F352627

General Info

Members Datasets Scaffolds Average Seq Length
240 156 216 182

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100552585|Ga0070708_1005525852
Length 181
Sequence MKDWQRADSAQVFRCRVFNVRRDESYSPLTGEAHEFFVIEPTHWVNVIAVTPERQVVLVEQYRHGINRVTLEIPGGIIDGDELPEAAARRELLEETGYEAENWRLIGINEPNSAIQNNRCYTYLAEQSRLIVSQRLDQTEDIDVHLAPLDSIAGLIMDGKINHALVIAAFYYYDHFKKVEN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
16 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
17 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
18 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
19 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
20 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
21 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
22 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
23 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
24 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
25 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
26 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
34 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90
Metatranscriptomes 0
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 0
Rhizoplane 0.83
Rhizosphere 81.67
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3132777 2162886007 Bacteria 3261
2 JGI24736J21556_1002653 3300001904 Bacteria 3134
3 JGI24737J22298_10007572 3300001990 Bacteria 3660
4 JGI24735J21928_10065272 3300002067 Bacteria 1045
5 JGI25152J39213_1000737 3300002773 Bacteria 16746
6 JGI25150J39212_1000360 3300002774 Bacteria 22352
7 JGI25151J46595_10000947 3300003187 Bacteria 22352
8 JGI25153J46596_10000587 3300003215 Bacteria 22352
9 rootH1_10008251 3300003316 Bacteria 10642
10 rootH1_10049485 3300003323 Bacteria 6557
11 Ga0055530_10021622 3300003791 Bacteria 1890
12 Ga0065714_10002768 3300005288 Bacteria 13465
13 Ga0065714_10065465 3300005288 Bacteria 9923
14 Ga0065714_10068717 3300005288 Bacteria 4566
15 Ga0065714_10106642 3300005288 Bacteria 1481
16 Ga0065714_10110816 3300005288 Bacteria 1474
17 Ga0065704_10000234 3300005289 Bacteria 68011
18 Ga0065704_10136293 3300005289 Bacteria 1522
19 Ga0070658_10582695 3300005327 Bacteria 969
20 Ga0070676_10006129 3300005328 Bacteria 6419
21 Ga0070683_100797281 3300005329 Bacteria 905
22 Ga0068869_100083125 3300005334 Bacteria 2394
23 Ga0068868_100091886 3300005338 Bacteria 2446
24 Ga0070660_100442124 3300005339 Bacteria 1078
25 Ga0070673_100026931 3300005364 Bacteria 4254
26 Ga0070659_100098602 3300005366 Bacteria 2350
27 Ga0070708_100552585 3300005445 Bacteria 1086
28 Ga0070663_100212530 3300005455 Bacteria 1515
29 Ga0070663_100566623 3300005455 Bacteria 951
30 Ga0070678_100036473 3300005456 Bacteria 3442
31 Ga0068867_100045812 3300005459 Bacteria 3209
32 Ga0070679_100078207 3300005530 Bacteria 3297
33 Ga0068853_100097212 3300005539 Bacteria 2599
34 Ga0070665_100000061 3300005548 Bacteria 222138
35 Ga0068855_100000141 3300005563 Bacteria 92463
36 Ga0068855_100058495 3300005563 Bacteria 4514
37 Ga0068857_100223307 3300005577 Bacteria 1721
38 Ga0068856_100009668 3300005614 Bacteria 9364
39 Ga0068856_100187529 3300005614 Unclassified 2082
40 Ga0068852_100006565 3300005616 Bacteria 8417
41 Ga0068870_10307875 3300005840 Bacteria 1002
42 Ga0068863_100354990 3300005841 Bacteria 1428
43 Ga0075366_10003659 3300006195 Bacteria 8149
44 Ga0075366_10019486 3300006195 Bacteria 3926
45 Ga0097621_100012648 3300006237 Bacteria 6265
46 Ga0075370_10228345 3300006353 Bacteria 1101
47 Ga0068871_100000622 3300006358 Bacteria 24425
48 Ga0068865_100005448 3300006881 Bacteria 7722
49 Ga0105240_10009940 3300009093 Bacteria 13413
50 Ga0105240_10104434 3300009093 Bacteria 3441
51 Ga0105241_10236353 3300009174 Bacteria 1543
52 Ga0105237_10000465 3300009545 Bacteria 57393
53 Ga0105237_10008137 3300009545 Bacteria 11385
54 Ga0105237_10011183 3300009545 Bacteria 9510
55 Ga0105237_11072395 3300009545 Bacteria 812
56 Ga0105239_10080322 3300010375 Bacteria 3588
57 Ga0105239_10137247 3300010375 Bacteria 2723
58 Ga0157373_10003855 3300013100 Bacteria 11334
59 Ga0157373_10016499 3300013100 Bacteria 5386
60 Ga0157373_10026352 3300013100 Bacteria 4199
61 Ga0157371_10001554 3300013102 Bacteria 23606
62 Ga0157371_10019750 3300013102 Bacteria 4964
63 Ga0157371_10024083 3300013102 Bacteria 4447
64 Ga0157371_10026092 3300013102 Bacteria 4251
65 Ga0157371_10032953 3300013102 Bacteria 3725
66 Ga0157371_10279513 3300013102 Unclassified 1206
67 Ga0157371_10411645 3300013102 Bacteria 990
68 Ga0157371_10724591 3300013102 Bacteria 746
69 Ga0157370_10002387 3300013104 Bacteria 22646
70 Ga0157370_10006383 3300013104 Bacteria 13013
71 Ga0157370_10027867 3300013104 Bacteria 5566
72 Ga0157370_10043632 3300013104 Bacteria 4314
73 Ga0157370_10091224 3300013104 Bacteria 2861
74 Ga0157370_10256147 3300013104 Bacteria 1618
75 Ga0157369_10001625 3300013105 Bacteria 27447
76 Ga0157369_10207936 3300013105 Bacteria 2052
77 Ga0157369_10796883 3300013105 Bacteria 971
78 Ga0157374_10011079 3300013296 Bacteria 7790
79 Ga0163162_10000087 3300013306 Bacteria 85680
80 Ga0163162_10000586 3300013306 Bacteria 33755
81 Ga0163162_10009602 3300013306 Bacteria 9413
82 Ga0163162_10860728 3300013306 Bacteria 1021
83 Ga0157372_10000048 3300013307 Bacteria 142757
84 Ga0157372_10001459 3300013307 Bacteria 25634
85 Ga0157372_10245310 3300013307 Bacteria 2079
86 Ga0182008_10000021 3300014497 Bacteria 227140
87 Ga0182008_10000165 3300014497 Bacteria 51552
88 Ga0182006_1000247 3300015261 Bacteria 50590
89 Ga0182006_1002188 3300015261 Bacteria 10837
90 Ga0182006_1002453 3300015261 Bacteria 10138
91 Ga0182006_1002563 3300015261 Bacteria 9843
92 Ga0182006_1006618 3300015261 Bacteria 5367
93 Ga0182007_10000016 3300015262 Bacteria 202375
94 Ga0182007_10008201 3300015262 Bacteria 4304
95 Ga0183373_1011 3300015682 Bacteria 138873
96 Ga0163161_10001359 3300017792 Bacteria 18150
97 Ga0163161_10002630 3300017792 Bacteria 12778
98 Ga0163161_10033811 3300017792 Bacteria 3654
99 Ga0163161_10202794 3300017792 Bacteria 1529
100 Ga0209437_100230 3300025233 Bacteria 95882
101 Ga0209026_1016798 3300025250 Unclassified 1179
102 Ga0209129_1008682 3300025258 Bacteria 2792
103 Ga0209233_1015761 3300025261 Bacteria 2096
104 Ga0209676_1000106 3300025292 Bacteria 222576
105 Ga0209050_1000174 3300025298 Bacteria 148871
106 Ga0207647_10000877 3300025904 Bacteria 23342
107 Ga0207645_10001026 3300025907 Bacteria 23094
108 Ga0207643_10309668 3300025908 Bacteria 984
109 Ga0207705_10000088 3300025909 Bacteria 113694
110 Ga0207654_10015759 3300025911 Bacteria 3928
111 Ga0207695_10013534 3300025913 Bacteria 9721
112 Ga0207695_11329914 3300025913 Bacteria 599
113 Ga0207671_10000316 3300025914 Bacteria 71241
114 Ga0207671_10004296 3300025914 Bacteria 13701
115 Ga0207671_10004914 3300025914 Bacteria 12547
116 Ga0207671_10016211 3300025914 Bacteria 5801
117 Ga0207671_10034653 3300025914 Bacteria 3750
118 Ga0207671_10254980 3300025914 Bacteria 1380
119 Ga0207671_10950723 3300025914 Bacteria 678
120 Ga0207652_10239467 3300025921 Unclassified 1636
121 Ga0207690_10089645 3300025932 Bacteria 2169
122 Ga0207686_10034309 3300025934 Bacteria 3036
123 Ga0207704_10000028 3300025938 Bacteria 122144
124 Ga0207689_10262160 3300025942 Bacteria 1430
125 Ga0207667_10000030 3300025949 Bacteria 327226
126 Ga0207667_10000408 3300025949 Bacteria 58389
127 Ga0207667_10047965 3300025949 Bacteria 4518
128 Ga0207667_10070746 3300025949 Bacteria 3631
129 Ga0207651_10019554 3300025960 Bacteria 4062
130 Ga0207640_10486164 3300025981 Bacteria 1025
131 Ga0207677_10064725 3300026023 Bacteria 2548
132 Ga0207639_10015982 3300026041 Bacteria 5301
133 Ga0207639_10099791 3300026041 Bacteria 2343
134 Ga0207678_10024089 3300026067 Bacteria 5318
135 Ga0207678_10753717 3300026067 Bacteria 858
136 Ga0207702_10008805 3300026078 Bacteria 8507
137 Ga0207702_10168524 3300026078 Unclassified 2006
138 Ga0207648_10000968 3300026089 Bacteria 32355
139 Ga0207674_10230428 3300026116 Bacteria 1800
140 Ga0207674_10242114 3300026116 Bacteria 1751
141 Ga0207683_10033022 3300026121 Bacteria 4495
142 Ga0207698_10006109 3300026142 Bacteria 7494
143 Ga0268266_10000053 3300028379 Bacteria 295181
144 Ga0307515_10000676 3300028794 Bacteria 78539
145 Ga0307515_10004899 3300028794 Bacteria 27348
146 Ga0307515_10011130 3300028794 Bacteria 17107
147 Ga0307516_10620375 3300031730 Bacteria 736
148 Ga0307405_10000023 3300031731 Bacteria 141450
149 Ga0307407_10000057 3300031903 Bacteria 49070
150 Ga0307412_10000149 3300031911 Bacteria 50465
151 Ga0307412_10039535 3300031911 Bacteria 3046
152 Ga0307412_10371523 3300031911 Bacteria 1155
153 Ga0307416_100000112 3300032002 Bacteria 49491
154 Ga0307414_10004544 3300032004 Bacteria 7545
155 Ga0307414_10004590 3300032004 Bacteria 7515
156 Ga0307414_10007707 3300032004 Bacteria 6063
157 Ga0307414_10018130 3300032004 Bacteria 4324
158 Ga0307507_10005214 3300033179 Bacteria 21670
159 Ga0373941_0042804 3300035115 Bacteria 1407
160 Ga0395899_0000453 3300037312 Bacteria 46699
161 Ga0395899_0002538 3300037312 Bacteria 14791
162 Ga0395899_0059268 3300037312 Bacteria 2822
163 Ga0395900_0000431 3300037418 Bacteria 60172
164 Ga0395900_0021872 3300037418 Bacteria 6539
165 Ga0395900_0564070 3300037418 Bacteria 1082
166 Ga0395898_0100025 3300037466 Bacteria 2785
167 Ga0395905_0001156 3300037471 Bacteria 33041
168 Ga0395905_0001183 3300037471 Bacteria 32616
169 Ga0395905_0001649 3300037471 Bacteria 26382
170 Ga0395901_0001158 3300038443 Bacteria 28004
171 Ga0395901_0001199 3300038443 Bacteria 27585
172 Ga0466959_0087713 3300045049 Bacteria 2238
173 Ga0495638_0141177 3300046460 Bacteria 1406
174 Ga0495650_0000023 3300046471 Bacteria 527763
175 Ga0495596_0078261 3300046500 Bacteria 1284
176 Ga0495583_0082289 3300046506 Bacteria 1397
177 Ga0495583_0102710 3300046506 Bacteria 1219
178 Ga0495606_0000448 3300046507 Bacteria 67282
179 Ga0495606_0008544 3300046507 Bacteria 8869
180 Ga0495606_0075762 3300046507 Bacteria 2105
181 Ga0495610_0001315 3300046512 Bacteria 22083
182 Ga0495610_0001664 3300046512 Bacteria 19541
183 Ga0495616_0001269 3300046513 Bacteria 17736
184 Ga0495616_0017732 3300046513 Bacteria 3922
185 Ga0495637_0035396 3300046520 Bacteria 2181
186 Ga0495648_0089138 3300046524 Bacteria 1732
187 Ga0495652_0111385 3300046529 Bacteria 2201
188 Ga0495652_0587372 3300046529 Bacteria 761
189 Ga0495609_0010562 3300046538 Bacteria 4425
190 Ga0495633_0000082 3300046558 Bacteria 125101
191 Ga0495633_0005199 3300046558 Bacteria 8038
192 Ga0495625_0000018 3300046660 Bacteria 299567
193 Ga0495625_0085430 3300046660 Bacteria 2190
194 Ga0495625_0109892 3300046660 Bacteria 1885
195 Ga0495661_0001731 3300046665 Bacteria 17639
196 Ga0495670_0129126 3300046691 Bacteria 1317
197 Ga0495671_0354368 3300046692 Bacteria 704
198 Ga0495649_0000015 3300046694 Bacteria 246431
199 Ga0495660_0191477 3300046810 Bacteria 982
200 Ga0495687_001855 3300047443 Bacteria 18422
201 Ga0495686_0000585 3300047472 Bacteria 51508
202 Ga0495686_0038016 3300047472 Bacteria 3081
203 Ga0495614_0043550 3300048089 Bacteria 1925
204 Ga0496115_0076913 3300048918 Bacteria 2713
205 Ga0496122_0000395 3300048925 Bacteria 92779
206 Ga0496123_0001650 3300048926 Bacteria 29957
207 Ga0495678_016844 3300049459 Bacteria 3328
208 Ga0495678_136494 3300049459 Bacteria 807
209 Ga0501249_022563 3300049679 Bacteria 1378
210 nmdc:mga0k408_7788_c1 3300050493 Bacteria 3972
211 Ga0500651_0000552 3300053093 Bacteria 19015
212 Ga0500608_001018 3300053122 Bacteria 10052
213 Ga0500618_000027 3300053125 Bacteria 142903
214 Ga0500618_006941 3300053125 Bacteria 3275
215 Ga0500658_0275052 3300053134 Bacteria 774
216 Ga0500568_0025782 3300053139 Bacteria 2475

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100078207 Ga0070679_1000782072 165
2 3300025921 Ga0207652_10239467 Ga0207652_102394672 165
3 3300006353 Ga0075370_10228345 Ga0075370_102283452 168
4 3300013307 Ga0157372_10245310 Ga0157372_102453102 169
5 3300001904 JGI24736J21556_1002653 JGI24736J21556_10026532 171
6 3300001990 JGI24737J22298_10007572 JGI24737J22298_100075723 171
7 3300002067 JGI24735J21928_10065272 JGI24735J21928_100652722 171
8 3300005327 Ga0070658_10582695 Ga0070658_105826951 171
9 3300005577 Ga0068857_100223307 Ga0068857_1002233071 171
10 3300013100 Ga0157373_10016499 Ga0157373_100164996 171
11 3300013102 Ga0157371_10019750 Ga0157371_100197501 171
12 3300025261 Ga0209233_1015761 Ga0209233_10157612 171
13 3300025904 Ga0207647_10000877 Ga0207647_100008778 171
14 3300026116 Ga0207674_10230428 Ga0207674_102304282 171
15 3300005366 Ga0070659_100098602 Ga0070659_1000986023 172
16 3300025932 Ga0207690_10089645 Ga0207690_100896452 172
17 3300031911 Ga0307412_10039535 Ga0307412_100395355 173
18 iso_pu_bacteria 2902048731 2902050857 175
19 iso_pu_bacteria 2852627209 2852632276 177
20 iso_pu_bacteria 2585427687 2586207955 178
21 iso_pu_bacteria 2738541302 2738856500 178
22 iso_pu_bacteria 2738543023 2739302900 178
23 iso_pu_bacteria 2739367651 2739587487 178
24 iso_pu_bacteria 2818991437 2819550374 178
25 iso_pu_bacteria 2842722452 2842726934 178
26 iso_pu_bacteria 2842909656 2842911783 178
27 iso_pu_bacteria 2849281842 2849286974 178
28 iso_pu_bacteria 2904445276 2904448782 178
29 iso_pu_bacteria 2919186247 2919191295 178
30 iso_pu_bacteria 2939664404 2939669574 178
31 iso_pu_bacteria 2945997725 2946002737 178
32 iso_pu_bacteria 2954016120 2954019612 178
33 3300005445 Ga0070708_100552585 Ga0070708_1005525852 179
34 3300028794 Ga0307515_10011130 Ga0307515_100111309 179
35 3300048918 Ga0496115_0076913 Ga0496115_0076913_2139_2678 179
36 iso_pu_bacteria 2599185184 2599479220 179
37 iso_pu_bacteria 2738541283 2738758497 179
38 iso_pu_bacteria 2738541284 2738764152 179
39 iso_pu_bacteria 2739367656 2739613844 179
40 iso_pu_bacteria 2775506987 2776611904 179
41 iso_pu_bacteria 2919437846 2919439272 179
42 iso_pu_bacteria 2928078545 2928082465 179
43 iso_pu_bacteria 2928147474 2928148947 179
44 iso_pu_bacteria 2932082852 2932087480 179
45 3300009093 Ga0105240_10104434 Ga0105240_101044342 180
46 3300009545 Ga0105237_10011183 Ga0105237_1001118312 180
47 3300010375 Ga0105239_10080322 Ga0105239_100803222 180
48 3300013296 Ga0157374_10011079 Ga0157374_100110791 180
49 3300025233 Ga0209437_100230 Ga0209437_10023077 180
50 3300025258 Ga0209129_1008682 Ga0209129_10086825 180
51 3300025913 Ga0207695_11329914 Ga0207695_113299141 180
52 3300025914 Ga0207671_10004296 Ga0207671_1000429612 180
53 3300025914 Ga0207671_10254980 Ga0207671_102549802 180
54 3300025949 Ga0207667_10070746 Ga0207667_100707463 180
55 3300025981 Ga0207640_10486164 Ga0207640_104861642 180
56 3300045049 Ga0466959_0087713 Ga0466959_0087713_1294_1839 180
57 3300005288 Ga0065714_10002768 Ga0065714_1000276811 181
58 3300009545 Ga0105237_10008137 Ga0105237_100081377 181
59 3300013104 Ga0157370_10002387 Ga0157370_1000238719 181
60 3300013306 Ga0163162_10860728 Ga0163162_108607282 181
61 3300015261 Ga0182006_1002188 Ga0182006_10021886 181
62 3300017792 Ga0163161_10001359 Ga0163161_100013593 181
63 3300025914 Ga0207671_10016211 Ga0207671_100162117 181
64 3300048925 Ga0496122_0000395 Ga0496122_0000395_5479_6024 181
65 3300048926 Ga0496123_0001650 Ga0496123_0001650_25049_25594 181
66 3300003316 rootH1_10008251 rootH1_100082513 182
67 3300003323 rootH1_10049485 rootH1_100494856 182
68 3300003791 Ga0055530_10021622 Ga0055530_100216222 182
69 3300005288 Ga0065714_10065465 Ga0065714_100654653 182
70 3300005288 Ga0065714_10068717 Ga0065714_100687174 182
71 3300005288 Ga0065714_10110816 Ga0065714_101108162 182
72 3300005289 Ga0065704_10136293 Ga0065704_101362932 182
73 3300005328 Ga0070676_10006129 Ga0070676_100061293 182
74 3300005334 Ga0068869_100083125 Ga0068869_1000831252 182
75 3300005338 Ga0068868_100091886 Ga0068868_1000918861 182
76 3300005339 Ga0070660_100442124 Ga0070660_1004421241 182
77 3300005364 Ga0070673_100026931 Ga0070673_1000269313 182
78 3300005455 Ga0070663_100566623 Ga0070663_1005666231 182
79 3300005456 Ga0070678_100036473 Ga0070678_1000364732 182
80 3300005459 Ga0068867_100045812 Ga0068867_1000458121 182
81 3300005539 Ga0068853_100097212 Ga0068853_1000972122 182
82 3300005548 Ga0070665_100000061 Ga0070665_10000006117 182
83 3300005563 Ga0068855_100058495 Ga0068855_1000584955 182
84 3300005614 Ga0068856_100009668 Ga0068856_1000096685 182
85 3300005616 Ga0068852_100006565 Ga0068852_1000065656 182
86 3300005840 Ga0068870_10307875 Ga0068870_103078752 182
87 3300005841 Ga0068863_100354990 Ga0068863_1003549902 182
88 3300006195 Ga0075366_10003659 Ga0075366_100036592 182
89 3300006195 Ga0075366_10019486 Ga0075366_100194864 182
90 3300006237 Ga0097621_100012648 Ga0097621_1000126482 182
91 3300006358 Ga0068871_100000622 Ga0068871_1000006228 182
92 3300006881 Ga0068865_100005448 Ga0068865_1000054483 182
93 3300009093 Ga0105240_10009940 Ga0105240_1000994010 182
94 3300009174 Ga0105241_10236353 Ga0105241_102363532 182
95 3300009545 Ga0105237_10000465 Ga0105237_1000046525 182
96 3300010375 Ga0105239_10137247 Ga0105239_101372474 182
97 3300013100 Ga0157373_10026352 Ga0157373_100263522 182
98 3300013102 Ga0157371_10001554 Ga0157371_1000155416 182
99 3300013102 Ga0157371_10024083 Ga0157371_100240832 182
100 3300013102 Ga0157371_10411645 Ga0157371_104116452 182
101 3300013102 Ga0157371_10724591 Ga0157371_107245911 182
102 3300013104 Ga0157370_10006383 Ga0157370_100063834 182
103 3300013104 Ga0157370_10091224 Ga0157370_100912242 182
104 3300013104 Ga0157370_10256147 Ga0157370_102561472 182
105 3300013105 Ga0157369_10001625 Ga0157369_1000162512 182
106 3300013105 Ga0157369_10796883 Ga0157369_107968832 182
107 3300013306 Ga0163162_10000087 Ga0163162_1000008715 182
108 3300013306 Ga0163162_10000586 Ga0163162_1000058627 182
109 3300013306 Ga0163162_10009602 Ga0163162_100096027 182
110 3300013307 Ga0157372_10001459 Ga0157372_1000145911 182
111 3300014497 Ga0182008_10000165 Ga0182008_1000016511 182
112 3300015261 Ga0182006_1000247 Ga0182006_100024746 182
113 3300015262 Ga0182007_10000016 Ga0182007_10000016176 182
114 3300015682 Ga0183373_1011 Ga0183373_1011139 182
115 3300017792 Ga0163161_10002630 Ga0163161_100026305 182
116 3300017792 Ga0163161_10033811 Ga0163161_100338112 182
117 3300017792 Ga0163161_10202794 Ga0163161_102027942 182
118 3300025250 Ga0209026_1016798 Ga0209026_10167982 182
119 3300025292 Ga0209676_1000106 Ga0209676_100010610 182
120 3300025298 Ga0209050_1000174 Ga0209050_1000174147 182
121 3300025907 Ga0207645_10001026 Ga0207645_1000102619 182
122 3300025908 Ga0207643_10309668 Ga0207643_103096682 182
123 3300025909 Ga0207705_10000088 Ga0207705_1000008814 182
124 3300025911 Ga0207654_10015759 Ga0207654_100157595 182
125 3300025913 Ga0207695_10013534 Ga0207695_100135347 182
126 3300025914 Ga0207671_10000316 Ga0207671_100003168 182
127 3300025914 Ga0207671_10004914 Ga0207671_1000491411 182
128 3300025914 Ga0207671_10034653 Ga0207671_100346531 182
129 3300025934 Ga0207686_10034309 Ga0207686_100343093 182
130 3300025938 Ga0207704_10000028 Ga0207704_1000002817 182
131 3300025942 Ga0207689_10262160 Ga0207689_102621602 182
132 3300025949 Ga0207667_10000408 Ga0207667_1000040840 182
133 3300025949 Ga0207667_10047965 Ga0207667_100479655 182
134 3300025960 Ga0207651_10019554 Ga0207651_100195545 182
135 3300026023 Ga0207677_10064725 Ga0207677_100647252 182
136 3300026041 Ga0207639_10015982 Ga0207639_100159824 182
137 3300026041 Ga0207639_10099791 Ga0207639_100997913 182
138 3300026067 Ga0207678_10753717 Ga0207678_107537172 182
139 3300026078 Ga0207702_10008805 Ga0207702_100088054 182
140 3300026089 Ga0207648_10000968 Ga0207648_100009686 182
141 3300026116 Ga0207674_10242114 Ga0207674_102421141 182
142 3300026121 Ga0207683_10033022 Ga0207683_100330226 182
143 3300026142 Ga0207698_10006109 Ga0207698_100061094 182
144 3300028379 Ga0268266_10000053 Ga0268266_10000053183 182
145 3300028794 Ga0307515_10000676 Ga0307515_1000067623 182
146 3300028794 Ga0307515_10004899 Ga0307515_1000489915 182
147 3300031730 Ga0307516_10620375 Ga0307516_106203752 182
148 3300031731 Ga0307405_10000023 Ga0307405_1000002311 182
149 3300031903 Ga0307407_10000057 Ga0307407_1000005710 182
150 3300031911 Ga0307412_10371523 Ga0307412_103715232 182
151 3300032002 Ga0307416_100000112 Ga0307416_10000011244 182
152 3300032004 Ga0307414_10004590 Ga0307414_100045903 182
153 3300033179 Ga0307507_10005214 Ga0307507_1000521415 182
154 3300035115 Ga0373941_0042804 Ga0373941_0042804_86_640 182
155 3300037312 Ga0395899_0002538 Ga0395899_0002538_12622_13176 182
156 3300037312 Ga0395899_0059268 Ga0395899_0059268_244_798 182
157 3300037418 Ga0395900_0000431 Ga0395900_0000431_46996_47550 182
158 3300037418 Ga0395900_0021872 Ga0395900_0021872_5752_6306 182
159 3300037418 Ga0395900_0564070 Ga0395900_0564070_493_1041 182
160 3300037466 Ga0395898_0100025 Ga0395898_0100025_167_721 182
161 3300037471 Ga0395905_0001156 Ga0395905_0001156_31768_32322 182
162 3300037471 Ga0395905_0001183 Ga0395905_0001183_31558_32112 182
163 3300037471 Ga0395905_0001649 Ga0395905_0001649_13206_13760 182
164 3300038443 Ga0395901_0001158 Ga0395901_0001158_13027_13581 182
165 3300038443 Ga0395901_0001199 Ga0395901_0001199_18060_18614 182
166 3300046460 Ga0495638_0141177 Ga0495638_0141177_735_1286 182
167 3300046471 Ga0495650_0000023 Ga0495650_0000023_408607_409158 182
168 3300046506 Ga0495583_0082289 Ga0495583_0082289_127_678 182
169 3300046506 Ga0495583_0102710 Ga0495583_0102710_122_670 182
170 3300046507 Ga0495606_0000448 Ga0495606_0000448_15055_15606 182
171 3300046507 Ga0495606_0008544 Ga0495606_0008544_1428_1979 182
172 3300046507 Ga0495606_0075762 Ga0495606_0075762_576_1127 182
173 3300046512 Ga0495610_0001315 Ga0495610_0001315_2176_2724 182
174 3300046512 Ga0495610_0001664 Ga0495610_0001664_9907_10458 182
175 3300046513 Ga0495616_0001269 Ga0495616_0001269_7889_8440 182
176 3300046513 Ga0495616_0017732 Ga0495616_0017732_2420_2971 182
177 3300046520 Ga0495637_0035396 Ga0495637_0035396_415_966 182
178 3300046524 Ga0495648_0089138 Ga0495648_0089138_77_628 182
179 3300046529 Ga0495652_0111385 Ga0495652_0111385_1208_1759 182
180 3300046529 Ga0495652_0587372 Ga0495652_0587372_175_726 182
181 3300046538 Ga0495609_0010562 Ga0495609_0010562_383_934 182
182 3300046558 Ga0495633_0000082 Ga0495633_0000082_11854_12405 182
183 3300046558 Ga0495633_0005199 Ga0495633_0005199_2895_3446 182
184 3300046660 Ga0495625_0000018 Ga0495625_0000018_133950_134501 182
185 3300046660 Ga0495625_0085430 Ga0495625_0085430_750_1301 182
186 3300046660 Ga0495625_0109892 Ga0495625_0109892_1071_1622 182
187 3300046665 Ga0495661_0001731 Ga0495661_0001731_10943_11494 182
188 3300046691 Ga0495670_0129126 Ga0495670_0129126_141_689 182
189 3300046692 Ga0495671_0354368 Ga0495671_0354368_80_631 182
190 3300046694 Ga0495649_0000015 Ga0495649_0000015_62451_63002 182
191 3300046810 Ga0495660_0191477 Ga0495660_0191477_101_652 182
192 3300047443 Ga0495687_001855 Ga0495687_001855_2392_2940 182
193 3300047472 Ga0495686_0000585 Ga0495686_0000585_18043_18594 182
194 3300047472 Ga0495686_0038016 Ga0495686_0038016_395_946 182
195 3300048089 Ga0495614_0043550 Ga0495614_0043550_102_737 182
196 3300049459 Ga0495678_016844 Ga0495678_016844_1806_2357 182
197 3300049459 Ga0495678_136494 Ga0495678_136494_165_716 182
198 3300049679 Ga0501249_022563 Ga0501249_022563_196_744 182
199 3300050493 nmdc:mga0k408_7788_c1 nmdc:mga0k408_7788_c1_238_789 182
200 3300053125 Ga0500618_000027 Ga0500618_000027_8633_9184 182
201 3300053125 Ga0500618_006941 Ga0500618_006941_2036_2587 182
202 3300053134 Ga0500658_0275052 Ga0500658_0275052_182_733 182
203 2162886007 SwRhRL2b_contig_3132777 SwRhRL2b_0443.00002220 183
204 3300002773 JGI25152J39213_1000737 JGI25152J39213_100073715 183
205 3300002774 JGI25150J39212_1000360 JGI25150J39212_100036015 183
206 3300003187 JGI25151J46595_10000947 JGI25151J46595_1000094715 183
207 3300003215 JGI25153J46596_10000587 JGI25153J46596_1000058715 183
208 3300005288 Ga0065714_10106642 Ga0065714_101066421 183
209 3300005289 Ga0065704_10000234 Ga0065704_1000023477 183
210 3300005329 Ga0070683_100797281 Ga0070683_1007972812 183
211 3300005455 Ga0070663_100212530 Ga0070663_1002125302 183
212 3300005563 Ga0068855_100000141 Ga0068855_10000014127 183
213 3300005614 Ga0068856_100187529 Ga0068856_1001875292 183
214 3300009545 Ga0105237_11072395 Ga0105237_110723952 183
215 3300013100 Ga0157373_10003855 Ga0157373_100038559 183
216 3300013102 Ga0157371_10026092 Ga0157371_100260925 183
217 3300013102 Ga0157371_10032953 Ga0157371_100329534 183
218 3300013102 Ga0157371_10279513 Ga0157371_102795132 183
219 3300013104 Ga0157370_10027867 Ga0157370_100278672 183
220 3300013104 Ga0157370_10043632 Ga0157370_100436322 183
221 3300013105 Ga0157369_10207936 Ga0157369_102079362 183
222 3300013307 Ga0157372_10000048 Ga0157372_1000004812 183
223 3300014497 Ga0182008_10000021 Ga0182008_10000021189 183
224 3300015261 Ga0182006_1002453 Ga0182006_10024532 183
225 3300015261 Ga0182006_1002563 Ga0182006_10025634 183
226 3300015261 Ga0182006_1006618 Ga0182006_10066183 183
227 3300015262 Ga0182007_10008201 Ga0182007_100082012 183
228 3300025914 Ga0207671_10950723 Ga0207671_109507231 183
229 3300025949 Ga0207667_10000030 Ga0207667_1000003050 183
230 3300026067 Ga0207678_10024089 Ga0207678_100240891 183
231 3300026078 Ga0207702_10168524 Ga0207702_101685242 183
232 3300031911 Ga0307412_10000149 Ga0307412_100001499 183
233 3300032004 Ga0307414_10004544 Ga0307414_100045442 183
234 3300032004 Ga0307414_10007707 Ga0307414_100077072 183
235 3300032004 Ga0307414_10018130 Ga0307414_100181303 183
236 3300037312 Ga0395899_0000453 Ga0395899_0000453_9351_9902 183
237 3300046500 Ga0495596_0078261 Ga0495596_0078261_454_1005 183
238 3300053093 Ga0500651_0000552 Ga0500651_0000552_519_1070 183
239 3300053122 Ga0500608_001018 Ga0500608_001018_3601_4152 183
240 3300053139 Ga0500568_0025782 Ga0500568_0025782_624_1175 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

41

170

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2w4e-assembly1.cif.gz_A structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.9586 44 180
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9458 5 180
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9214 5 183
2w4e-assembly1.cif.gz_B structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans 0.9199 44 180
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9155 5 180
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9458 5 180 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9325 1 181 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9224 1 181 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9199 44 180 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9155 5 180 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A520DV30-F1-model_v4 NUDIX hydrolase 0.9838 34 178 GO:0006753
GO:0016462
GO:0019693
AF-A0A3D1RFN7-F1-model_v4 DNA mismatch repair protein MutT 0.9789 35 180 GO:0005829
GO:0006753
GO:0016462
GO:0019693
AF-A0A1G7N4S4-F1-model_v4 NUDIX domain-containing protein 0.9769 5 182 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A396PX41-F1-model_v4 NUDIX hydrolase 0.9729 5 180 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-K2EQJ0-F1-model_v4 NUDIX hydrolase 0.9725 4 183 GO:0005829
GO:0006753
GO:0016787
GO:0019693

Feature Viewer

pLDDT pTM Quality
94.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map