F352776

General Info

Members Datasets Scaffolds Average Seq Length
240 166 480 166

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10072467|Ga0099794_100724672
Length 196
Sequence MARVDPAVPGVLTDPELWDGLGAGPQKHEHLRNKGGSVTSVTISVNGTSQARQVEPRLLLVHFLRETLGLTGTHVGCDTSQCGACTVFLDGEAVKSCSLFAVQADGRSVTTIEGLAKDGKLHPMQEGFWEQHGLQCGFCTPGMIISACQILERNPSPSEAEIRQGLEGNLCRCTGYANIVKAVQHAARNMADRGAR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 7.08
Rhizosphere 89.17
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10072467 3300007265 Bacteria 1689
2 Ga0058863_11735950 3300004799 Bacteria 1142
3 Ga0058862_12804550 3300004803 Bacteria 2505
4 Ga0070676_10038816 3300005328 Bacteria 2751
5 Ga0070683_101208275 3300005329 Bacteria 726
6 Ga0070677_10023627 3300005333 Bacteria 2277
7 Ga0068869_100111257 3300005334 Bacteria 2084
8 Ga0070666_10618442 3300005335 Bacteria 791
9 Ga0070682_100322729 3300005337 Bacteria 1141
10 Ga0068868_101167753 3300005338 Bacteria 711
11 Ga0070669_100233240 3300005353 Bacteria 1459
12 Ga0070675_100121302 3300005354 Bacteria 2221
13 Ga0070675_100715218 3300005354 Bacteria 913
14 Ga0070674_100018832 3300005356 Bacteria 4374
15 Ga0070667_100034382 3300005367 Bacteria 4240
16 Ga0070709_10009345 3300005434 Bacteria 5405
17 Ga0070714_100033347 3300005435 Bacteria 4304
18 Ga0070713_100095847 3300005436 Bacteria 2560
19 Ga0070710_10273719 3300005437 Bacteria 1093
20 Ga0070711_100176023 3300005439 Bacteria 1634
21 Ga0070711_100211917 3300005439 Bacteria 1501
22 Ga0070694_100316744 3300005444 Bacteria 1199
23 Ga0070708_100084456 3300005445 Bacteria 2880
24 Ga0070708_100453876 3300005445 Bacteria 1209
25 Ga0070708_101793193 3300005445 Bacteria 570
26 Ga0070678_100008327 3300005456 Bacteria 6209
27 Ga0070662_100241980 3300005457 Bacteria 1447
28 Ga0068867_101605894 3300005459 Bacteria 608
29 Ga0070685_10669543 3300005466 Bacteria 754
30 Ga0070706_100032309 3300005467 Bacteria 4827
31 Ga0070706_100243068 3300005467 Bacteria 1681
32 Ga0070706_100418026 3300005467 Bacteria 1248
33 Ga0070707_100006964 3300005468 Bacteria 10480
34 Ga0070684_101371897 3300005535 Bacteria 665
35 Ga0070697_100992843 3300005536 Bacteria 746
36 Ga0068853_100748930 3300005539 Bacteria 934
37 Ga0070665_100047670 3300005548 Bacteria 4300
38 Ga0070704_101332270 3300005549 Bacteria 657
39 Ga0068857_100200760 3300005577 Bacteria 1818
40 Ga0068857_100709853 3300005577 Bacteria 956
41 Ga0068854_100436432 3300005578 Bacteria 1091
42 Ga0068864_100895841 3300005618 Bacteria 876
43 Ga0068861_100102393 3300005719 Bacteria 2280
44 Ga0068870_10157472 3300005840 Bacteria 1344
45 Ga0068870_10624906 3300005840 Bacteria 735
46 Ga0068863_100547803 3300005841 Bacteria 1142
47 Ga0068860_100037410 3300005843 Bacteria 4646
48 Ga0068862_100121322 3300005844 Bacteria 2304
49 Ga0081455_10041505 3300005937 Bacteria 4045
50 Ga0081538_10003451 3300005981 Bacteria 14930
51 Ga0081540_1073689 3300005983 Bacteria 1568
52 Ga0070717_10040968 3300006028 Bacteria 3776
53 Ga0070712_100012882 3300006175 Bacteria 5327
54 Ga0075367_10043307 3300006178 Bacteria 2636
55 Ga0075367_10384934 3300006178 Bacteria 886
56 Ga0075370_10324747 3300006353 Bacteria 917
57 Ga0075431_100002369 3300006847 Bacteria 18105
58 Ga0075431_100006142 3300006847 Bacteria 11917
59 Ga0075431_101075511 3300006847 Bacteria 769
60 Ga0075433_10989132 3300006852 Bacteria 733
61 Ga0075429_100025652 3300006880 Bacteria 5117
62 Ga0075429_100164678 3300006880 Bacteria 1942
63 Ga0068865_100018775 3300006881 Bacteria 4468
64 Ga0111539_10051188 3300009094 Bacteria 4920
65 Ga0111539_10315342 3300009094 Bacteria 1820
66 Ga0111539_11411739 3300009094 Bacteria 808
67 Ga0114129_10003273 3300009147 Bacteria 22735
68 Ga0114129_10014076 3300009147 Bacteria 11395
69 Ga0114129_10212621 3300009147 Bacteria 2614
70 Ga0114129_10237216 3300009147 Bacteria 2453
71 Ga0114129_10802748 3300009147 Bacteria 1200
72 Ga0114129_10892066 3300009147 Bacteria 1127
73 Ga0105243_10081969 3300009148 Bacteria 2635
74 Ga0163162_10209819 3300013306 Bacteria 2077
75 Ga0163163_10045460 3300014325 Bacteria 4309
76 Ga0182008_10668169 3300014497 Bacteria 590
77 Ga0157377_10857947 3300014745 Bacteria 675
78 Ga0207692_10220674 3300025898 Bacteria 1124
79 Ga0207699_10062896 3300025906 Bacteria 2239
80 Ga0207699_10393943 3300025906 Bacteria 985
81 Ga0207684_10031519 3300025910 Bacteria 4509
82 Ga0207684_10101715 3300025910 Bacteria 2457
83 Ga0207693_10019947 3300025915 Bacteria 5332
84 Ga0207663_10191607 3300025916 Bacteria 1468
85 Ga0207660_10416341 3300025917 Bacteria 1083
86 Ga0207662_10628883 3300025918 Bacteria 749
87 Ga0207652_10236119 3300025921 Bacteria 1648
88 Ga0207646_10073033 3300025922 Bacteria 3064
89 Ga0207700_10122402 3300025928 Bacteria 2111
90 Ga0207706_10034651 3300025933 Bacteria 4491
91 Ga0207661_10571576 3300025944 Bacteria 1036
92 Ga0207679_11331587 3300025945 Bacteria 659
93 Ga0207667_11310436 3300025949 Bacteria 700
94 Ga0207640_10946654 3300025981 Bacteria 755
95 Ga0207678_10727024 3300026067 Bacteria 874
96 Ga0207702_10966533 3300026078 Bacteria 845
97 Ga0207676_10602110 3300026095 Bacteria 1056
98 Ga0207674_11383377 3300026116 Bacteria 673
99 Ga0207683_10133340 3300026121 Bacteria 2235
100 Ga0207698_11666223 3300026142 Bacteria 653
101 Ga0209588_1022788 3300027671 Bacteria 1971
102 Ga0209813_10048188 3300027866 Bacteria 1322
103 Ga0207428_10076573 3300027907 Bacteria 2620
104 Ga0265338_10230642 3300028800 Bacteria 1377
105 Ga0307405_10680430 3300031731 Bacteria 850
106 Ga0307405_10933288 3300031731 Bacteria 736
107 Ga0307409_100355892 3300031995 Bacteria 1383
108 Ga0307416_100259315 3300032002 Bacteria 1698
109 Ga0307416_102680731 3300032002 Bacteria 595
110 Ga0307415_100327798 3300032126 Bacteria 1280
111 Ga0307415_100359068 3300032126 Bacteria 1230
112 Ga0307415_100536251 3300032126 Bacteria 1030
113 Ga0373926_0044436 3300035083 Bacteria 1591
114 Ga0373945_0009464 3300035116 Bacteria 3192
115 Ga0373943_0016449 3300035170 Bacteria 3373
116 Ga0373946_0022917 3300035171 Bacteria 2435
117 Ga0373927_0019644 3300035695 Bacteria 4430
118 Ga0373947_0008246 3300035725 Bacteria 6005
119 Ga0373937_0296470 3300036401 Bacteria 1528
120 Ga0373925_0419985 3300037068 Bacteria 1092
121 Ga0395899_0030805 3300037312 Bacteria 4034
122 Ga0395899_0079052 3300037312 Bacteria 2396
123 Ga0395900_0043116 3300037418 Bacteria 4649
124 Ga0395900_0124697 3300037418 Bacteria 2641
125 Ga0395898_0018490 3300037466 Bacteria 7103
126 Ga0395898_0225574 3300037466 Bacteria 1787
127 Ga0395905_0002734 3300037471 Bacteria 19305
128 Ga0395905_0019158 3300037471 Bacteria 6489
129 Ga0395901_0003733 3300038443 Bacteria 15341
130 Ga0395901_0032841 3300038443 Bacteria 5354
131 Ga0395901_0537838 3300038443 Bacteria 1185
132 Ga0436365_1839598 3300039437 Bacteria 1905
133 Ga0436362_0500580 3300039453 Bacteria 988
134 Ga0439454_031046 3300042011 Bacteria 838
135 Ga0466963_0125727 3300044694 Bacteria 1768
136 Ga0466963_0194193 3300044694 Bacteria 1418
137 Ga0466963_0442932 3300044694 Bacteria 916
138 Ga0466968_0296190 3300044735 Bacteria 777
139 Ga0466960_0018692 3300044901 Bacteria 3042
140 Ga0466959_0056218 3300045049 Bacteria 2872
141 Ga0466959_0159768 3300045049 Bacteria 1585
142 Ga0466967_0140620 3300045976 Bacteria 2248
143 Ga0466967_0202431 3300045976 Bacteria 1881
144 Ga0466967_0396612 3300045976 Bacteria 1342
145 Ga0466967_1406806 3300045976 Bacteria 695
146 Ga0495603_0006657 3300046455 Bacteria 6932
147 Ga0495582_0069329 3300046473 Bacteria 1949
148 Ga0495639_0006642 3300046475 Bacteria 4975
149 Ga0495665_0029800 3300046531 Bacteria 2922
150 Ga0495588_0009987 3300046674 Bacteria 4401
151 Ga0495658_0003009 3300046683 Bacteria 8438
152 Ga0495581_0031507 3300047315 Bacteria 3072
153 Ga0495672_0019002 3300047320 Bacteria 4545
154 Ga0495593_0013656 3300047673 Bacteria 4628
155 Ga0495615_0064344 3300048090 Bacteria 975
156 Ga0496100_0102106 3300048903 Bacteria 1978
157 Ga0496101_0005868 3300048904 Bacteria 7862
158 Ga0496102_1477124 3300048905 Bacteria 598
159 Ga0496103_0311878 3300048906 Bacteria 1012
160 Ga0496104_0002272 3300048907 Bacteria 16566
161 Ga0496104_0339054 3300048907 Bacteria 1416
162 Ga0496105_0098463 3300048908 Bacteria 2415
163 Ga0496108_0094507 3300048911 Bacteria 2545
164 Ga0496109_0120225 3300048912 Bacteria 2447
165 Ga0496109_0205669 3300048912 Bacteria 1851
166 Ga0496110_0212625 3300048913 Bacteria 1758
167 Ga0496110_0403045 3300048913 Bacteria 1247
168 Ga0496111_0167051 3300048914 Bacteria 1634
169 Ga0496112_0115096 3300048915 Bacteria 2660
170 Ga0496113_0429014 3300048916 Bacteria 1062
171 Ga0496113_0719688 3300048916 Bacteria 796
172 Ga0496114_0001918 3300048917 Bacteria 15830
173 Ga0501031_0176837 3300049568 Bacteria 1394
174 Ga0501032_0472486 3300049569 Bacteria 802
175 Ga0501036_0217767 3300049572 Bacteria 1603
176 Ga0501038_0570511 3300049574 Bacteria 859
177 Ga0501039_0101106 3300049575 Bacteria 2250
178 Ga0501039_0352100 3300049575 Bacteria 1157
179 Ga0501039_0625455 3300049575 Bacteria 843
180 Ga0501040_0316040 3300049576 Bacteria 1117
181 Ga0501041_0020406 3300049577 Bacteria 3962
182 Ga0501041_0062336 3300049577 Bacteria 2282
183 Ga0501042_0171068 3300049578 Unclassified 1567
184 Ga0501046_0064996 3300049580 Bacteria 2847
185 Ga0501046_0632430 3300049580 Bacteria 757
186 Ga0501048_0035718 3300049582 Bacteria 3576
187 Ga0501048_0097549 3300049582 Bacteria 2073
188 Ga0501048_0392464 3300049582 Bacteria 992
189 Ga0501071_0224438 3300049587 Bacteria 1414
190 Ga0501071_0757505 3300049587 Bacteria 748
191 Ga0501072_0105172 3300049588 Bacteria 2244
192 Ga0501072_0159866 3300049588 Bacteria 1797
193 Ga0501072_0189117 3300049588 Bacteria 1642
194 Ga0501074_1131392 3300049590 Bacteria 550
195 Ga0501075_0063229 3300049591 Bacteria 2790
196 Ga0501075_1301920 3300049591 Bacteria 551
197 Ga0501076_0004043 3300049592 Bacteria 10365
198 Ga0501077_0041157 3300049593 Bacteria 2942
199 Ga0501079_0083318 3300049741 Bacteria 2474
200 Ga0501079_0300472 3300049741 Bacteria 1256
201 Ga0501079_0402527 3300049741 Bacteria 1073
202 Ga0501081_0413417 3300049743 Bacteria 999
203 Ga0501083_0116327 3300049744 Bacteria 1755
204 Ga0501083_0462487 3300049744 Bacteria 826
205 Ga0501045_0026862 3300049824 Bacteria 4143
206 Ga0501045_0057832 3300049824 Bacteria 2838
207 nmdc:mga0k408_210706_c1 3300050493 Bacteria 1160
208 nmdc:mga0k408_37267_c2 3300050493 Bacteria 2166
209 nmdc:mga06z11_43991_c1 3300050494 Bacteria 2250
210 nmdc:mga05p37_142476_c1 3300050507 Unclassified 2936
211 nmdc:mga05p37_15703_c1 3300050507 Bacteria 9102
212 nmdc:mga05p37_17465_c2 3300050507 Bacteria 7033
213 nmdc:mga05p37_188459_c1 3300050507 Bacteria 2506
214 nmdc:mga05p37_269711_c1 3300050507 Bacteria 2034
215 nmdc:mga05p37_66834_c1 3300050507 Bacteria 4422
216 nmdc:mga05p37_952955_c1 3300050507 Bacteria 918
217 nmdc:mga09592_16622_c1 3300050508 Bacteria 6021
218 nmdc:mga09592_255531_c1 3300050508 Bacteria 1519
219 nmdc:mga06r32_108107_c1 3300050510 Bacteria 2734
220 nmdc:mga06r32_29782_c1 3300050510 Bacteria 5120
221 nmdc:mga06r32_475663_c1 3300050510 Bacteria 1228
222 nmdc:mga08y16_1043636_c1 3300050511 Bacteria 795
223 nmdc:mga08y16_5385_c1 3300050511 Bacteria 13383
224 nmdc:mga0n895_1480493_c1 3300050512 Bacteria 646
225 nmdc:mga0n895_313368_c1 3300050512 Bacteria 1590
226 nmdc:mga0n895_4124_c1 3300050512 Bacteria 11844
227 nmdc:mga0n895_48374_c1 3300050512 Bacteria 4162
228 nmdc:mga0rr50_215584_c1 3300050513 Bacteria 1583
229 nmdc:mga0a205_39018_c2 3300050515 Bacteria 2205
230 Ga0500568_0051977 3300053139 Bacteria 1610
231 Ga0501084_0236047 3300054114 Bacteria 1543
232 Ga0501084_0249503 3300054114 Bacteria 1498
233 Ga0501084_0431140 3300054114 Bacteria 1114
234 Ga0587106_064306 3300059605 Bacteria 681
235 Ga0587111_0156477 3300060346 Bacteria 616
236 Ga0501082_0032026 3300060353 Bacteria 4535
237 Ga0501082_0329397 3300060353 Bacteria 1330
238 Ga0530510_0079197 3300061734 Unclassified 2390
239 Ga0530510_0118987 3300061734 Bacteria 1938
240 Ga0530510_0544104 3300061734 Bacteria 881
241 Ga0099794_10072467
242 Ga0058863_11735950
243 Ga0058862_12804550
244 Ga0070676_10038816
245 Ga0070683_101208275
246 Ga0070677_10023627
247 Ga0068869_100111257
248 Ga0070666_10618442
249 Ga0070682_100322729
250 Ga0068868_101167753
251 Ga0070669_100233240
252 Ga0070675_100121302
253 Ga0070675_100715218
254 Ga0070674_100018832
255 Ga0070667_100034382
256 Ga0070709_10009345
257 Ga0070714_100033347
258 Ga0070713_100095847
259 Ga0070710_10273719
260 Ga0070711_100176023
261 Ga0070711_100211917
262 Ga0070694_100316744
263 Ga0070708_100084456
264 Ga0070708_100453876
265 Ga0070708_101793193
266 Ga0070678_100008327
267 Ga0070662_100241980
268 Ga0068867_101605894
269 Ga0070685_10669543
270 Ga0070706_100032309
271 Ga0070706_100243068
272 Ga0070706_100418026
273 Ga0070707_100006964
274 Ga0070684_101371897
275 Ga0070697_100992843
276 Ga0068853_100748930
277 Ga0070665_100047670
278 Ga0070704_101332270
279 Ga0068857_100200760
280 Ga0068857_100709853
281 Ga0068854_100436432
282 Ga0068864_100895841
283 Ga0068861_100102393
284 Ga0068870_10157472
285 Ga0068870_10624906
286 Ga0068863_100547803
287 Ga0068860_100037410
288 Ga0068862_100121322
289 Ga0081455_10041505
290 Ga0081538_10003451
291 Ga0081540_1073689
292 Ga0070717_10040968
293 Ga0070712_100012882
294 Ga0075367_10043307
295 Ga0075367_10384934
296 Ga0075370_10324747
297 Ga0075431_100002369
298 Ga0075431_100006142
299 Ga0075431_101075511
300 Ga0075433_10989132
301 Ga0075429_100025652
302 Ga0075429_100164678
303 Ga0068865_100018775
304 Ga0111539_10051188
305 Ga0111539_10315342
306 Ga0111539_11411739
307 Ga0114129_10003273
308 Ga0114129_10014076
309 Ga0114129_10212621
310 Ga0114129_10237216
311 Ga0114129_10802748
312 Ga0114129_10892066
313 Ga0105243_10081969
314 Ga0163162_10209819
315 Ga0163163_10045460
316 Ga0182008_10668169
317 Ga0157377_10857947
318 Ga0207692_10220674
319 Ga0207699_10062896
320 Ga0207699_10393943
321 Ga0207684_10031519
322 Ga0207684_10101715
323 Ga0207693_10019947
324 Ga0207663_10191607
325 Ga0207660_10416341
326 Ga0207662_10628883
327 Ga0207652_10236119
328 Ga0207646_10073033
329 Ga0207700_10122402
330 Ga0207706_10034651
331 Ga0207661_10571576
332 Ga0207679_11331587
333 Ga0207667_11310436
334 Ga0207640_10946654
335 Ga0207678_10727024
336 Ga0207702_10966533
337 Ga0207676_10602110
338 Ga0207674_11383377
339 Ga0207683_10133340
340 Ga0207698_11666223
341 Ga0209588_1022788
342 Ga0209813_10048188
343 Ga0207428_10076573
344 Ga0265338_10230642
345 Ga0307405_10680430
346 Ga0307405_10933288
347 Ga0307409_100355892
348 Ga0307416_100259315
349 Ga0307416_102680731
350 Ga0307415_100327798
351 Ga0307415_100359068
352 Ga0307415_100536251
353 Ga0373926_0044436
354 Ga0373945_0009464
355 Ga0373943_0016449
356 Ga0373946_0022917
357 Ga0373927_0019644
358 Ga0373947_0008246
359 Ga0373937_0296470
360 Ga0373925_0419985
361 Ga0395899_0030805
362 Ga0395899_0079052
363 Ga0395900_0043116
364 Ga0395900_0124697
365 Ga0395898_0018490
366 Ga0395898_0225574
367 Ga0395905_0002734
368 Ga0395905_0019158
369 Ga0395901_0003733
370 Ga0395901_0032841
371 Ga0395901_0537838
372 Ga0436365_1839598
373 Ga0436362_0500580
374 Ga0439454_031046
375 Ga0466963_0125727
376 Ga0466963_0194193
377 Ga0466963_0442932
378 Ga0466968_0296190
379 Ga0466960_0018692
380 Ga0466959_0056218
381 Ga0466959_0159768
382 Ga0466967_0140620
383 Ga0466967_0202431
384 Ga0466967_0396612
385 Ga0466967_1406806
386 Ga0495603_0006657
387 Ga0495582_0069329
388 Ga0495639_0006642
389 Ga0495665_0029800
390 Ga0495588_0009987
391 Ga0495658_0003009
392 Ga0495581_0031507
393 Ga0495672_0019002
394 Ga0495593_0013656
395 Ga0495615_0064344
396 Ga0496100_0102106
397 Ga0496101_0005868
398 Ga0496102_1477124
399 Ga0496103_0311878
400 Ga0496104_0002272
401 Ga0496104_0339054
402 Ga0496105_0098463
403 Ga0496108_0094507
404 Ga0496109_0120225
405 Ga0496109_0205669
406 Ga0496110_0212625
407 Ga0496110_0403045
408 Ga0496111_0167051
409 Ga0496112_0115096
410 Ga0496113_0429014
411 Ga0496113_0719688
412 Ga0496114_0001918
413 Ga0501031_0176837
414 Ga0501032_0472486
415 Ga0501036_0217767
416 Ga0501038_0570511
417 Ga0501039_0101106
418 Ga0501039_0352100
419 Ga0501039_0625455
420 Ga0501040_0316040
421 Ga0501041_0020406
422 Ga0501041_0062336
423 Ga0501042_0171068
424 Ga0501046_0064996
425 Ga0501046_0632430
426 Ga0501048_0035718
427 Ga0501048_0097549
428 Ga0501048_0392464
429 Ga0501071_0224438
430 Ga0501071_0757505
431 Ga0501072_0105172
432 Ga0501072_0159866
433 Ga0501072_0189117
434 Ga0501074_1131392
435 Ga0501075_0063229
436 Ga0501075_1301920
437 Ga0501076_0004043
438 Ga0501077_0041157
439 Ga0501079_0083318
440 Ga0501079_0300472
441 Ga0501079_0402527
442 Ga0501081_0413417
443 Ga0501083_0116327
444 Ga0501083_0462487
445 Ga0501045_0026862
446 Ga0501045_0057832
447 nmdc:mga0k408_210706_c1
448 nmdc:mga0k408_37267_c2
449 nmdc:mga06z11_43991_c1
450 nmdc:mga05p37_142476_c1
451 nmdc:mga05p37_15703_c1
452 nmdc:mga05p37_17465_c2
453 nmdc:mga05p37_188459_c1
454 nmdc:mga05p37_269711_c1
455 nmdc:mga05p37_66834_c1
456 nmdc:mga05p37_952955_c1
457 nmdc:mga09592_16622_c1
458 nmdc:mga09592_255531_c1
459 nmdc:mga06r32_108107_c1
460 nmdc:mga06r32_29782_c1
461 nmdc:mga06r32_475663_c1
462 nmdc:mga08y16_1043636_c1
463 nmdc:mga08y16_5385_c1
464 nmdc:mga0n895_1480493_c1
465 nmdc:mga0n895_313368_c1
466 nmdc:mga0n895_4124_c1
467 nmdc:mga0n895_48374_c1
468 nmdc:mga0rr50_215584_c1
469 nmdc:mga0a205_39018_c2
470 Ga0500568_0051977
471 Ga0501084_0236047
472 Ga0501084_0249503
473 Ga0501084_0431140
474 Ga0587106_064306
475 Ga0587111_0156477
476 Ga0501082_0032026
477 Ga0501082_0329397
478 Ga0530510_0079197
479 Ga0530510_0118987
480 Ga0530510_0544104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

111

184

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

43

112

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9642 2 152
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9634 2 152
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9561 2 152
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9543 1 152
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9484 1 152
ID Description Score Start End Superfamily
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9604 2 77 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9555 1 77 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9526 1 77 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9479 1 75 3.10.20.30
3hrdH01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9411 2 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A543L6H0-F1-model_v4 deleted 0.9695 3 152
AF-A0A516X3C8-F1-model_v4 (2Fe-2S)-binding protein 0.9693 3 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A3E0KM30-F1-model_v4 Carbon monoxide dehydrogenase 0.9691 2 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A1X7JBU1-F1-model_v4 deleted 0.9691 3 152
AF-A0A6N8WVW0-F1-model_v4 (2Fe-2S)-binding protein 0.9691 3 152 GO:0016491
GO:0046872
GO:0051537

Map