F352627
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 240 | 156 | 216 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100552585|Ga0070708_1005525852 |
| Length | 181 |
| Sequence | MKDWQRADSAQVFRCRVFNVRRDESYSPLTGEAHEFFVIEPTHWVNVIAVTPERQVVLVEQYRHGINRVTLEIPGGIIDGDELPEAAARRELLEETGYEAENWRLIGINEPNSAIQNNRCYTYLAEQSRLIVSQRLDQTEDIDVHLAPLDSIAGLIMDGKINHALVIAAFYYYDHFKKVEN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 5 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 6 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 7 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 8 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 9 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 10 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 11 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 12 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 13 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 14 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 15 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 16 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 17 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 18 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 19 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 20 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 21 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 22 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 23 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 24 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 25 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 26 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 27 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 30 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 31 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 34 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 35 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 111 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 117 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 118 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 125 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 147 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 148 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 149 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 151 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 152 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 153 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 154 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 155 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 156 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90 |
| Metatranscriptomes | 0 |
| Isolates | 10 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.33 |
| Nodule | 0 |
| Rhizoplane | 0.83 |
| Rhizosphere | 81.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3132777 | 2162886007 | Bacteria | 3261 |
| 2 | JGI24736J21556_1002653 | 3300001904 | Bacteria | 3134 |
| 3 | JGI24737J22298_10007572 | 3300001990 | Bacteria | 3660 |
| 4 | JGI24735J21928_10065272 | 3300002067 | Bacteria | 1045 |
| 5 | JGI25152J39213_1000737 | 3300002773 | Bacteria | 16746 |
| 6 | JGI25150J39212_1000360 | 3300002774 | Bacteria | 22352 |
| 7 | JGI25151J46595_10000947 | 3300003187 | Bacteria | 22352 |
| 8 | JGI25153J46596_10000587 | 3300003215 | Bacteria | 22352 |
| 9 | rootH1_10008251 | 3300003316 | Bacteria | 10642 |
| 10 | rootH1_10049485 | 3300003323 | Bacteria | 6557 |
| 11 | Ga0055530_10021622 | 3300003791 | Bacteria | 1890 |
| 12 | Ga0065714_10002768 | 3300005288 | Bacteria | 13465 |
| 13 | Ga0065714_10065465 | 3300005288 | Bacteria | 9923 |
| 14 | Ga0065714_10068717 | 3300005288 | Bacteria | 4566 |
| 15 | Ga0065714_10106642 | 3300005288 | Bacteria | 1481 |
| 16 | Ga0065714_10110816 | 3300005288 | Bacteria | 1474 |
| 17 | Ga0065704_10000234 | 3300005289 | Bacteria | 68011 |
| 18 | Ga0065704_10136293 | 3300005289 | Bacteria | 1522 |
| 19 | Ga0070658_10582695 | 3300005327 | Bacteria | 969 |
| 20 | Ga0070676_10006129 | 3300005328 | Bacteria | 6419 |
| 21 | Ga0070683_100797281 | 3300005329 | Bacteria | 905 |
| 22 | Ga0068869_100083125 | 3300005334 | Bacteria | 2394 |
| 23 | Ga0068868_100091886 | 3300005338 | Bacteria | 2446 |
| 24 | Ga0070660_100442124 | 3300005339 | Bacteria | 1078 |
| 25 | Ga0070673_100026931 | 3300005364 | Bacteria | 4254 |
| 26 | Ga0070659_100098602 | 3300005366 | Bacteria | 2350 |
| 27 | Ga0070708_100552585 | 3300005445 | Bacteria | 1086 |
| 28 | Ga0070663_100212530 | 3300005455 | Bacteria | 1515 |
| 29 | Ga0070663_100566623 | 3300005455 | Bacteria | 951 |
| 30 | Ga0070678_100036473 | 3300005456 | Bacteria | 3442 |
| 31 | Ga0068867_100045812 | 3300005459 | Bacteria | 3209 |
| 32 | Ga0070679_100078207 | 3300005530 | Bacteria | 3297 |
| 33 | Ga0068853_100097212 | 3300005539 | Bacteria | 2599 |
| 34 | Ga0070665_100000061 | 3300005548 | Bacteria | 222138 |
| 35 | Ga0068855_100000141 | 3300005563 | Bacteria | 92463 |
| 36 | Ga0068855_100058495 | 3300005563 | Bacteria | 4514 |
| 37 | Ga0068857_100223307 | 3300005577 | Bacteria | 1721 |
| 38 | Ga0068856_100009668 | 3300005614 | Bacteria | 9364 |
| 39 | Ga0068856_100187529 | 3300005614 | Unclassified | 2082 |
| 40 | Ga0068852_100006565 | 3300005616 | Bacteria | 8417 |
| 41 | Ga0068870_10307875 | 3300005840 | Bacteria | 1002 |
| 42 | Ga0068863_100354990 | 3300005841 | Bacteria | 1428 |
| 43 | Ga0075366_10003659 | 3300006195 | Bacteria | 8149 |
| 44 | Ga0075366_10019486 | 3300006195 | Bacteria | 3926 |
| 45 | Ga0097621_100012648 | 3300006237 | Bacteria | 6265 |
| 46 | Ga0075370_10228345 | 3300006353 | Bacteria | 1101 |
| 47 | Ga0068871_100000622 | 3300006358 | Bacteria | 24425 |
| 48 | Ga0068865_100005448 | 3300006881 | Bacteria | 7722 |
| 49 | Ga0105240_10009940 | 3300009093 | Bacteria | 13413 |
| 50 | Ga0105240_10104434 | 3300009093 | Bacteria | 3441 |
| 51 | Ga0105241_10236353 | 3300009174 | Bacteria | 1543 |
| 52 | Ga0105237_10000465 | 3300009545 | Bacteria | 57393 |
| 53 | Ga0105237_10008137 | 3300009545 | Bacteria | 11385 |
| 54 | Ga0105237_10011183 | 3300009545 | Bacteria | 9510 |
| 55 | Ga0105237_11072395 | 3300009545 | Bacteria | 812 |
| 56 | Ga0105239_10080322 | 3300010375 | Bacteria | 3588 |
| 57 | Ga0105239_10137247 | 3300010375 | Bacteria | 2723 |
| 58 | Ga0157373_10003855 | 3300013100 | Bacteria | 11334 |
| 59 | Ga0157373_10016499 | 3300013100 | Bacteria | 5386 |
| 60 | Ga0157373_10026352 | 3300013100 | Bacteria | 4199 |
| 61 | Ga0157371_10001554 | 3300013102 | Bacteria | 23606 |
| 62 | Ga0157371_10019750 | 3300013102 | Bacteria | 4964 |
| 63 | Ga0157371_10024083 | 3300013102 | Bacteria | 4447 |
| 64 | Ga0157371_10026092 | 3300013102 | Bacteria | 4251 |
| 65 | Ga0157371_10032953 | 3300013102 | Bacteria | 3725 |
| 66 | Ga0157371_10279513 | 3300013102 | Unclassified | 1206 |
| 67 | Ga0157371_10411645 | 3300013102 | Bacteria | 990 |
| 68 | Ga0157371_10724591 | 3300013102 | Bacteria | 746 |
| 69 | Ga0157370_10002387 | 3300013104 | Bacteria | 22646 |
| 70 | Ga0157370_10006383 | 3300013104 | Bacteria | 13013 |
| 71 | Ga0157370_10027867 | 3300013104 | Bacteria | 5566 |
| 72 | Ga0157370_10043632 | 3300013104 | Bacteria | 4314 |
| 73 | Ga0157370_10091224 | 3300013104 | Bacteria | 2861 |
| 74 | Ga0157370_10256147 | 3300013104 | Bacteria | 1618 |
| 75 | Ga0157369_10001625 | 3300013105 | Bacteria | 27447 |
| 76 | Ga0157369_10207936 | 3300013105 | Bacteria | 2052 |
| 77 | Ga0157369_10796883 | 3300013105 | Bacteria | 971 |
| 78 | Ga0157374_10011079 | 3300013296 | Bacteria | 7790 |
| 79 | Ga0163162_10000087 | 3300013306 | Bacteria | 85680 |
| 80 | Ga0163162_10000586 | 3300013306 | Bacteria | 33755 |
| 81 | Ga0163162_10009602 | 3300013306 | Bacteria | 9413 |
| 82 | Ga0163162_10860728 | 3300013306 | Bacteria | 1021 |
| 83 | Ga0157372_10000048 | 3300013307 | Bacteria | 142757 |
| 84 | Ga0157372_10001459 | 3300013307 | Bacteria | 25634 |
| 85 | Ga0157372_10245310 | 3300013307 | Bacteria | 2079 |
| 86 | Ga0182008_10000021 | 3300014497 | Bacteria | 227140 |
| 87 | Ga0182008_10000165 | 3300014497 | Bacteria | 51552 |
| 88 | Ga0182006_1000247 | 3300015261 | Bacteria | 50590 |
| 89 | Ga0182006_1002188 | 3300015261 | Bacteria | 10837 |
| 90 | Ga0182006_1002453 | 3300015261 | Bacteria | 10138 |
| 91 | Ga0182006_1002563 | 3300015261 | Bacteria | 9843 |
| 92 | Ga0182006_1006618 | 3300015261 | Bacteria | 5367 |
| 93 | Ga0182007_10000016 | 3300015262 | Bacteria | 202375 |
| 94 | Ga0182007_10008201 | 3300015262 | Bacteria | 4304 |
| 95 | Ga0183373_1011 | 3300015682 | Bacteria | 138873 |
| 96 | Ga0163161_10001359 | 3300017792 | Bacteria | 18150 |
| 97 | Ga0163161_10002630 | 3300017792 | Bacteria | 12778 |
| 98 | Ga0163161_10033811 | 3300017792 | Bacteria | 3654 |
| 99 | Ga0163161_10202794 | 3300017792 | Bacteria | 1529 |
| 100 | Ga0209437_100230 | 3300025233 | Bacteria | 95882 |
| 101 | Ga0209026_1016798 | 3300025250 | Unclassified | 1179 |
| 102 | Ga0209129_1008682 | 3300025258 | Bacteria | 2792 |
| 103 | Ga0209233_1015761 | 3300025261 | Bacteria | 2096 |
| 104 | Ga0209676_1000106 | 3300025292 | Bacteria | 222576 |
| 105 | Ga0209050_1000174 | 3300025298 | Bacteria | 148871 |
| 106 | Ga0207647_10000877 | 3300025904 | Bacteria | 23342 |
| 107 | Ga0207645_10001026 | 3300025907 | Bacteria | 23094 |
| 108 | Ga0207643_10309668 | 3300025908 | Bacteria | 984 |
| 109 | Ga0207705_10000088 | 3300025909 | Bacteria | 113694 |
| 110 | Ga0207654_10015759 | 3300025911 | Bacteria | 3928 |
| 111 | Ga0207695_10013534 | 3300025913 | Bacteria | 9721 |
| 112 | Ga0207695_11329914 | 3300025913 | Bacteria | 599 |
| 113 | Ga0207671_10000316 | 3300025914 | Bacteria | 71241 |
| 114 | Ga0207671_10004296 | 3300025914 | Bacteria | 13701 |
| 115 | Ga0207671_10004914 | 3300025914 | Bacteria | 12547 |
| 116 | Ga0207671_10016211 | 3300025914 | Bacteria | 5801 |
| 117 | Ga0207671_10034653 | 3300025914 | Bacteria | 3750 |
| 118 | Ga0207671_10254980 | 3300025914 | Bacteria | 1380 |
| 119 | Ga0207671_10950723 | 3300025914 | Bacteria | 678 |
| 120 | Ga0207652_10239467 | 3300025921 | Unclassified | 1636 |
| 121 | Ga0207690_10089645 | 3300025932 | Bacteria | 2169 |
| 122 | Ga0207686_10034309 | 3300025934 | Bacteria | 3036 |
| 123 | Ga0207704_10000028 | 3300025938 | Bacteria | 122144 |
| 124 | Ga0207689_10262160 | 3300025942 | Bacteria | 1430 |
| 125 | Ga0207667_10000030 | 3300025949 | Bacteria | 327226 |
| 126 | Ga0207667_10000408 | 3300025949 | Bacteria | 58389 |
| 127 | Ga0207667_10047965 | 3300025949 | Bacteria | 4518 |
| 128 | Ga0207667_10070746 | 3300025949 | Bacteria | 3631 |
| 129 | Ga0207651_10019554 | 3300025960 | Bacteria | 4062 |
| 130 | Ga0207640_10486164 | 3300025981 | Bacteria | 1025 |
| 131 | Ga0207677_10064725 | 3300026023 | Bacteria | 2548 |
| 132 | Ga0207639_10015982 | 3300026041 | Bacteria | 5301 |
| 133 | Ga0207639_10099791 | 3300026041 | Bacteria | 2343 |
| 134 | Ga0207678_10024089 | 3300026067 | Bacteria | 5318 |
| 135 | Ga0207678_10753717 | 3300026067 | Bacteria | 858 |
| 136 | Ga0207702_10008805 | 3300026078 | Bacteria | 8507 |
| 137 | Ga0207702_10168524 | 3300026078 | Unclassified | 2006 |
| 138 | Ga0207648_10000968 | 3300026089 | Bacteria | 32355 |
| 139 | Ga0207674_10230428 | 3300026116 | Bacteria | 1800 |
| 140 | Ga0207674_10242114 | 3300026116 | Bacteria | 1751 |
| 141 | Ga0207683_10033022 | 3300026121 | Bacteria | 4495 |
| 142 | Ga0207698_10006109 | 3300026142 | Bacteria | 7494 |
| 143 | Ga0268266_10000053 | 3300028379 | Bacteria | 295181 |
| 144 | Ga0307515_10000676 | 3300028794 | Bacteria | 78539 |
| 145 | Ga0307515_10004899 | 3300028794 | Bacteria | 27348 |
| 146 | Ga0307515_10011130 | 3300028794 | Bacteria | 17107 |
| 147 | Ga0307516_10620375 | 3300031730 | Bacteria | 736 |
| 148 | Ga0307405_10000023 | 3300031731 | Bacteria | 141450 |
| 149 | Ga0307407_10000057 | 3300031903 | Bacteria | 49070 |
| 150 | Ga0307412_10000149 | 3300031911 | Bacteria | 50465 |
| 151 | Ga0307412_10039535 | 3300031911 | Bacteria | 3046 |
| 152 | Ga0307412_10371523 | 3300031911 | Bacteria | 1155 |
| 153 | Ga0307416_100000112 | 3300032002 | Bacteria | 49491 |
| 154 | Ga0307414_10004544 | 3300032004 | Bacteria | 7545 |
| 155 | Ga0307414_10004590 | 3300032004 | Bacteria | 7515 |
| 156 | Ga0307414_10007707 | 3300032004 | Bacteria | 6063 |
| 157 | Ga0307414_10018130 | 3300032004 | Bacteria | 4324 |
| 158 | Ga0307507_10005214 | 3300033179 | Bacteria | 21670 |
| 159 | Ga0373941_0042804 | 3300035115 | Bacteria | 1407 |
| 160 | Ga0395899_0000453 | 3300037312 | Bacteria | 46699 |
| 161 | Ga0395899_0002538 | 3300037312 | Bacteria | 14791 |
| 162 | Ga0395899_0059268 | 3300037312 | Bacteria | 2822 |
| 163 | Ga0395900_0000431 | 3300037418 | Bacteria | 60172 |
| 164 | Ga0395900_0021872 | 3300037418 | Bacteria | 6539 |
| 165 | Ga0395900_0564070 | 3300037418 | Bacteria | 1082 |
| 166 | Ga0395898_0100025 | 3300037466 | Bacteria | 2785 |
| 167 | Ga0395905_0001156 | 3300037471 | Bacteria | 33041 |
| 168 | Ga0395905_0001183 | 3300037471 | Bacteria | 32616 |
| 169 | Ga0395905_0001649 | 3300037471 | Bacteria | 26382 |
| 170 | Ga0395901_0001158 | 3300038443 | Bacteria | 28004 |
| 171 | Ga0395901_0001199 | 3300038443 | Bacteria | 27585 |
| 172 | Ga0466959_0087713 | 3300045049 | Bacteria | 2238 |
| 173 | Ga0495638_0141177 | 3300046460 | Bacteria | 1406 |
| 174 | Ga0495650_0000023 | 3300046471 | Bacteria | 527763 |
| 175 | Ga0495596_0078261 | 3300046500 | Bacteria | 1284 |
| 176 | Ga0495583_0082289 | 3300046506 | Bacteria | 1397 |
| 177 | Ga0495583_0102710 | 3300046506 | Bacteria | 1219 |
| 178 | Ga0495606_0000448 | 3300046507 | Bacteria | 67282 |
| 179 | Ga0495606_0008544 | 3300046507 | Bacteria | 8869 |
| 180 | Ga0495606_0075762 | 3300046507 | Bacteria | 2105 |
| 181 | Ga0495610_0001315 | 3300046512 | Bacteria | 22083 |
| 182 | Ga0495610_0001664 | 3300046512 | Bacteria | 19541 |
| 183 | Ga0495616_0001269 | 3300046513 | Bacteria | 17736 |
| 184 | Ga0495616_0017732 | 3300046513 | Bacteria | 3922 |
| 185 | Ga0495637_0035396 | 3300046520 | Bacteria | 2181 |
| 186 | Ga0495648_0089138 | 3300046524 | Bacteria | 1732 |
| 187 | Ga0495652_0111385 | 3300046529 | Bacteria | 2201 |
| 188 | Ga0495652_0587372 | 3300046529 | Bacteria | 761 |
| 189 | Ga0495609_0010562 | 3300046538 | Bacteria | 4425 |
| 190 | Ga0495633_0000082 | 3300046558 | Bacteria | 125101 |
| 191 | Ga0495633_0005199 | 3300046558 | Bacteria | 8038 |
| 192 | Ga0495625_0000018 | 3300046660 | Bacteria | 299567 |
| 193 | Ga0495625_0085430 | 3300046660 | Bacteria | 2190 |
| 194 | Ga0495625_0109892 | 3300046660 | Bacteria | 1885 |
| 195 | Ga0495661_0001731 | 3300046665 | Bacteria | 17639 |
| 196 | Ga0495670_0129126 | 3300046691 | Bacteria | 1317 |
| 197 | Ga0495671_0354368 | 3300046692 | Bacteria | 704 |
| 198 | Ga0495649_0000015 | 3300046694 | Bacteria | 246431 |
| 199 | Ga0495660_0191477 | 3300046810 | Bacteria | 982 |
| 200 | Ga0495687_001855 | 3300047443 | Bacteria | 18422 |
| 201 | Ga0495686_0000585 | 3300047472 | Bacteria | 51508 |
| 202 | Ga0495686_0038016 | 3300047472 | Bacteria | 3081 |
| 203 | Ga0495614_0043550 | 3300048089 | Bacteria | 1925 |
| 204 | Ga0496115_0076913 | 3300048918 | Bacteria | 2713 |
| 205 | Ga0496122_0000395 | 3300048925 | Bacteria | 92779 |
| 206 | Ga0496123_0001650 | 3300048926 | Bacteria | 29957 |
| 207 | Ga0495678_016844 | 3300049459 | Bacteria | 3328 |
| 208 | Ga0495678_136494 | 3300049459 | Bacteria | 807 |
| 209 | Ga0501249_022563 | 3300049679 | Bacteria | 1378 |
| 210 | nmdc:mga0k408_7788_c1 | 3300050493 | Bacteria | 3972 |
| 211 | Ga0500651_0000552 | 3300053093 | Bacteria | 19015 |
| 212 | Ga0500608_001018 | 3300053122 | Bacteria | 10052 |
| 213 | Ga0500618_000027 | 3300053125 | Bacteria | 142903 |
| 214 | Ga0500618_006941 | 3300053125 | Bacteria | 3275 |
| 215 | Ga0500658_0275052 | 3300053134 | Bacteria | 774 |
| 216 | Ga0500568_0025782 | 3300053139 | Bacteria | 2475 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100078207 | Ga0070679_1000782072 | 165 |
| 2 | 3300025921 | Ga0207652_10239467 | Ga0207652_102394672 | 165 |
| 3 | 3300006353 | Ga0075370_10228345 | Ga0075370_102283452 | 168 |
| 4 | 3300013307 | Ga0157372_10245310 | Ga0157372_102453102 | 169 |
| 5 | 3300001904 | JGI24736J21556_1002653 | JGI24736J21556_10026532 | 171 |
| 6 | 3300001990 | JGI24737J22298_10007572 | JGI24737J22298_100075723 | 171 |
| 7 | 3300002067 | JGI24735J21928_10065272 | JGI24735J21928_100652722 | 171 |
| 8 | 3300005327 | Ga0070658_10582695 | Ga0070658_105826951 | 171 |
| 9 | 3300005577 | Ga0068857_100223307 | Ga0068857_1002233071 | 171 |
| 10 | 3300013100 | Ga0157373_10016499 | Ga0157373_100164996 | 171 |
| 11 | 3300013102 | Ga0157371_10019750 | Ga0157371_100197501 | 171 |
| 12 | 3300025261 | Ga0209233_1015761 | Ga0209233_10157612 | 171 |
| 13 | 3300025904 | Ga0207647_10000877 | Ga0207647_100008778 | 171 |
| 14 | 3300026116 | Ga0207674_10230428 | Ga0207674_102304282 | 171 |
| 15 | 3300005366 | Ga0070659_100098602 | Ga0070659_1000986023 | 172 |
| 16 | 3300025932 | Ga0207690_10089645 | Ga0207690_100896452 | 172 |
| 17 | 3300031911 | Ga0307412_10039535 | Ga0307412_100395355 | 173 |
| 18 | iso_pu_bacteria | 2902048731 | 2902050857 | 175 |
| 19 | iso_pu_bacteria | 2852627209 | 2852632276 | 177 |
| 20 | iso_pu_bacteria | 2585427687 | 2586207955 | 178 |
| 21 | iso_pu_bacteria | 2738541302 | 2738856500 | 178 |
| 22 | iso_pu_bacteria | 2738543023 | 2739302900 | 178 |
| 23 | iso_pu_bacteria | 2739367651 | 2739587487 | 178 |
| 24 | iso_pu_bacteria | 2818991437 | 2819550374 | 178 |
| 25 | iso_pu_bacteria | 2842722452 | 2842726934 | 178 |
| 26 | iso_pu_bacteria | 2842909656 | 2842911783 | 178 |
| 27 | iso_pu_bacteria | 2849281842 | 2849286974 | 178 |
| 28 | iso_pu_bacteria | 2904445276 | 2904448782 | 178 |
| 29 | iso_pu_bacteria | 2919186247 | 2919191295 | 178 |
| 30 | iso_pu_bacteria | 2939664404 | 2939669574 | 178 |
| 31 | iso_pu_bacteria | 2945997725 | 2946002737 | 178 |
| 32 | iso_pu_bacteria | 2954016120 | 2954019612 | 178 |
| 33 | 3300005445 | Ga0070708_100552585 | Ga0070708_1005525852 | 179 |
| 34 | 3300028794 | Ga0307515_10011130 | Ga0307515_100111309 | 179 |
| 35 | 3300048918 | Ga0496115_0076913 | Ga0496115_0076913_2139_2678 | 179 |
| 36 | iso_pu_bacteria | 2599185184 | 2599479220 | 179 |
| 37 | iso_pu_bacteria | 2738541283 | 2738758497 | 179 |
| 38 | iso_pu_bacteria | 2738541284 | 2738764152 | 179 |
| 39 | iso_pu_bacteria | 2739367656 | 2739613844 | 179 |
| 40 | iso_pu_bacteria | 2775506987 | 2776611904 | 179 |
| 41 | iso_pu_bacteria | 2919437846 | 2919439272 | 179 |
| 42 | iso_pu_bacteria | 2928078545 | 2928082465 | 179 |
| 43 | iso_pu_bacteria | 2928147474 | 2928148947 | 179 |
| 44 | iso_pu_bacteria | 2932082852 | 2932087480 | 179 |
| 45 | 3300009093 | Ga0105240_10104434 | Ga0105240_101044342 | 180 |
| 46 | 3300009545 | Ga0105237_10011183 | Ga0105237_1001118312 | 180 |
| 47 | 3300010375 | Ga0105239_10080322 | Ga0105239_100803222 | 180 |
| 48 | 3300013296 | Ga0157374_10011079 | Ga0157374_100110791 | 180 |
| 49 | 3300025233 | Ga0209437_100230 | Ga0209437_10023077 | 180 |
| 50 | 3300025258 | Ga0209129_1008682 | Ga0209129_10086825 | 180 |
| 51 | 3300025913 | Ga0207695_11329914 | Ga0207695_113299141 | 180 |
| 52 | 3300025914 | Ga0207671_10004296 | Ga0207671_1000429612 | 180 |
| 53 | 3300025914 | Ga0207671_10254980 | Ga0207671_102549802 | 180 |
| 54 | 3300025949 | Ga0207667_10070746 | Ga0207667_100707463 | 180 |
| 55 | 3300025981 | Ga0207640_10486164 | Ga0207640_104861642 | 180 |
| 56 | 3300045049 | Ga0466959_0087713 | Ga0466959_0087713_1294_1839 | 180 |
| 57 | 3300005288 | Ga0065714_10002768 | Ga0065714_1000276811 | 181 |
| 58 | 3300009545 | Ga0105237_10008137 | Ga0105237_100081377 | 181 |
| 59 | 3300013104 | Ga0157370_10002387 | Ga0157370_1000238719 | 181 |
| 60 | 3300013306 | Ga0163162_10860728 | Ga0163162_108607282 | 181 |
| 61 | 3300015261 | Ga0182006_1002188 | Ga0182006_10021886 | 181 |
| 62 | 3300017792 | Ga0163161_10001359 | Ga0163161_100013593 | 181 |
| 63 | 3300025914 | Ga0207671_10016211 | Ga0207671_100162117 | 181 |
| 64 | 3300048925 | Ga0496122_0000395 | Ga0496122_0000395_5479_6024 | 181 |
| 65 | 3300048926 | Ga0496123_0001650 | Ga0496123_0001650_25049_25594 | 181 |
| 66 | 3300003316 | rootH1_10008251 | rootH1_100082513 | 182 |
| 67 | 3300003323 | rootH1_10049485 | rootH1_100494856 | 182 |
| 68 | 3300003791 | Ga0055530_10021622 | Ga0055530_100216222 | 182 |
| 69 | 3300005288 | Ga0065714_10065465 | Ga0065714_100654653 | 182 |
| 70 | 3300005288 | Ga0065714_10068717 | Ga0065714_100687174 | 182 |
| 71 | 3300005288 | Ga0065714_10110816 | Ga0065714_101108162 | 182 |
| 72 | 3300005289 | Ga0065704_10136293 | Ga0065704_101362932 | 182 |
| 73 | 3300005328 | Ga0070676_10006129 | Ga0070676_100061293 | 182 |
| 74 | 3300005334 | Ga0068869_100083125 | Ga0068869_1000831252 | 182 |
| 75 | 3300005338 | Ga0068868_100091886 | Ga0068868_1000918861 | 182 |
| 76 | 3300005339 | Ga0070660_100442124 | Ga0070660_1004421241 | 182 |
| 77 | 3300005364 | Ga0070673_100026931 | Ga0070673_1000269313 | 182 |
| 78 | 3300005455 | Ga0070663_100566623 | Ga0070663_1005666231 | 182 |
| 79 | 3300005456 | Ga0070678_100036473 | Ga0070678_1000364732 | 182 |
| 80 | 3300005459 | Ga0068867_100045812 | Ga0068867_1000458121 | 182 |
| 81 | 3300005539 | Ga0068853_100097212 | Ga0068853_1000972122 | 182 |
| 82 | 3300005548 | Ga0070665_100000061 | Ga0070665_10000006117 | 182 |
| 83 | 3300005563 | Ga0068855_100058495 | Ga0068855_1000584955 | 182 |
| 84 | 3300005614 | Ga0068856_100009668 | Ga0068856_1000096685 | 182 |
| 85 | 3300005616 | Ga0068852_100006565 | Ga0068852_1000065656 | 182 |
| 86 | 3300005840 | Ga0068870_10307875 | Ga0068870_103078752 | 182 |
| 87 | 3300005841 | Ga0068863_100354990 | Ga0068863_1003549902 | 182 |
| 88 | 3300006195 | Ga0075366_10003659 | Ga0075366_100036592 | 182 |
| 89 | 3300006195 | Ga0075366_10019486 | Ga0075366_100194864 | 182 |
| 90 | 3300006237 | Ga0097621_100012648 | Ga0097621_1000126482 | 182 |
| 91 | 3300006358 | Ga0068871_100000622 | Ga0068871_1000006228 | 182 |
| 92 | 3300006881 | Ga0068865_100005448 | Ga0068865_1000054483 | 182 |
| 93 | 3300009093 | Ga0105240_10009940 | Ga0105240_1000994010 | 182 |
| 94 | 3300009174 | Ga0105241_10236353 | Ga0105241_102363532 | 182 |
| 95 | 3300009545 | Ga0105237_10000465 | Ga0105237_1000046525 | 182 |
| 96 | 3300010375 | Ga0105239_10137247 | Ga0105239_101372474 | 182 |
| 97 | 3300013100 | Ga0157373_10026352 | Ga0157373_100263522 | 182 |
| 98 | 3300013102 | Ga0157371_10001554 | Ga0157371_1000155416 | 182 |
| 99 | 3300013102 | Ga0157371_10024083 | Ga0157371_100240832 | 182 |
| 100 | 3300013102 | Ga0157371_10411645 | Ga0157371_104116452 | 182 |
| 101 | 3300013102 | Ga0157371_10724591 | Ga0157371_107245911 | 182 |
| 102 | 3300013104 | Ga0157370_10006383 | Ga0157370_100063834 | 182 |
| 103 | 3300013104 | Ga0157370_10091224 | Ga0157370_100912242 | 182 |
| 104 | 3300013104 | Ga0157370_10256147 | Ga0157370_102561472 | 182 |
| 105 | 3300013105 | Ga0157369_10001625 | Ga0157369_1000162512 | 182 |
| 106 | 3300013105 | Ga0157369_10796883 | Ga0157369_107968832 | 182 |
| 107 | 3300013306 | Ga0163162_10000087 | Ga0163162_1000008715 | 182 |
| 108 | 3300013306 | Ga0163162_10000586 | Ga0163162_1000058627 | 182 |
| 109 | 3300013306 | Ga0163162_10009602 | Ga0163162_100096027 | 182 |
| 110 | 3300013307 | Ga0157372_10001459 | Ga0157372_1000145911 | 182 |
| 111 | 3300014497 | Ga0182008_10000165 | Ga0182008_1000016511 | 182 |
| 112 | 3300015261 | Ga0182006_1000247 | Ga0182006_100024746 | 182 |
| 113 | 3300015262 | Ga0182007_10000016 | Ga0182007_10000016176 | 182 |
| 114 | 3300015682 | Ga0183373_1011 | Ga0183373_1011139 | 182 |
| 115 | 3300017792 | Ga0163161_10002630 | Ga0163161_100026305 | 182 |
| 116 | 3300017792 | Ga0163161_10033811 | Ga0163161_100338112 | 182 |
| 117 | 3300017792 | Ga0163161_10202794 | Ga0163161_102027942 | 182 |
| 118 | 3300025250 | Ga0209026_1016798 | Ga0209026_10167982 | 182 |
| 119 | 3300025292 | Ga0209676_1000106 | Ga0209676_100010610 | 182 |
| 120 | 3300025298 | Ga0209050_1000174 | Ga0209050_1000174147 | 182 |
| 121 | 3300025907 | Ga0207645_10001026 | Ga0207645_1000102619 | 182 |
| 122 | 3300025908 | Ga0207643_10309668 | Ga0207643_103096682 | 182 |
| 123 | 3300025909 | Ga0207705_10000088 | Ga0207705_1000008814 | 182 |
| 124 | 3300025911 | Ga0207654_10015759 | Ga0207654_100157595 | 182 |
| 125 | 3300025913 | Ga0207695_10013534 | Ga0207695_100135347 | 182 |
| 126 | 3300025914 | Ga0207671_10000316 | Ga0207671_100003168 | 182 |
| 127 | 3300025914 | Ga0207671_10004914 | Ga0207671_1000491411 | 182 |
| 128 | 3300025914 | Ga0207671_10034653 | Ga0207671_100346531 | 182 |
| 129 | 3300025934 | Ga0207686_10034309 | Ga0207686_100343093 | 182 |
| 130 | 3300025938 | Ga0207704_10000028 | Ga0207704_1000002817 | 182 |
| 131 | 3300025942 | Ga0207689_10262160 | Ga0207689_102621602 | 182 |
| 132 | 3300025949 | Ga0207667_10000408 | Ga0207667_1000040840 | 182 |
| 133 | 3300025949 | Ga0207667_10047965 | Ga0207667_100479655 | 182 |
| 134 | 3300025960 | Ga0207651_10019554 | Ga0207651_100195545 | 182 |
| 135 | 3300026023 | Ga0207677_10064725 | Ga0207677_100647252 | 182 |
| 136 | 3300026041 | Ga0207639_10015982 | Ga0207639_100159824 | 182 |
| 137 | 3300026041 | Ga0207639_10099791 | Ga0207639_100997913 | 182 |
| 138 | 3300026067 | Ga0207678_10753717 | Ga0207678_107537172 | 182 |
| 139 | 3300026078 | Ga0207702_10008805 | Ga0207702_100088054 | 182 |
| 140 | 3300026089 | Ga0207648_10000968 | Ga0207648_100009686 | 182 |
| 141 | 3300026116 | Ga0207674_10242114 | Ga0207674_102421141 | 182 |
| 142 | 3300026121 | Ga0207683_10033022 | Ga0207683_100330226 | 182 |
| 143 | 3300026142 | Ga0207698_10006109 | Ga0207698_100061094 | 182 |
| 144 | 3300028379 | Ga0268266_10000053 | Ga0268266_10000053183 | 182 |
| 145 | 3300028794 | Ga0307515_10000676 | Ga0307515_1000067623 | 182 |
| 146 | 3300028794 | Ga0307515_10004899 | Ga0307515_1000489915 | 182 |
| 147 | 3300031730 | Ga0307516_10620375 | Ga0307516_106203752 | 182 |
| 148 | 3300031731 | Ga0307405_10000023 | Ga0307405_1000002311 | 182 |
| 149 | 3300031903 | Ga0307407_10000057 | Ga0307407_1000005710 | 182 |
| 150 | 3300031911 | Ga0307412_10371523 | Ga0307412_103715232 | 182 |
| 151 | 3300032002 | Ga0307416_100000112 | Ga0307416_10000011244 | 182 |
| 152 | 3300032004 | Ga0307414_10004590 | Ga0307414_100045903 | 182 |
| 153 | 3300033179 | Ga0307507_10005214 | Ga0307507_1000521415 | 182 |
| 154 | 3300035115 | Ga0373941_0042804 | Ga0373941_0042804_86_640 | 182 |
| 155 | 3300037312 | Ga0395899_0002538 | Ga0395899_0002538_12622_13176 | 182 |
| 156 | 3300037312 | Ga0395899_0059268 | Ga0395899_0059268_244_798 | 182 |
| 157 | 3300037418 | Ga0395900_0000431 | Ga0395900_0000431_46996_47550 | 182 |
| 158 | 3300037418 | Ga0395900_0021872 | Ga0395900_0021872_5752_6306 | 182 |
| 159 | 3300037418 | Ga0395900_0564070 | Ga0395900_0564070_493_1041 | 182 |
| 160 | 3300037466 | Ga0395898_0100025 | Ga0395898_0100025_167_721 | 182 |
| 161 | 3300037471 | Ga0395905_0001156 | Ga0395905_0001156_31768_32322 | 182 |
| 162 | 3300037471 | Ga0395905_0001183 | Ga0395905_0001183_31558_32112 | 182 |
| 163 | 3300037471 | Ga0395905_0001649 | Ga0395905_0001649_13206_13760 | 182 |
| 164 | 3300038443 | Ga0395901_0001158 | Ga0395901_0001158_13027_13581 | 182 |
| 165 | 3300038443 | Ga0395901_0001199 | Ga0395901_0001199_18060_18614 | 182 |
| 166 | 3300046460 | Ga0495638_0141177 | Ga0495638_0141177_735_1286 | 182 |
| 167 | 3300046471 | Ga0495650_0000023 | Ga0495650_0000023_408607_409158 | 182 |
| 168 | 3300046506 | Ga0495583_0082289 | Ga0495583_0082289_127_678 | 182 |
| 169 | 3300046506 | Ga0495583_0102710 | Ga0495583_0102710_122_670 | 182 |
| 170 | 3300046507 | Ga0495606_0000448 | Ga0495606_0000448_15055_15606 | 182 |
| 171 | 3300046507 | Ga0495606_0008544 | Ga0495606_0008544_1428_1979 | 182 |
| 172 | 3300046507 | Ga0495606_0075762 | Ga0495606_0075762_576_1127 | 182 |
| 173 | 3300046512 | Ga0495610_0001315 | Ga0495610_0001315_2176_2724 | 182 |
| 174 | 3300046512 | Ga0495610_0001664 | Ga0495610_0001664_9907_10458 | 182 |
| 175 | 3300046513 | Ga0495616_0001269 | Ga0495616_0001269_7889_8440 | 182 |
| 176 | 3300046513 | Ga0495616_0017732 | Ga0495616_0017732_2420_2971 | 182 |
| 177 | 3300046520 | Ga0495637_0035396 | Ga0495637_0035396_415_966 | 182 |
| 178 | 3300046524 | Ga0495648_0089138 | Ga0495648_0089138_77_628 | 182 |
| 179 | 3300046529 | Ga0495652_0111385 | Ga0495652_0111385_1208_1759 | 182 |
| 180 | 3300046529 | Ga0495652_0587372 | Ga0495652_0587372_175_726 | 182 |
| 181 | 3300046538 | Ga0495609_0010562 | Ga0495609_0010562_383_934 | 182 |
| 182 | 3300046558 | Ga0495633_0000082 | Ga0495633_0000082_11854_12405 | 182 |
| 183 | 3300046558 | Ga0495633_0005199 | Ga0495633_0005199_2895_3446 | 182 |
| 184 | 3300046660 | Ga0495625_0000018 | Ga0495625_0000018_133950_134501 | 182 |
| 185 | 3300046660 | Ga0495625_0085430 | Ga0495625_0085430_750_1301 | 182 |
| 186 | 3300046660 | Ga0495625_0109892 | Ga0495625_0109892_1071_1622 | 182 |
| 187 | 3300046665 | Ga0495661_0001731 | Ga0495661_0001731_10943_11494 | 182 |
| 188 | 3300046691 | Ga0495670_0129126 | Ga0495670_0129126_141_689 | 182 |
| 189 | 3300046692 | Ga0495671_0354368 | Ga0495671_0354368_80_631 | 182 |
| 190 | 3300046694 | Ga0495649_0000015 | Ga0495649_0000015_62451_63002 | 182 |
| 191 | 3300046810 | Ga0495660_0191477 | Ga0495660_0191477_101_652 | 182 |
| 192 | 3300047443 | Ga0495687_001855 | Ga0495687_001855_2392_2940 | 182 |
| 193 | 3300047472 | Ga0495686_0000585 | Ga0495686_0000585_18043_18594 | 182 |
| 194 | 3300047472 | Ga0495686_0038016 | Ga0495686_0038016_395_946 | 182 |
| 195 | 3300048089 | Ga0495614_0043550 | Ga0495614_0043550_102_737 | 182 |
| 196 | 3300049459 | Ga0495678_016844 | Ga0495678_016844_1806_2357 | 182 |
| 197 | 3300049459 | Ga0495678_136494 | Ga0495678_136494_165_716 | 182 |
| 198 | 3300049679 | Ga0501249_022563 | Ga0501249_022563_196_744 | 182 |
| 199 | 3300050493 | nmdc:mga0k408_7788_c1 | nmdc:mga0k408_7788_c1_238_789 | 182 |
| 200 | 3300053125 | Ga0500618_000027 | Ga0500618_000027_8633_9184 | 182 |
| 201 | 3300053125 | Ga0500618_006941 | Ga0500618_006941_2036_2587 | 182 |
| 202 | 3300053134 | Ga0500658_0275052 | Ga0500658_0275052_182_733 | 182 |
| 203 | 2162886007 | SwRhRL2b_contig_3132777 | SwRhRL2b_0443.00002220 | 183 |
| 204 | 3300002773 | JGI25152J39213_1000737 | JGI25152J39213_100073715 | 183 |
| 205 | 3300002774 | JGI25150J39212_1000360 | JGI25150J39212_100036015 | 183 |
| 206 | 3300003187 | JGI25151J46595_10000947 | JGI25151J46595_1000094715 | 183 |
| 207 | 3300003215 | JGI25153J46596_10000587 | JGI25153J46596_1000058715 | 183 |
| 208 | 3300005288 | Ga0065714_10106642 | Ga0065714_101066421 | 183 |
| 209 | 3300005289 | Ga0065704_10000234 | Ga0065704_1000023477 | 183 |
| 210 | 3300005329 | Ga0070683_100797281 | Ga0070683_1007972812 | 183 |
| 211 | 3300005455 | Ga0070663_100212530 | Ga0070663_1002125302 | 183 |
| 212 | 3300005563 | Ga0068855_100000141 | Ga0068855_10000014127 | 183 |
| 213 | 3300005614 | Ga0068856_100187529 | Ga0068856_1001875292 | 183 |
| 214 | 3300009545 | Ga0105237_11072395 | Ga0105237_110723952 | 183 |
| 215 | 3300013100 | Ga0157373_10003855 | Ga0157373_100038559 | 183 |
| 216 | 3300013102 | Ga0157371_10026092 | Ga0157371_100260925 | 183 |
| 217 | 3300013102 | Ga0157371_10032953 | Ga0157371_100329534 | 183 |
| 218 | 3300013102 | Ga0157371_10279513 | Ga0157371_102795132 | 183 |
| 219 | 3300013104 | Ga0157370_10027867 | Ga0157370_100278672 | 183 |
| 220 | 3300013104 | Ga0157370_10043632 | Ga0157370_100436322 | 183 |
| 221 | 3300013105 | Ga0157369_10207936 | Ga0157369_102079362 | 183 |
| 222 | 3300013307 | Ga0157372_10000048 | Ga0157372_1000004812 | 183 |
| 223 | 3300014497 | Ga0182008_10000021 | Ga0182008_10000021189 | 183 |
| 224 | 3300015261 | Ga0182006_1002453 | Ga0182006_10024532 | 183 |
| 225 | 3300015261 | Ga0182006_1002563 | Ga0182006_10025634 | 183 |
| 226 | 3300015261 | Ga0182006_1006618 | Ga0182006_10066183 | 183 |
| 227 | 3300015262 | Ga0182007_10008201 | Ga0182007_100082012 | 183 |
| 228 | 3300025914 | Ga0207671_10950723 | Ga0207671_109507231 | 183 |
| 229 | 3300025949 | Ga0207667_10000030 | Ga0207667_1000003050 | 183 |
| 230 | 3300026067 | Ga0207678_10024089 | Ga0207678_100240891 | 183 |
| 231 | 3300026078 | Ga0207702_10168524 | Ga0207702_101685242 | 183 |
| 232 | 3300031911 | Ga0307412_10000149 | Ga0307412_100001499 | 183 |
| 233 | 3300032004 | Ga0307414_10004544 | Ga0307414_100045442 | 183 |
| 234 | 3300032004 | Ga0307414_10007707 | Ga0307414_100077072 | 183 |
| 235 | 3300032004 | Ga0307414_10018130 | Ga0307414_100181303 | 183 |
| 236 | 3300037312 | Ga0395899_0000453 | Ga0395899_0000453_9351_9902 | 183 |
| 237 | 3300046500 | Ga0495596_0078261 | Ga0495596_0078261_454_1005 | 183 |
| 238 | 3300053093 | Ga0500651_0000552 | Ga0500651_0000552_519_1070 | 183 |
| 239 | 3300053122 | Ga0500608_001018 | Ga0500608_001018_3601_4152 | 183 |
| 240 | 3300053139 | Ga0500568_0025782 | Ga0500568_0025782_624_1175 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2w4e-assembly1.cif.gz_A | structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans | 0.9586 | 44 | 180 |
| 5c8l-assembly1.cif.gz_B | crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase | 0.9458 | 5 | 180 |
| 5c7q-assembly1.cif.gz_B | crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase | 0.9214 | 5 | 183 |
| 2w4e-assembly1.cif.gz_B | structure of an n-terminally truncated nudix hydrolase dr2204 from deinococcus radiodurans | 0.9199 | 44 | 180 |
| 5c8l-assembly1.cif.gz_B | crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase | 0.9155 | 5 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5c8lB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9458 | 5 | 180 | 3.90.79.10 |
| af_Q2FY72_1_175_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9325 | 1 | 181 | 3.90.79.10 |
| af_Q2FY72_1_175_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9224 | 1 | 181 | 3.90.79.10 |
| 2w4eB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9199 | 44 | 180 | 3.90.79.10 |
| 5c8lB00 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9155 | 5 | 180 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520DV30-F1-model_v4 | NUDIX hydrolase | 0.9838 | 34 | 178 |
GO:0006753
GO:0016462 GO:0019693 |
| AF-A0A3D1RFN7-F1-model_v4 | DNA mismatch repair protein MutT | 0.9789 | 35 | 180 |
GO:0005829
GO:0006753 GO:0016462 GO:0019693 |
| AF-A0A1G7N4S4-F1-model_v4 | NUDIX domain-containing protein | 0.9769 | 5 | 182 |
GO:0005829
GO:0006753 GO:0016787 GO:0019693 |
| AF-A0A396PX41-F1-model_v4 | NUDIX hydrolase | 0.9729 | 5 | 180 |
GO:0005829
GO:0006753 GO:0016787 GO:0019693 |
| AF-K2EQJ0-F1-model_v4 | NUDIX hydrolase | 0.9725 | 4 | 183 |
GO:0005829
GO:0006753 GO:0016787 GO:0019693 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar