F352669

General Info

Members Datasets Scaffolds Average Seq Length
240 102 480 306

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100070031|Ga0070697_1000700314
Length 321
Sequence VRVVFFGTPEFAVPSLRALVGEGFDVVAVVTQPDAAQGRSRSKLIPPPVKVAAEAEDLTIFQPEKPTDGAFLLRLRDLKPDIGVVVAYGHILKPELLELPRRGMVNVHPSLLPELRGAAPVEWAIIRGHEMTGVTIIQLDAGMDSGPILHQIPHGIPPDVSAGDLSAHLAEMGAQALVETLTMLEQSDPPPQPVPQNEDRATYAPKLTREIARIDWTKDARAIACLIRGLDPRPGAWTELNGVEIKLFNPKVIEPLPPFKGTRAPGEVLSADGSLAIATGPLKDTAGGAVEVVEVQPAGKARMTTDDWLHGARITAGARFA

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
88 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
89 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.92
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100070031 3300005536 Bacteria 2874
2 Ga0070658_10013911 3300005327 Bacteria 6460
3 Ga0070658_10400881 3300005327 Unclassified 1178
4 Ga0070680_100002791 3300005336 Bacteria 12972
5 Ga0070680_100029163 3300005336 Bacteria 4432
6 Ga0070692_10187026 3300005345 Bacteria 1204
7 Ga0070703_10000571 3300005406 Bacteria 13353
8 Ga0070703_10001212 3300005406 Bacteria 7881
9 Ga0070703_10011867 3300005406 Bacteria 2465
10 Ga0070709_10003597 3300005434 Bacteria 8325
11 Ga0070714_100065157 3300005435 Bacteria 3138
12 Ga0070713_100244759 3300005436 Bacteria 1634
13 Ga0070701_10032528 3300005438 Bacteria 2598
14 Ga0070711_100005527 3300005439 Bacteria 7567
15 Ga0070711_100053780 3300005439 Bacteria 2776
16 Ga0070705_100001730 3300005440 Bacteria 11358
17 Ga0070705_100003349 3300005440 Bacteria 7867
18 Ga0070705_100005768 3300005440 Bacteria 6051
19 Ga0070705_100006987 3300005440 Bacteria 5551
20 Ga0070705_100079986 3300005440 Bacteria 2003
21 Ga0070705_100172498 3300005440 Bacteria 1457
22 Ga0070694_100000915 3300005444 Bacteria 16713
23 Ga0070694_100001180 3300005444 Bacteria 15009
24 Ga0070694_100005404 3300005444 Bacteria 7731
25 Ga0070694_100006874 3300005444 Bacteria 6914
26 Ga0070694_100016924 3300005444 Bacteria 4598
27 Ga0070694_100084503 3300005444 Bacteria 2215
28 Ga0070694_100200736 3300005444 Bacteria 1486
29 Ga0070708_100089885 3300005445 Bacteria 2795
30 Ga0070708_100112510 3300005445 Bacteria 2504
31 Ga0070708_100117043 3300005445 Bacteria 2454
32 Ga0070708_100170149 3300005445 Bacteria 2034
33 Ga0070708_100358215 3300005445 Bacteria 1375
34 Ga0070708_100369996 3300005445 Bacteria 1351
35 Ga0070662_100000305 3300005457 Bacteria 29160
36 Ga0070685_10041691 3300005466 Bacteria 2617
37 Ga0070706_100004140 3300005467 Bacteria 14103
38 Ga0070706_100036404 3300005467 Bacteria 4545
39 Ga0070706_100111453 3300005467 Bacteria 2546
40 Ga0070707_100012242 3300005468 Bacteria 8010
41 Ga0070707_100013120 3300005468 Bacteria 7746
42 Ga0070707_100014209 3300005468 Bacteria 7462
43 Ga0070707_100099086 3300005468 Bacteria 2823
44 Ga0070707_100134680 3300005468 Bacteria 2403
45 Ga0070698_100025876 3300005471 Bacteria 6114
46 Ga0070698_100034539 3300005471 Bacteria 5233
47 Ga0070698_100083745 3300005471 Bacteria 3178
48 Ga0070698_100168903 3300005471 Bacteria 2129
49 Ga0070698_100358026 3300005471 Bacteria 1391
50 Ga0070698_100369631 3300005471 Bacteria 1366
51 Ga0070699_100029071 3300005518 Bacteria 4765
52 Ga0070699_100039747 3300005518 Bacteria 4073
53 Ga0070699_100047945 3300005518 Bacteria 3696
54 Ga0070699_100102440 3300005518 Bacteria 2510
55 Ga0070699_100156717 3300005518 Bacteria 2015
56 Ga0070697_100003196 3300005536 Bacteria 12582
57 Ga0070697_100014116 3300005536 Bacteria 6274
58 Ga0070697_100022768 3300005536 Bacteria 4979
59 Ga0070697_100023431 3300005536 Bacteria 4908
60 Ga0070697_100080607 3300005536 Bacteria 2682
61 Ga0070697_100150068 3300005536 Bacteria 1964
62 Ga0070672_100011749 3300005543 Bacteria 6118
63 Ga0070686_100000066 3300005544 Bacteria 79941
64 Ga0070686_100042916 3300005544 Bacteria 2835
65 Ga0070695_100022816 3300005545 Bacteria 3841
66 Ga0070695_100029418 3300005545 Bacteria 3413
67 Ga0070695_100035588 3300005545 Bacteria 3128
68 Ga0070695_100044588 3300005545 Bacteria 2824
69 Ga0070695_100109273 3300005545 Unclassified 1874
70 Ga0070695_100251747 3300005545 Bacteria 1286
71 Ga0070696_100001401 3300005546 Bacteria 15762
72 Ga0070696_100004847 3300005546 Bacteria 8998
73 Ga0070696_100026959 3300005546 Bacteria 3912
74 Ga0070696_100051483 3300005546 Unclassified 2864
75 Ga0070696_100056467 3300005546 Bacteria 2738
76 Ga0070696_100107873 3300005546 Bacteria 2003
77 Ga0070704_100000644 3300005549 Bacteria 16867
78 Ga0070704_100005733 3300005549 Bacteria 7260
79 Ga0070704_100037806 3300005549 Bacteria 3301
80 Ga0070704_100064045 3300005549 Bacteria 2640
81 Ga0070704_100085945 3300005549 Bacteria 2329
82 Ga0068855_100018146 3300005563 Bacteria 8454
83 Ga0068855_100220996 3300005563 Bacteria 2124
84 Ga0068856_100090719 3300005614 Unclassified 3040
85 Ga0068856_100337118 3300005614 Bacteria 1526
86 Ga0068852_100001588 3300005616 Bacteria 15454
87 Ga0068859_100046029 3300005617 Bacteria 4383
88 Ga0068859_100340092 3300005617 Bacteria 1595
89 Ga0068864_100251474 3300005618 Bacteria 1641
90 Ga0068861_100204082 3300005719 Bacteria 1661
91 Ga0070716_100033470 3300006173 Bacteria 2811
92 Ga0070716_100039330 3300006173 Bacteria 2625
93 Ga0075428_100005684 3300006844 Bacteria 13863
94 Ga0075430_100119898 3300006846 Bacteria 2193
95 Ga0075430_100190830 3300006846 Bacteria 1703
96 Ga0075431_100047048 3300006847 Bacteria 4448
97 Ga0075431_100089897 3300006847 Bacteria 3169
98 Ga0075431_100103150 3300006847 Bacteria 2944
99 Ga0075433_10007800 3300006852 Bacteria 8510
100 Ga0075433_10027108 3300006852 Bacteria 4857
101 Ga0075433_10031497 3300006852 Bacteria 4534
102 Ga0075433_10072648 3300006852 Bacteria 3025
103 Ga0075433_10167394 3300006852 Bacteria 1956
104 Ga0075433_10232404 3300006852 Bacteria 1637
105 Ga0075434_100006849 3300006871 Bacteria 10492
106 Ga0075434_100008859 3300006871 Bacteria 9367
107 Ga0075434_100081647 3300006871 Bacteria 3230
108 Ga0075434_100139650 3300006871 Unclassified 2442
109 Ga0075434_100163869 3300006871 Bacteria 2243
110 Ga0075434_100164235 3300006871 Bacteria 2240
111 Ga0075434_100258703 3300006871 Bacteria 1759
112 Ga0075434_100266991 3300006871 Bacteria 1730
113 Ga0075434_100400429 3300006871 Bacteria 1394
114 Ga0075429_100002921 3300006880 Bacteria 14496
115 Ga0075429_100036718 3300006880 Bacteria 4263
116 Ga0075429_100144835 3300006880 Bacteria 2079
117 Ga0075436_100024879 3300006914 Bacteria 4117
118 Ga0075436_100082274 3300006914 Bacteria 2233
119 Ga0075436_100088241 3300006914 Bacteria 2154
120 Ga0075436_100091090 3300006914 Bacteria 2120
121 Ga0097620_100046029 3300006931 Bacteria 4383
122 Ga0097620_100340115 3300006931 Bacteria 1595
123 Ga0075435_100007775 3300007076 Bacteria 7662
124 Ga0075435_100012718 3300007076 Bacteria 6235
125 Ga0075435_100078570 3300007076 Bacteria 2706
126 Ga0075435_100244607 3300007076 Bacteria 1526
127 Ga0075435_100358344 3300007076 Bacteria 1251
128 Ga0099794_10000020 3300007265 Bacteria 72580
129 Ga0099794_10105509 3300007265 Bacteria 1409
130 Ga0105240_10000395 3300009093 Bacteria 81541
131 Ga0105240_10203660 3300009093 Bacteria 2317
132 Ga0111539_10174151 3300009094 Bacteria 2514
133 Ga0114129_10481670 3300009147 Bacteria 1623
134 Ga0105248_10199857 3300009177 Bacteria 2252
135 Ga0157370_10002893 3300013104 Bacteria 20474
136 Ga0157378_10059068 3300013297 Bacteria 3421
137 Ga0157372_10118521 3300013307 Bacteria 3038
138 Ga0157375_10963292 3300013308 Bacteria 994
139 Ga0163163_10066852 3300014325 Bacteria 3572
140 Ga0163163_10105325 3300014325 Bacteria 2846
141 Ga0157376_10484914 3300014969 Bacteria 1212
142 Ga0207653_10000048 3300025885 Bacteria 90730
143 Ga0207653_10005078 3300025885 Bacteria 4111
144 Ga0207653_10015037 3300025885 Bacteria 2429
145 Ga0207699_10005124 3300025906 Bacteria 6276
146 Ga0207699_10015565 3300025906 Bacteria 3954
147 Ga0207705_10182155 3300025909 Bacteria 1586
148 Ga0207684_10015566 3300025910 Bacteria 6543
149 Ga0207684_10058202 3300025910 Bacteria 3279
150 Ga0207684_10078744 3300025910 Bacteria 2803
151 Ga0207684_10128608 3300025910 Bacteria 2174
152 Ga0207684_10144682 3300025910 Bacteria 2044
153 Ga0207684_10205969 3300025910 Bacteria 1697
154 Ga0207684_10305200 3300025910 Bacteria 1372
155 Ga0207671_10026473 3300025914 Bacteria 4345
156 Ga0207663_10000053 3300025916 Bacteria 62261
157 Ga0207663_10093233 3300025916 Bacteria 2004
158 Ga0207660_10003140 3300025917 Bacteria 10806
159 Ga0207660_10020959 3300025917 Bacteria 4391
160 Ga0207660_10207629 3300025917 Bacteria 1532
161 Ga0207662_10044574 3300025918 Bacteria 2619
162 Ga0207646_10001595 3300025922 Bacteria 27689
163 Ga0207646_10003084 3300025922 Bacteria 19160
164 Ga0207646_10038035 3300025922 Bacteria 4336
165 Ga0207646_10039653 3300025922 Bacteria 4238
166 Ga0207646_10079982 3300025922 Bacteria 2922
167 Ga0207646_10229003 3300025922 Bacteria 1679
168 Ga0207700_10194711 3300025928 Bacteria 1705
169 Ga0207665_10003920 3300025939 Bacteria 9962
170 Ga0207665_10048069 3300025939 Bacteria 2862
171 Ga0207691_10019262 3300025940 Bacteria 6460
172 Ga0207711_10242543 3300025941 Bacteria 1653
173 Ga0207667_10053693 3300025949 Bacteria 4239
174 Ga0207708_10051635 3300026075 Bacteria 3131
175 Ga0207702_10238778 3300026078 Bacteria 1702
176 Ga0207698_10006244 3300026142 Bacteria 7419
177 Ga0209588_1004736 3300027671 Bacteria 3859
178 Ga0209588_1005543 3300027671 Bacteria 3623
179 Ga0265331_10121728 3300031250 Bacteria 1193
180 Ga0265316_10009598 3300031344 Bacteria 8891
181 Ga0265314_10008980 3300031711 Bacteria 8506
182 Ga0265342_10029364 3300031712 Bacteria 3414
183 Ga0307416_100002731 3300032002 Bacteria 10232
184 Ga0373956_0061478 3300035119 Bacteria 1702
185 Ga0373927_0078944 3300035695 Bacteria 2132
186 Ga0451577_0076957 3300042876 Bacteria 2975
187 Ga0466969_0068341 3300044656 Bacteria 1712
188 Ga0453683_0002084 3300044673 Bacteria 16003
189 Ga0453683_0005250 3300044673 Bacteria 9071
190 Ga0466961_0005521 3300044693 Bacteria 7978
191 Ga0453684_0808326 3300044712 Unclassified 1011
192 Ga0451576_0001404 3300045051 Bacteria 41339
193 Ga0451576_0003210 3300045051 Bacteria 22792
194 Ga0451576_0068482 3300045051 Bacteria 3693
195 Ga0451576_0072630 3300045051 Bacteria 3580
196 Ga0451576_0075747 3300045051 Bacteria 3501
197 Ga0451576_0179510 3300045051 Bacteria 2210
198 Ga0451576_0450860 3300045051 Bacteria 1350
199 Ga0451576_0534103 3300045051 Bacteria 1232
200 Ga0495663_0021052 3300046525 Bacteria 1876
201 Ga0496104_0056715 3300048907 Bacteria 3705
202 Ga0496105_0002597 3300048908 Bacteria 13140
203 Ga0496108_0031570 3300048911 Bacteria 4395
204 Ga0496109_0030365 3300048912 Bacteria 4844
205 Ga0496110_0008071 3300048913 Bacteria 8451
206 Ga0496111_0026604 3300048914 Bacteria 4086
207 Ga0496113_0002757 3300048916 Bacteria 10328
208 Ga0501047_0283454 3300049581 Bacteria 1501
209 Ga0501081_0038302 3300049743 Bacteria 3275
210 nmdc:mga05p37_868_c1 3300050507 Bacteria 34033
211 nmdc:mga09592_208266_c1 3300050508 Bacteria 1694
212 nmdc:mga09592_8029_c1 3300050508 Bacteria 8583
213 nmdc:mga0qj67_102371_c1 3300050509 Bacteria 2309
214 nmdc:mga0qj67_176812_c1 3300050509 Bacteria 1733
215 nmdc:mga0qj67_30526_c1 3300050509 Bacteria 4197
216 nmdc:mga06r32_228177_c1 3300050510 Bacteria 1850
217 nmdc:mga06r32_99775_c1 3300050510 Bacteria 2848
218 nmdc:mga08y16_179783_c1 3300050511 Bacteria 2196
219 nmdc:mga0n895_140795_c1 3300050512 Unclassified 2441
220 nmdc:mga0n895_19048_c1 3300050512 Bacteria 6370
221 nmdc:mga0n895_2774_c1 3300050512 Bacteria 13850
222 nmdc:mga0n895_356388_c1 3300050512 Unclassified 1482
223 nmdc:mga0n895_3922_c1 3300050512 Bacteria 12088
224 nmdc:mga0n895_472001_c1 3300050512 Unclassified 1266
225 nmdc:mga0n895_49908_c1 3300050512 Bacteria 4102
226 nmdc:mga0rr50_100735_c1 3300050513 Bacteria 2269
227 nmdc:mga0rr50_194706_c1 3300050513 Bacteria 1663
228 nmdc:mga0rr50_23059_c1 3300050513 Bacteria 4284
229 nmdc:mga0rr50_61538_c1 3300050513 Bacteria 2829
230 nmdc:mga08x19_151836_c1 3300050514 Unclassified 1569
231 nmdc:mga08x19_34319_c1 3300050514 Bacteria 3206
232 nmdc:mga08x19_49817_c1 3300050514 Bacteria 2687
233 nmdc:mga08x19_53658_c1 3300050514 Bacteria 2594
234 nmdc:mga08x19_54009_c1 3300050514 Bacteria 2585
235 nmdc:mga0a205_186216_c1 3300050515 Bacteria 1969
236 nmdc:mga0a205_24433_c1 3300050515 Bacteria 5747
237 nmdc:mga0a205_28534_c1 3300050515 Bacteria 5337
238 nmdc:mga0a205_41362_c1 3300050515 Bacteria 4438
239 nmdc:mga0a205_70165_c1 3300050515 Bacteria 3383
240 Ga0501084_0068963 3300054114 Bacteria 2960
241 Ga0070697_100070031
242 Ga0070658_10013911
243 Ga0070658_10400881
244 Ga0070680_100002791
245 Ga0070680_100029163
246 Ga0070692_10187026
247 Ga0070703_10000571
248 Ga0070703_10001212
249 Ga0070703_10011867
250 Ga0070709_10003597
251 Ga0070714_100065157
252 Ga0070713_100244759
253 Ga0070701_10032528
254 Ga0070711_100005527
255 Ga0070711_100053780
256 Ga0070705_100001730
257 Ga0070705_100003349
258 Ga0070705_100005768
259 Ga0070705_100006987
260 Ga0070705_100079986
261 Ga0070705_100172498
262 Ga0070694_100000915
263 Ga0070694_100001180
264 Ga0070694_100005404
265 Ga0070694_100006874
266 Ga0070694_100016924
267 Ga0070694_100084503
268 Ga0070694_100200736
269 Ga0070708_100089885
270 Ga0070708_100112510
271 Ga0070708_100117043
272 Ga0070708_100170149
273 Ga0070708_100358215
274 Ga0070708_100369996
275 Ga0070662_100000305
276 Ga0070685_10041691
277 Ga0070706_100004140
278 Ga0070706_100036404
279 Ga0070706_100111453
280 Ga0070707_100012242
281 Ga0070707_100013120
282 Ga0070707_100014209
283 Ga0070707_100099086
284 Ga0070707_100134680
285 Ga0070698_100025876
286 Ga0070698_100034539
287 Ga0070698_100083745
288 Ga0070698_100168903
289 Ga0070698_100358026
290 Ga0070698_100369631
291 Ga0070699_100029071
292 Ga0070699_100039747
293 Ga0070699_100047945
294 Ga0070699_100102440
295 Ga0070699_100156717
296 Ga0070697_100003196
297 Ga0070697_100014116
298 Ga0070697_100022768
299 Ga0070697_100023431
300 Ga0070697_100080607
301 Ga0070697_100150068
302 Ga0070672_100011749
303 Ga0070686_100000066
304 Ga0070686_100042916
305 Ga0070695_100022816
306 Ga0070695_100029418
307 Ga0070695_100035588
308 Ga0070695_100044588
309 Ga0070695_100109273
310 Ga0070695_100251747
311 Ga0070696_100001401
312 Ga0070696_100004847
313 Ga0070696_100026959
314 Ga0070696_100051483
315 Ga0070696_100056467
316 Ga0070696_100107873
317 Ga0070704_100000644
318 Ga0070704_100005733
319 Ga0070704_100037806
320 Ga0070704_100064045
321 Ga0070704_100085945
322 Ga0068855_100018146
323 Ga0068855_100220996
324 Ga0068856_100090719
325 Ga0068856_100337118
326 Ga0068852_100001588
327 Ga0068859_100046029
328 Ga0068859_100340092
329 Ga0068864_100251474
330 Ga0068861_100204082
331 Ga0070716_100033470
332 Ga0070716_100039330
333 Ga0075428_100005684
334 Ga0075430_100119898
335 Ga0075430_100190830
336 Ga0075431_100047048
337 Ga0075431_100089897
338 Ga0075431_100103150
339 Ga0075433_10007800
340 Ga0075433_10027108
341 Ga0075433_10031497
342 Ga0075433_10072648
343 Ga0075433_10167394
344 Ga0075433_10232404
345 Ga0075434_100006849
346 Ga0075434_100008859
347 Ga0075434_100081647
348 Ga0075434_100139650
349 Ga0075434_100163869
350 Ga0075434_100164235
351 Ga0075434_100258703
352 Ga0075434_100266991
353 Ga0075434_100400429
354 Ga0075429_100002921
355 Ga0075429_100036718
356 Ga0075429_100144835
357 Ga0075436_100024879
358 Ga0075436_100082274
359 Ga0075436_100088241
360 Ga0075436_100091090
361 Ga0097620_100046029
362 Ga0097620_100340115
363 Ga0075435_100007775
364 Ga0075435_100012718
365 Ga0075435_100078570
366 Ga0075435_100244607
367 Ga0075435_100358344
368 Ga0099794_10000020
369 Ga0099794_10105509
370 Ga0105240_10000395
371 Ga0105240_10203660
372 Ga0111539_10174151
373 Ga0114129_10481670
374 Ga0105248_10199857
375 Ga0157370_10002893
376 Ga0157378_10059068
377 Ga0157372_10118521
378 Ga0157375_10963292
379 Ga0163163_10066852
380 Ga0163163_10105325
381 Ga0157376_10484914
382 Ga0207653_10000048
383 Ga0207653_10005078
384 Ga0207653_10015037
385 Ga0207699_10005124
386 Ga0207699_10015565
387 Ga0207705_10182155
388 Ga0207684_10015566
389 Ga0207684_10058202
390 Ga0207684_10078744
391 Ga0207684_10128608
392 Ga0207684_10144682
393 Ga0207684_10205969
394 Ga0207684_10305200
395 Ga0207671_10026473
396 Ga0207663_10000053
397 Ga0207663_10093233
398 Ga0207660_10003140
399 Ga0207660_10020959
400 Ga0207660_10207629
401 Ga0207662_10044574
402 Ga0207646_10001595
403 Ga0207646_10003084
404 Ga0207646_10038035
405 Ga0207646_10039653
406 Ga0207646_10079982
407 Ga0207646_10229003
408 Ga0207700_10194711
409 Ga0207665_10003920
410 Ga0207665_10048069
411 Ga0207691_10019262
412 Ga0207711_10242543
413 Ga0207667_10053693
414 Ga0207708_10051635
415 Ga0207702_10238778
416 Ga0207698_10006244
417 Ga0209588_1004736
418 Ga0209588_1005543
419 Ga0265331_10121728
420 Ga0265316_10009598
421 Ga0265314_10008980
422 Ga0265342_10029364
423 Ga0307416_100002731
424 Ga0373956_0061478
425 Ga0373927_0078944
426 Ga0451577_0076957
427 Ga0466969_0068341
428 Ga0453683_0002084
429 Ga0453683_0005250
430 Ga0466961_0005521
431 Ga0453684_0808326
432 Ga0451576_0001404
433 Ga0451576_0003210
434 Ga0451576_0068482
435 Ga0451576_0072630
436 Ga0451576_0075747
437 Ga0451576_0179510
438 Ga0451576_0450860
439 Ga0451576_0534103
440 Ga0495663_0021052
441 Ga0496104_0056715
442 Ga0496105_0002597
443 Ga0496108_0031570
444 Ga0496109_0030365
445 Ga0496110_0008071
446 Ga0496111_0026604
447 Ga0496113_0002757
448 Ga0501047_0283454
449 Ga0501081_0038302
450 nmdc:mga05p37_868_c1
451 nmdc:mga09592_208266_c1
452 nmdc:mga09592_8029_c1
453 nmdc:mga0qj67_102371_c1
454 nmdc:mga0qj67_176812_c1
455 nmdc:mga0qj67_30526_c1
456 nmdc:mga06r32_228177_c1
457 nmdc:mga06r32_99775_c1
458 nmdc:mga08y16_179783_c1
459 nmdc:mga0n895_140795_c1
460 nmdc:mga0n895_19048_c1
461 nmdc:mga0n895_2774_c1
462 nmdc:mga0n895_356388_c1
463 nmdc:mga0n895_3922_c1
464 nmdc:mga0n895_472001_c1
465 nmdc:mga0n895_49908_c1
466 nmdc:mga0rr50_100735_c1
467 nmdc:mga0rr50_194706_c1
468 nmdc:mga0rr50_23059_c1
469 nmdc:mga0rr50_61538_c1
470 nmdc:mga08x19_151836_c1
471 nmdc:mga08x19_34319_c1
472 nmdc:mga08x19_49817_c1
473 nmdc:mga08x19_53658_c1
474 nmdc:mga08x19_54009_c1
475 nmdc:mga0a205_186216_c1
476 nmdc:mga0a205_24433_c1
477 nmdc:mga0a205_28534_c1
478 nmdc:mga0a205_41362_c1
479 nmdc:mga0a205_70165_c1
480 Ga0501084_0068963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

1

181

0.98

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

206

313

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9595 2 309
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.9566 2 308
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9535 2 309
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9505 1 307
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.95 2 308
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9743 2 205 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9611 2 205 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9594 2 205 3.40.50.170
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9477 1 302 3.40.50.12230
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9428 2 205 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A7U9WVT5-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9895 1 112 GO:0004479
GO:0005829
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.989 1 124 GO:0004479
GO:0005829
AF-A0A376FF32-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9822 1 205 GO:0004479
GO:0005829
AF-D8FIG2-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9813 1 205 GO:0004479
GO:0005829
AF-A0A432IEX0-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9795 1 246 GO:0004479
GO:0005829

Map