
241 Ga0265338_10078016
242 Ga0070682_100640064
243 Ga0070687_100180288
244 Ga0070669_100761528
245 Ga0070671_100444360
246 Ga0070674_100263106
247 Ga0070674_100310608
248 Ga0070688_100534888
249 Ga0070659_100110982
250 Ga0070659_100346967
251 Ga0070701_10157264
252 Ga0070701_10238296
253 Ga0070711_100740777
254 Ga0070708_100153066
255 Ga0070678_100262226
256 Ga0068867_100095086
257 Ga0068867_100171919
258 Ga0070684_100323449
259 Ga0070696_100418600
260 Ga0070665_100193540
261 Ga0070665_101031537
262 Ga0070664_100090447
263 Ga0068854_100165917
264 Ga0068856_100467398
265 Ga0068856_100884741
266 Ga0068856_100983692
267 Ga0070702_100108417
268 Ga0068852_100064469
269 Ga0068859_100149443
270 Ga0068866_10180681
271 Ga0068861_100093569
272 Ga0068851_10186091
273 Ga0081455_10032672
274 Ga0070716_100420427
275 Ga0075434_100011904
276 Ga0075436_100353642
277 Ga0097620_100149457
278 Ga0075435_100006915
279 Ga0111539_10063063
280 Ga0105245_10151692
281 Ga0105245_10818809
282 Ga0105243_10009668
283 Ga0105243_10350012
284 Ga0105242_10234069
285 Ga0105239_10022953
286 Ga0105246_10008032
287 Ga0163162_10478554
288 Ga0157375_10210814
289 Ga0163163_10031392
290 Ga0163163_10360998
291 Ga0157380_10068858
292 Ga0182008_10309935
293 Ga0157379_10106952
294 Ga0157376_10014230
295 Ga0157376_10161997
296 Ga0157376_10843763
297 Ga0163161_10102934
298 Ga0207657_10097951
299 Ga0207687_10499842
300 Ga0207664_10621442
301 Ga0207690_10077537
302 Ga0207709_10018854
303 Ga0207669_10044993
304 Ga0207704_10357485
305 Ga0207691_10027454
306 Ga0207711_10206779
307 Ga0207661_10400958
308 Ga0207679_10848918
309 Ga0207640_10161517
310 Ga0207703_10613184
311 Ga0207702_10007683
312 Ga0207648_10033591
313 Ga0207675_100034911
314 Ga0207675_101078492
315 Ga0207683_10092976
316 Ga0207683_10662436
317 Ga0207683_11036895
318 Ga0207698_10186097
319 Ga0207428_10023154
320 Ga0268266_10136843
321 Ga0268266_10729642
322 Ga0265319_1041505
323 Ga0395900_0029656
324 Ga0395900_0135432
325 Ga0395898_0015888
326 Ga0395898_0019245
327 Ga0395901_0015821
328 Ga0395901_0363956
329 Ga0439439_0002945
330 Ga0451853_1465929
331 Ga0439431_0027031
332 Ga0439433_0014497
333 Ga0439449_0060630
334 Ga0439457_031754
335 Ga0450920_006104
336 Ga0439446_0000697
337 Ga0466969_0016892
338 Ga0466968_0074673
339 Ga0466957_0258425
340 Ga0495603_0122548
341 Ga0495605_0111064
342 Ga0495588_0110477
343 Ga0495670_0339299
344 Ga0496100_0192388
345 Ga0496101_0002594
346 Ga0496101_0053451
347 Ga0496101_0071838
348 Ga0496101_0122245
349 Ga0496102_0198680
350 Ga0496104_0013017
351 Ga0496104_0080196
352 Ga0496104_0904712
353 Ga0496105_0196424
354 Ga0496105_0525332
355 Ga0496105_0588043
356 Ga0496105_0655476
357 Ga0496106_0111173
358 Ga0496106_0188432
359 Ga0496106_1390186
360 Ga0496107_0070002
361 Ga0496108_0141467
362 Ga0496109_0258660
363 Ga0496110_0092797
364 Ga0496110_0100014
365 Ga0496110_0147719
366 Ga0496110_0239584
367 Ga0496111_0277342
368 Ga0496114_0097169
369 Ga0496114_0125418
370 Ga0496114_0213708
371 Ga0496114_0251528
372 Ga0496114_0542964
373 Ga0501031_0006829
374 Ga0501031_0011672
375 Ga0501031_0015857
376 Ga0501031_0065009
377 Ga0501032_0012079
378 Ga0501036_0025304
379 Ga0501036_0028152
380 Ga0501036_0281543
381 Ga0501036_0731522
382 Ga0501038_0098831
383 Ga0501038_0157323
384 Ga0501039_0018001
385 Ga0501039_0026684
386 Ga0501040_0027626
387 Ga0501040_0082746
388 Ga0501040_0125945
389 Ga0501041_0000621
390 Ga0501041_0059314
391 Ga0501041_0314519
392 Ga0501041_0461943
393 Ga0501042_0040983
394 Ga0501042_0050764
395 Ga0501042_0058352
396 Ga0501043_0115639
397 Ga0501043_0159153
398 Ga0501046_0022883
399 Ga0501046_0716719
400 Ga0501047_0107687
401 Ga0501047_0138708
402 Ga0501047_0216942
403 Ga0501048_0008138
404 Ga0501048_0020762
405 Ga0501067_0014933
406 Ga0501067_0359997
407 Ga0501068_0050690
408 Ga0501068_0076456
409 Ga0501068_0138747
410 Ga0501069_0019370
411 Ga0501070_0016483
412 Ga0501070_0027868
413 Ga0501071_0010447
414 Ga0501071_0018853
415 Ga0501071_0032505
416 Ga0501071_0218343
417 Ga0501071_0778905
418 Ga0501072_0015612
419 Ga0501072_0025056
420 Ga0501072_0242778
421 Ga0501072_0316055
422 Ga0501073_0081339
423 Ga0501074_0014554
424 Ga0501074_0022818
425 Ga0501074_0075362
426 Ga0501075_0018328
427 Ga0501075_0031833
428 Ga0501076_0008356
429 Ga0501076_0027759
430 Ga0501076_0030960
431 Ga0501076_0060942
432 Ga0501076_0072884
433 Ga0501077_0005736
434 Ga0501077_0056635
435 Ga0501077_0191435
436 Ga0501079_0008916
437 Ga0501079_0012257
438 Ga0501079_0470383
439 Ga0501080_0027644
440 Ga0501080_0044768
441 Ga0501080_0718167
442 Ga0501080_0768518
443 Ga0501081_0004211
444 Ga0501081_0004371
445 Ga0501081_0057965
446 Ga0501081_0072831
447 Ga0501081_0193191
448 Ga0501081_0447795
449 Ga0501083_0018665
450 Ga0501083_0297524
451 Ga0501035_0010671
452 Ga0501035_0043290
453 Ga0501044_0093310
454 Ga0501044_0145000
455 Ga0501044_0186802
456 Ga0501044_0440996
457 Ga0501045_0002656
458 Ga0501045_0020235
459 Ga0501045_0058243
460 Ga0501045_0334967
461 Ga0501045_0959387
462 nmdc:mga05p37_541311_c1
463 nmdc:mga0n895_29982_c1
464 nmdc:mga0rr50_170982_c1
465 nmdc:mga08x19_257425_c1
466 nmdc:mga0a205_195968_c1
467 Ga0501084_0014292
468 Ga0501084_0021551
469 Ga0501084_0031950
470 Ga0501084_0104291
471 Ga0501084_0350419
472 Ga0501082_0040507
473 Ga0501082_0099062
474 Ga0501082_0107410
475 Ga0501082_0202965
476 Ga0501082_0378531
477 Ga0530510_0011148
478 Ga0530510_0437858
479 2875397981
480 2919716471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02589

LUD_dom

LUD domain

40

205

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g40-assembly1.cif.gz_A-2 crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution 0.9044 34 207
2g40-assembly1.cif.gz_A-2 crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution 0.8991 34 207
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.5847 27 60
6p8t-assembly1.cif.gz_D acinetobacter baumannii trna synthetase in complex with compound 1 0.5298 25 58
4rfl-assembly1.cif.gz_B crystal structure of g1pdh with nadph from methanocaldococcus jannaschii 0.528 51 149
ID Description Score Start End Superfamily
2g40A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9044 34 207 3.40.50.10420
2g40A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8991 34 207 3.40.50.10420
af_P77433_40_228_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.7837 34 206 3.40.50.10420
af_P77433_40_228_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.7182 34 206 3.40.50.10420
af_Q0DQ10_1_144_3.40.50.10470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Translation initiation factor eif-2b; domain 2 0.6439 95 156 3.40.50.10470
ID Description Score Start End GO Terms
AF-A0A3D2MIH5-F1-model_v4 Lactate utilization protein C 0.9456 60 153
AF-A0A7K2PCR5-F1-model_v4 Lactate utilization protein C 0.9325 73 167
AF-A0A6G3X421-F1-model_v4 Lactate utilization protein C 0.9191 25 149
AF-A0A7W1MZN5-F1-model_v4 LUD domain-containing protein 0.9179 41 208
AF-A0A7V9FLJ7-F1-model_v4 LUD domain-containing protein 0.8919 57 206

Map