F352475

General Info

Members Datasets Scaffolds Average Seq Length
240 158 202 151

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1046867|Ga0006562J51391_10468675
Length 169
Sequence VNDAETDVPGLRRPDSLEDMSELRVVELSASTIVAVNNMSLKPGQEQYLAPTSYAVAGAVVNPATAWQRVVMDGDEVVGFVSANFDQEAPQEHFRSVLWRINVDADDQGRGVGRFAVKQLLEEARARGMDHVNVIYEAGDGGPEAFFRRVGFTPVDETEFGEVVAEIRL

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221566 Microbacterium sp. Root166 Isolate Unclassified
6 2643221575 Microbacterium sp. Root61 Isolate Unclassified
7 2643221597 Microbacterium sp. Root180 Isolate Unclassified
8 2643221630 Microbacterium sp. Root322 Isolate Unclassified
9 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
10 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
11 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
12 2773857759 Microbacterium sp. 1294 Isolate Unclassified
13 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
14 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
15 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
16 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
17 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
18 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
19 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
20 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
21 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
22 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
23 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
24 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
25 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
26 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
27 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
28 2919395869 Microbacterium resistens 2980 Isolate Unclassified
29 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
30 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
31 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
32 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
33 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
34 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
35 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
36 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
92 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
93 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
94 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
95 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
96 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
97 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
98 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
99 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
100 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
101 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
153 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
158 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.33
Metatranscriptomes 0.83
Isolates 15.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 8.75
Nodule 0
Rhizoplane 12.5
Rhizosphere 47.92
Stem 0
Stem Tuber 0
Unclassified 30.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001258 3300002738 Bacteria 9494
2 Ga0006562J51391_1046867 3300003578 Bacteria 10812
3 Ga0006562J51391_1046868 3300003578 Bacteria 3710
4 Ga0070676_10621375 3300005328 Bacteria 781
5 Ga0070668_100200526 3300005347 Bacteria 1638
6 Ga0070668_100674608 3300005347 Bacteria 910
7 Ga0070675_100260481 3300005354 Bacteria 1520
8 Ga0070667_102109290 3300005367 Bacteria 531
9 Ga0070663_100989253 3300005455 Bacteria 731
10 Ga0070678_100539105 3300005456 Bacteria 1034
11 Ga0070685_10299165 3300005466 Bacteria 1084
12 Ga0070672_100286744 3300005543 Bacteria 1393
13 Ga0070665_101925270 3300005548 Bacteria 597
14 Ga0068862_102192796 3300005844 Bacteria 564
15 Ga0075365_10021597 3300006038 Bacteria 4018
16 Ga0075364_10043005 3300006051 Bacteria 2936
17 Ga0075364_10114037 3300006051 Bacteria 1806
18 Ga0075364_10140305 3300006051 Bacteria 1625
19 Ga0075364_10169094 3300006051 Bacteria 1477
20 Ga0075369_10053481 3300006186 Bacteria 1752
21 Ga0075369_10057871 3300006186 Bacteria 1687
22 Ga0075369_10159465 3300006186 Bacteria 1034
23 Ga0105244_10007722 3300009036 Bacteria 6810
24 Ga0105244_10054776 3300009036 Bacteria 2023
25 Ga0105244_10062618 3300009036 Bacteria 1870
26 Ga0105243_10040846 3300009148 Bacteria 3625
27 Ga0105243_11517398 3300009148 Bacteria 694
28 Ga0105237_10187178 3300009545 Bacteria 2070
29 Ga0105246_10350505 3300011119 Bacteria 1209
30 Ga0105246_11068003 3300011119 Bacteria 735
31 Ga0157370_10635823 3300013104 Bacteria 976
32 Ga0157369_10001265 3300013105 Bacteria 31382
33 Ga0157369_10117893 3300013105 Bacteria 2818
34 Ga0157369_10450988 3300013105 Bacteria 1332
35 Ga0157369_11313708 3300013105 Bacteria 737
36 Ga0157369_11413943 3300013105 Bacteria 708
37 Ga0171462_1001 3300013250 Bacteria 1135406
38 Ga0163162_10045371 3300013306 Bacteria 4403
39 Ga0157372_10083989 3300013307 Bacteria 3608
40 Ga0157372_10604573 3300013307 Bacteria 1278
41 Ga0157375_10567412 3300013308 Bacteria 1296
42 Ga0157375_10912053 3300013308 Bacteria 1022
43 Ga0157375_10995036 3300013308 Bacteria 978
44 Ga0157380_10184510 3300014326 Bacteria 1836
45 Ga0157380_10543212 3300014326 Bacteria 1138
46 Ga0157380_12582052 3300014326 Bacteria 574
47 Ga0163161_10261839 3300017792 Bacteria 1351
48 Ga0163161_11080936 3300017792 Bacteria 689
49 Ga0209646_1000088 3300025246 Bacteria 192345
50 Ga0207655_1003365 3300025728 Bacteria 11959
51 Ga0207655_1010640 3300025728 Bacteria 5563
52 Ga0207643_10038119 3300025908 Bacteria 2699
53 Ga0207671_10215569 3300025914 Bacteria 1503
54 Ga0207681_10208796 3300025923 Bacteria 1504
55 Ga0207650_10695524 3300025925 Bacteria 859
56 Ga0207659_10204141 3300025926 Bacteria 1580
57 Ga0207709_10009724 3300025935 Bacteria 5298
58 Ga0207709_10146628 3300025935 Bacteria 1629
59 Ga0207679_11086418 3300025945 Bacteria 734
60 Ga0207668_10127511 3300025972 Bacteria 1938
61 Ga0207678_10640740 3300026067 Bacteria 933
62 Ga0207674_10610947 3300026116 Bacteria 1053
63 Ga0207675_100162562 3300026118 Bacteria 2130
64 Ga0268266_11560668 3300028379 Bacteria 636
65 Ga0268265_10529775 3300028380 Bacteria 1115
66 Ga0307405_10816043 3300031731 Bacteria 783
67 Ga0307413_10290865 3300031824 Bacteria 1234
68 Ga0307406_10000236 3300031901 Bacteria 33679
69 Ga0307406_10001187 3300031901 Bacteria 14572
70 Ga0307406_10550224 3300031901 Bacteria 944
71 Ga0307406_10768746 3300031901 Bacteria 810
72 Ga0307407_10211461 3300031903 Bacteria 1306
73 Ga0307407_10253156 3300031903 Bacteria 1208
74 Ga0307409_100985666 3300031995 Bacteria 860
75 Ga0307416_100079070 3300032002 Bacteria 2770
76 Ga0307416_100469050 3300032002 Bacteria 1316
77 Ga0307416_101315055 3300032002 Bacteria 829
78 Ga0307414_10009743 3300032004 Bacteria 5537
79 Ga0307414_10204723 3300032004 Bacteria 1608
80 Ga0307414_10225277 3300032004 Bacteria 1542
81 Ga0307411_12337921 3300032005 Bacteria 502
82 Ga0307415_100060661 3300032126 Bacteria 2615
83 Ga0307415_101411668 3300032126 Bacteria 663
84 Ga0395900_1372440 3300037418 Bacteria 620
85 Ga0395898_0048467 3300037466 Bacteria 4166
86 Ga0439465_0218439 3300041413 Bacteria 698
87 Ga0451787_494352 3300041441 Bacteria 552
88 Ga0451789_0246473 3300041443 Bacteria 717
89 Ga0451789_0465687 3300041443 Bacteria 792
90 Ga0451789_0473018 3300041443 Bacteria 1188
91 Ga0451791_0067593 3300041451 Bacteria 618
92 Ga0451791_1848196 3300041451 Bacteria 844
93 Ga0451797_1148698 3300041453 Bacteria 869
94 Ga0451797_1296484 3300041453 Bacteria 520
95 Ga0451795_1017570 3300041456 Bacteria 625
96 Ga0451800_1221940 3300041459 Bacteria 649
97 Ga0451802_0162066 3300041460 Bacteria 802
98 Ga0451841_0545606 3300041498 Bacteria 1183
99 Ga0451847_0542939 3300041503 Bacteria 759
100 Ga0451849_0528576 3300041505 Bacteria 662
101 Ga0451851_0728912 3300041507 Bacteria 670
102 Ga0451853_0816220 3300041512 Bacteria 1641
103 Ga0451853_1415703 3300041512 Bacteria 712
104 Ga0451853_2830687 3300041512 Bacteria 772
105 Ga0451853_3587237 3300041512 Bacteria 715
106 Ga0466965_0220777 3300044683 Bacteria 1010
107 Ga0466968_0571720 3300044735 Bacteria 569
108 Ga0466970_0000030 3300044765 Bacteria 51701
109 Ga0466970_0064891 3300044765 Bacteria 1959
110 Ga0466960_0020597 3300044901 Bacteria 2923
111 Ga0466960_0063360 3300044901 Bacteria 1820
112 Ga0466960_0118520 3300044901 Bacteria 1384
113 Ga0466967_0392336 3300045976 Bacteria 1349
114 Ga0495627_000309 3300046453 Bacteria 48100
115 Ga0495650_0146276 3300046471 Bacteria 852
116 Ga0495664_0681455 3300046477 Bacteria 608
117 Ga0495620_0101403 3300046515 Bacteria 1147
118 Ga0495632_0273797 3300046519 Bacteria 753
119 Ga0495656_0078904 3300046615 Bacteria 1481
120 Ga0495649_0642867 3300046694 Bacteria 522
121 Ga0495686_0087499 3300047472 Bacteria 1895
122 Ga0495615_0241064 3300048090 Bacteria 570
123 Ga0496100_0025376 3300048903 Bacteria 3624
124 Ga0496101_0023868 3300048904 Bacteria 4228
125 Ga0496102_0214206 3300048905 Bacteria 1816
126 Ga0496103_0125627 3300048906 Bacteria 1636
127 Ga0496105_0101934 3300048908 Bacteria 2370
128 Ga0496107_0044642 3300048910 Bacteria 3186
129 Ga0496108_0043044 3300048911 Bacteria 3771
130 Ga0496108_0774216 3300048911 Bacteria 829
131 Ga0496109_0045199 3300048912 Bacteria 3995
132 Ga0496109_0240628 3300048912 Bacteria 1703
133 Ga0496109_0912644 3300048912 Bacteria 816
134 Ga0496110_0234125 3300048913 Bacteria 1671
135 Ga0496111_0389344 3300048914 Bacteria 1030
136 Ga0496112_0152895 3300048915 Bacteria 2275
137 Ga0496113_0025096 3300048916 Bacteria 4245
138 Ga0496113_0084358 3300048916 Bacteria 2439
139 Ga0496114_0022408 3300048917 Bacteria 5148
140 Ga0496114_0073098 3300048917 Bacteria 2885
141 Ga0496115_0066020 3300048918 Bacteria 2923
142 Ga0496116_0053795 3300048919 Bacteria 2656
143 Ga0496117_0000273 3300048920 Bacteria 96400
144 Ga0496117_0038099 3300048920 Bacteria 3571
145 Ga0496117_0041282 3300048920 Bacteria 3383
146 Ga0496118_0007108 3300048921 Bacteria 12015
147 Ga0496118_0011550 3300048921 Bacteria 8605
148 Ga0496118_0039824 3300048921 Bacteria 3744
149 Ga0496118_0059244 3300048921 Bacteria 2853
150 Ga0496118_0163199 3300048921 Bacteria 1374
151 Ga0496119_0004255 3300048922 Bacteria 14347
152 Ga0496119_0016250 3300048922 Bacteria 5679
153 Ga0496120_0002844 3300048923 Bacteria 16672
154 Ga0496121_0178536 3300048924 Bacteria 1535
155 Ga0496121_0249644 3300048924 Bacteria 1231
156 Ga0496122_0000020 3300048925 Bacteria 401675
157 Ga0496122_0002005 3300048925 Bacteria 30302
158 Ga0496122_0012394 3300048925 Bacteria 8498
159 Ga0496122_0015950 3300048925 Bacteria 7147
160 Ga0496122_0059301 3300048925 Bacteria 2825
161 Ga0496122_0083723 3300048925 Bacteria 2210
162 Ga0496123_0000003 3300048926 Bacteria 866556
163 Ga0496123_0000009 3300048926 Bacteria 509486
164 Ga0496123_0047906 3300048926 Bacteria 2882
165 Ga0496123_0135670 3300048926 Bacteria 1355
166 Ga0496124_0007818 3300048927 Bacteria 11290
167 Ga0496124_0098041 3300048927 Bacteria 2379
168 Ga0496124_0278672 3300048927 Bacteria 1220
169 Ga0496124_0333695 3300048927 Bacteria 1080
170 Ga0496125_0000209 3300048928 Bacteria 122267
171 Ga0496125_0002324 3300048928 Bacteria 25043
172 Ga0496125_0003916 3300048928 Bacteria 17564
173 Ga0496125_0049163 3300048928 Bacteria 3507
174 Ga0496125_0059398 3300048928 Bacteria 3081
175 Ga0496125_0105730 3300048928 Bacteria 2056
176 Ga0496125_0182136 3300048928 Bacteria 1398
177 Ga0496126_0043860 3300048929 Bacteria 4122
178 Ga0496126_0047627 3300048929 Bacteria 3924
179 Ga0501034_0000672 3300049571 Bacteria 51948
180 Ga0501034_0755484 3300049571 Bacteria 868
181 Ga0501038_0029778 3300049574 Bacteria 4835
182 Ga0501038_0041134 3300049574 Bacteria 4031
183 Ga0501038_0385578 3300049574 Bacteria 1086
184 Ga0501039_0048839 3300049575 Bacteria 3271
185 Ga0501043_0635621 3300049579 Bacteria 785
186 Ga0501070_0000305 3300049586 Bacteria 45485
187 Ga0501070_1098774 3300049586 Bacteria 613
188 Ga0501035_0391921 3300049822 Bacteria 1157
189 nmdc:mga03n38_111072_c2 3300050490 Bacteria 894
190 nmdc:mga00v17_103753_c2 3300050491 Bacteria 1439
191 nmdc:mga00v17_152130_c1 3300050491 Bacteria 1487
192 nmdc:mga00v17_268548_c1 3300050491 Bacteria 1107
193 nmdc:mga00v17_447434_c1 3300050491 Bacteria 839
194 nmdc:mga0yw44_539951_c1 3300050492 Bacteria 792
195 nmdc:mga04h51_450434_c1 3300050495 Bacteria 544
196 nmdc:mga04h51_457366_c1 3300050495 Bacteria 541
197 nmdc:mga0sz30_149062_c1 3300050516 Bacteria 1034
198 nmdc:mga0sz30_85151_c1 3300050516 Bacteria 1371
199 Ga0500562_148329 3300053108 Bacteria 639
200 Ga0500616_0198986 3300053153 Bacteria 889
201 Ga0500645_105970 3300053730 Bacteria 791
202 Ga0501082_1038566 3300060353 Bacteria 717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0198986 Ga0500616_0198986_17_427 136
2 3300006051 Ga0075364_10169094 Ga0075364_101690942 139
3 iso_pu_bacteria 2643221575 2643888316 141
4 3300037466 Ga0395898_0048467 Ga0395898_0048467_599_1030 143
5 3300041512 Ga0451853_1415703 Ga0451853_1415703_237_671 144
6 3300046519 Ga0495632_0273797 Ga0495632_0273797_284_718 144
7 3300048925 Ga0496122_0002005 Ga0496122_0002005_27397_27834 145
8 3300048926 Ga0496123_0000009 Ga0496123_0000009_506584_507021 145
9 3300048927 Ga0496124_0007818 Ga0496124_0007818_8392_8829 145
10 3300048928 Ga0496125_0049163 Ga0496125_0049163_791_1228 145
11 3300048929 Ga0496126_0047627 Ga0496126_0047627_1314_1751 145
12 iso_pu_bacteria 2643221546 2643753825 145
13 iso_pu_bacteria 2585428157 2588106879 146
14 iso_pu_bacteria 2643221566 2643848800 146
15 iso_pu_bacteria 2643221597 2643994960 146
16 iso_pu_bacteria 2773857759 2774383501 146
17 iso_pu_bacteria 2808606306 2808628622 146
18 iso_pu_bacteria 2808606368 2808884865 146
19 iso_pu_bacteria 2811994872 2812322245 146
20 iso_pu_bacteria 2821268502 2821269198 146
21 iso_pu_bacteria 2833709550 2833710097 146
22 iso_pu_bacteria 2852632344 2852632891 146
23 iso_pu_bacteria 2857720070 2857722297 146
24 iso_pu_bacteria 2857729791 2857730588 146
25 iso_pu_bacteria 2870628048 2870629571 146
26 iso_pu_bacteria 2906799679 2906801582 146
27 iso_pu_bacteria 2928090899 2928091050 146
28 iso_pu_bacteria 2928121344 2928121392 146
29 iso_pu_bacteria 2977251589 2977251997 146
30 iso_pu_bacteria 2984580707 2984582200 146
31 iso_pu_bacteria 8045830549 8045832478 146
32 3300041498 Ga0451841_0545606 Ga0451841_0545606_595_1038 147
33 3300048929 Ga0496126_0043860 Ga0496126_0043860_2178_2621 147
34 3300025923 Ga0207681_10208796 Ga0207681_102087963 148
35 iso_pu_bacteria 2643221542 2643734908 148
36 iso_pu_bacteria 2643221630 2644173068 148
37 iso_pu_bacteria 2852646457 2852646581 148
38 iso_pu_bacteria 2852663356 2852665784 148
39 iso_pu_bacteria 2857723135 2857724731 148
40 iso_pu_bacteria 2919395869 2919398546 148
41 iso_pu_bacteria 2945968032 2945970955 148
42 iso_pu_bacteria 2946033335 2946034639 148
43 iso_pu_bacteria 2946041624 2946043259 148
44 iso_pu_bacteria 2946080515 2946081752 148
45 iso_pu_bacteria 8004182704 8004183626 148
46 3300003578 Ga0006562J51391_1046867 Ga0006562J51391_10468675 150
47 3300003578 Ga0006562J51391_1046868 Ga0006562J51391_10468682 150
48 3300005328 Ga0070676_10621375 Ga0070676_106213751 150
49 3300005347 Ga0070668_100200526 Ga0070668_1002005262 150
50 3300005347 Ga0070668_100674608 Ga0070668_1006746081 150
51 3300005354 Ga0070675_100260481 Ga0070675_1002604811 150
52 3300005455 Ga0070663_100989253 Ga0070663_1009892531 150
53 3300005456 Ga0070678_100539105 Ga0070678_1005391052 150
54 3300005466 Ga0070685_10299165 Ga0070685_102991652 150
55 3300005543 Ga0070672_100286744 Ga0070672_1002867442 150
56 3300005548 Ga0070665_101925270 Ga0070665_1019252701 150
57 3300005844 Ga0068862_102192796 Ga0068862_1021927961 150
58 3300006038 Ga0075365_10021597 Ga0075365_100215972 150
59 3300006051 Ga0075364_10043005 Ga0075364_100430051 150
60 3300006051 Ga0075364_10114037 Ga0075364_101140372 150
61 3300006186 Ga0075369_10053481 Ga0075369_100534812 150
62 3300006186 Ga0075369_10057871 Ga0075369_100578712 150
63 3300009036 Ga0105244_10007722 Ga0105244_100077226 150
64 3300009036 Ga0105244_10054776 Ga0105244_100547763 150
65 3300009036 Ga0105244_10062618 Ga0105244_100626183 150
66 3300009148 Ga0105243_10040846 Ga0105243_100408462 150
67 3300009148 Ga0105243_11517398 Ga0105243_115173981 150
68 3300009545 Ga0105237_10187178 Ga0105237_101871782 150
69 3300011119 Ga0105246_10350505 Ga0105246_103505052 150
70 3300011119 Ga0105246_11068003 Ga0105246_110680031 150
71 3300013105 Ga0157369_10001265 Ga0157369_1000126525 150
72 3300013105 Ga0157369_10117893 Ga0157369_101178933 150
73 3300013105 Ga0157369_11313708 Ga0157369_113137081 150
74 3300013105 Ga0157369_11413943 Ga0157369_114139431 150
75 3300013250 Ga0171462_1001 Ga0171462_1001495 150
76 3300013306 Ga0163162_10045371 Ga0163162_100453713 150
77 3300013307 Ga0157372_10083989 Ga0157372_100839892 150
78 3300013307 Ga0157372_10604573 Ga0157372_106045732 150
79 3300013308 Ga0157375_10567412 Ga0157375_105674121 150
80 3300013308 Ga0157375_10912053 Ga0157375_109120531 150
81 3300013308 Ga0157375_10995036 Ga0157375_109950362 150
82 3300014326 Ga0157380_10184510 Ga0157380_101845103 150
83 3300014326 Ga0157380_10543212 Ga0157380_105432122 150
84 3300014326 Ga0157380_12582052 Ga0157380_125820521 150
85 3300017792 Ga0163161_10261839 Ga0163161_102618392 150
86 3300017792 Ga0163161_11080936 Ga0163161_110809362 150
87 3300025728 Ga0207655_1003365 Ga0207655_10033656 150
88 3300025728 Ga0207655_1010640 Ga0207655_10106401 150
89 3300025908 Ga0207643_10038119 Ga0207643_100381192 150
90 3300025914 Ga0207671_10215569 Ga0207671_102155691 150
91 3300025925 Ga0207650_10695524 Ga0207650_106955241 150
92 3300025926 Ga0207659_10204141 Ga0207659_102041412 150
93 3300025935 Ga0207709_10009724 Ga0207709_100097243 150
94 3300025935 Ga0207709_10146628 Ga0207709_101466282 150
95 3300025945 Ga0207679_11086418 Ga0207679_110864181 150
96 3300025972 Ga0207668_10127511 Ga0207668_101275113 150
97 3300026067 Ga0207678_10640740 Ga0207678_106407402 150
98 3300026116 Ga0207674_10610947 Ga0207674_106109472 150
99 3300026118 Ga0207675_100162562 Ga0207675_1001625623 150
100 3300028379 Ga0268266_11560668 Ga0268266_115606681 150
101 3300028380 Ga0268265_10529775 Ga0268265_105297751 150
102 3300031901 Ga0307406_10000236 Ga0307406_1000023610 150
103 3300031901 Ga0307406_10768746 Ga0307406_107687461 150
104 3300031903 Ga0307407_10211461 Ga0307407_102114611 150
105 3300031903 Ga0307407_10253156 Ga0307407_102531561 150
106 3300031995 Ga0307409_100985666 Ga0307409_1009856661 150
107 3300032002 Ga0307416_100079070 Ga0307416_1000790702 150
108 3300032002 Ga0307416_100469050 Ga0307416_1004690502 150
109 3300032002 Ga0307416_101315055 Ga0307416_1013150552 150
110 3300032126 Ga0307415_100060661 Ga0307415_1000606612 150
111 3300032126 Ga0307415_101411668 Ga0307415_1014116681 150
112 3300037418 Ga0395900_1372440 Ga0395900_1372440_90_542 150
113 3300041413 Ga0439465_0218439 Ga0439465_0218439_177_629 150
114 3300041443 Ga0451789_0465687 Ga0451789_0465687_163_615 150
115 3300041443 Ga0451789_0473018 Ga0451789_0473018_236_688 150
116 3300041451 Ga0451791_0067593 Ga0451791_0067593_111_563 150
117 3300041453 Ga0451797_1148698 Ga0451797_1148698_230_682 150
118 3300041453 Ga0451797_1296484 Ga0451797_1296484_15_467 150
119 3300041456 Ga0451795_1017570 Ga0451795_1017570_155_607 150
120 3300041459 Ga0451800_1221940 Ga0451800_1221940_21_473 150
121 3300041460 Ga0451802_0162066 Ga0451802_0162066_257_709 150
122 3300041503 Ga0451847_0542939 Ga0451847_0542939_241_693 150
123 3300041507 Ga0451851_0728912 Ga0451851_0728912_29_481 150
124 3300041512 Ga0451853_0816220 Ga0451853_0816220_605_1057 150
125 3300041512 Ga0451853_2830687 Ga0451853_2830687_116_568 150
126 3300041512 Ga0451853_3587237 Ga0451853_3587237_210_662 150
127 3300044735 Ga0466968_0571720 Ga0466968_0571720_62_550 150
128 3300044765 Ga0466970_0000030 Ga0466970_0000030_767_1219 150
129 3300044901 Ga0466960_0020597 Ga0466960_0020597_1629_2117 150
130 3300044901 Ga0466960_0118520 Ga0466960_0118520_39_491 150
131 3300045976 Ga0466967_0392336 Ga0466967_0392336_348_800 150
132 3300046471 Ga0495650_0146276 Ga0495650_0146276_263_715 150
133 3300046477 Ga0495664_0681455 Ga0495664_0681455_64_516 150
134 3300046515 Ga0495620_0101403 Ga0495620_0101403_48_500 150
135 3300046615 Ga0495656_0078904 Ga0495656_0078904_946_1398 150
136 3300046694 Ga0495649_0642867 Ga0495649_0642867_49_501 150
137 3300047472 Ga0495686_0087499 Ga0495686_0087499_679_1131 150
138 3300048090 Ga0495615_0241064 Ga0495615_0241064_33_485 150
139 3300048903 Ga0496100_0025376 Ga0496100_0025376_1986_2438 150
140 3300048904 Ga0496101_0023868 Ga0496101_0023868_1386_1838 150
141 3300048905 Ga0496102_0214206 Ga0496102_0214206_475_927 150
142 3300048906 Ga0496103_0125627 Ga0496103_0125627_348_800 150
143 3300048908 Ga0496105_0101934 Ga0496105_0101934_1037_1489 150
144 3300048910 Ga0496107_0044642 Ga0496107_0044642_317_769 150
145 3300048911 Ga0496108_0043044 Ga0496108_0043044_2829_3281 150
146 3300048911 Ga0496108_0774216 Ga0496108_0774216_132_584 150
147 3300048912 Ga0496109_0045199 Ga0496109_0045199_2186_2638 150
148 3300048912 Ga0496109_0240628 Ga0496109_0240628_1196_1648 150
149 3300048912 Ga0496109_0912644 Ga0496109_0912644_300_752 150
150 3300048913 Ga0496110_0234125 Ga0496110_0234125_221_673 150
151 3300048914 Ga0496111_0389344 Ga0496111_0389344_537_989 150
152 3300048915 Ga0496112_0152895 Ga0496112_0152895_1260_1712 150
153 3300048916 Ga0496113_0025096 Ga0496113_0025096_1081_1533 150
154 3300048916 Ga0496113_0084358 Ga0496113_0084358_1777_2229 150
155 3300048917 Ga0496114_0022408 Ga0496114_0022408_364_816 150
156 3300048917 Ga0496114_0073098 Ga0496114_0073098_22_474 150
157 3300048918 Ga0496115_0066020 Ga0496115_0066020_1655_2107 150
158 3300048919 Ga0496116_0053795 Ga0496116_0053795_815_1267 150
159 3300048920 Ga0496117_0038099 Ga0496117_0038099_285_737 150
160 3300048920 Ga0496117_0041282 Ga0496117_0041282_524_976 150
161 3300048921 Ga0496118_0007108 Ga0496118_0007108_9122_9574 150
162 3300048921 Ga0496118_0039824 Ga0496118_0039824_2050_2502 150
163 3300048921 Ga0496118_0059244 Ga0496118_0059244_2282_2734 150
164 3300048921 Ga0496118_0163199 Ga0496118_0163199_176_628 150
165 3300048922 Ga0496119_0004255 Ga0496119_0004255_1296_1748 150
166 3300048922 Ga0496119_0016250 Ga0496119_0016250_145_597 150
167 3300048923 Ga0496120_0002844 Ga0496120_0002844_12752_13204 150
168 3300048924 Ga0496121_0249644 Ga0496121_0249644_522_974 150
169 3300048925 Ga0496122_0000020 Ga0496122_0000020_209786_210238 150
170 3300048925 Ga0496122_0059301 Ga0496122_0059301_821_1273 150
171 3300048926 Ga0496123_0000003 Ga0496123_0000003_424910_425362 150
172 3300048926 Ga0496123_0047906 Ga0496123_0047906_1031_1483 150
173 3300048927 Ga0496124_0098041 Ga0496124_0098041_217_669 150
174 3300048927 Ga0496124_0278672 Ga0496124_0278672_485_937 150
175 3300048928 Ga0496125_0000209 Ga0496125_0000209_2396_2848 150
176 3300048928 Ga0496125_0003916 Ga0496125_0003916_9777_10229 150
177 3300048928 Ga0496125_0182136 Ga0496125_0182136_628_1080 150
178 3300049571 Ga0501034_0755484 Ga0501034_0755484_293_745 150
179 3300049574 Ga0501038_0385578 Ga0501038_0385578_389_841 150
180 3300049575 Ga0501039_0048839 Ga0501039_0048839_486_938 150
181 3300049579 Ga0501043_0635621 Ga0501043_0635621_91_579 150
182 3300049586 Ga0501070_0000305 Ga0501070_0000305_27691_28143 150
183 3300049586 Ga0501070_1098774 Ga0501070_1098774_91_579 150
184 3300050490 nmdc:mga03n38_111072_c2 nmdc:mga03n38_111072_c2_286_738 150
185 3300050491 nmdc:mga00v17_103753_c2 nmdc:mga00v17_103753_c2_33_485 150
186 3300050491 nmdc:mga00v17_268548_c1 nmdc:mga00v17_268548_c1_329_781 150
187 3300050492 nmdc:mga0yw44_539951_c1 nmdc:mga0yw44_539951_c1_43_495 150
188 3300050495 nmdc:mga04h51_450434_c1 nmdc:mga04h51_450434_c1_79_531 150
189 3300050495 nmdc:mga04h51_457366_c1 nmdc:mga04h51_457366_c1_14_466 150
190 3300050516 nmdc:mga0sz30_85151_c1 nmdc:mga0sz30_85151_c1_300_752 150
191 3300053108 Ga0500562_148329 Ga0500562_148329_79_531 150
192 3300053730 Ga0500645_105970 Ga0500645_105970_240_692 150
193 iso_pu_bacteria 2643221553 2643783481 150
194 iso_pu_bacteria 2643221724 2644679281 150
195 iso_pu_bacteria 2728369380 2730228800 150
196 iso_pu_bacteria 2747842429 2747953215 150
197 iso_pu_bacteria 2773857763 2774400435 150
198 iso_pu_bacteria 2808606447 2809226681 150
199 3300002738 JGI25154J39366_1001258 JGI25154J39366_10012583 152
200 3300005367 Ga0070667_102109290 Ga0070667_1021092901 152
201 3300006051 Ga0075364_10140305 Ga0075364_101403052 152
202 3300006186 Ga0075369_10159465 Ga0075369_101594652 152
203 3300013104 Ga0157370_10635823 Ga0157370_106358232 152
204 3300013105 Ga0157369_10450988 Ga0157369_104509882 152
205 3300025246 Ga0209646_1000088 Ga0209646_1000088164 152
206 3300031731 Ga0307405_10816043 Ga0307405_108160431 152
207 3300031824 Ga0307413_10290865 Ga0307413_102908652 152
208 3300031901 Ga0307406_10001187 Ga0307406_100011875 152
209 3300031901 Ga0307406_10550224 Ga0307406_105502242 152
210 3300032004 Ga0307414_10009743 Ga0307414_100097432 152
211 3300032004 Ga0307414_10204723 Ga0307414_102047231 152
212 3300032004 Ga0307414_10225277 Ga0307414_102252772 152
213 3300032005 Ga0307411_12337921 Ga0307411_123379211 152
214 3300041441 Ga0451787_494352 Ga0451787_494352_53_511 152
215 3300041443 Ga0451789_0246473 Ga0451789_0246473_171_629 152
216 3300041451 Ga0451791_1848196 Ga0451791_1848196_134_592 152
217 3300041505 Ga0451849_0528576 Ga0451849_0528576_122_580 152
218 3300044683 Ga0466965_0220777 Ga0466965_0220777_514_972 152
219 3300044765 Ga0466970_0064891 Ga0466970_0064891_475_933 152
220 3300044901 Ga0466960_0063360 Ga0466960_0063360_839_1297 152
221 3300046453 Ga0495627_000309 Ga0495627_000309_934_1392 152
222 3300048920 Ga0496117_0000273 Ga0496117_0000273_37177_37635 152
223 3300048921 Ga0496118_0011550 Ga0496118_0011550_5763_6221 152
224 3300048924 Ga0496121_0178536 Ga0496121_0178536_487_945 152
225 3300048925 Ga0496122_0012394 Ga0496122_0012394_825_1283 152
226 3300048925 Ga0496122_0015950 Ga0496122_0015950_607_1065 152
227 3300048925 Ga0496122_0083723 Ga0496122_0083723_598_1056 152
228 3300048926 Ga0496123_0135670 Ga0496123_0135670_217_675 152
229 3300048927 Ga0496124_0333695 Ga0496124_0333695_20_478 152
230 3300048928 Ga0496125_0002324 Ga0496125_0002324_6503_6961 152
231 3300048928 Ga0496125_0059398 Ga0496125_0059398_208_666 152
232 3300048928 Ga0496125_0105730 Ga0496125_0105730_1010_1468 152
233 3300049571 Ga0501034_0000672 Ga0501034_0000672_48907_49365 152
234 3300049574 Ga0501038_0029778 Ga0501038_0029778_731_1189 152
235 3300049574 Ga0501038_0041134 Ga0501038_0041134_2327_2785 152
236 3300049822 Ga0501035_0391921 Ga0501035_0391921_324_782 152
237 3300050491 nmdc:mga00v17_152130_c1 nmdc:mga00v17_152130_c1_824_1282 152
238 3300050491 nmdc:mga00v17_447434_c1 nmdc:mga00v17_447434_c1_270_728 152
239 3300050516 nmdc:mga0sz30_149062_c1 nmdc:mga0sz30_149062_c1_320_778 152
240 3300060353 Ga0501082_1038566 Ga0501082_1038566_118_576 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

33

152

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

63

154

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.8159 42 151
8j6v-assembly11.cif.gz_I structure of yeast arginyl-trna-protein transferase 1 0.8054 46 110
7tif-assembly1.cif.gz_A 2.85 angstroem crystal structure of arginyltransferase 1 (ate1) from saccharomyces cerevisiae 0.8032 46 110
8j6v-assembly7.cif.gz_H structure of yeast arginyl-trna-protein transferase 1 0.8026 47 106
7tif-assembly5.cif.gz_E 2.85 angstroem crystal structure of arginyltransferase 1 (ate1) from saccharomyces cerevisiae 0.8015 46 110
ID Description Score Start End Superfamily
1tiqB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.863 47 146 3.40.630.30
af_K7LQW1_676_805_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.838 45 137 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8265 43 138 3.40.630.30
af_A4IDI3_157_301_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8193 46 137 3.40.630.30
af_K7VFD8_74_198_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8079 54 152 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A399N875-F1-model_v4 GNAT family N-acetyltransferase 0.986 46 149 GO:0016747
AF-A0A542N042-F1-model_v4 Diamine N-acetyltransferase 0.9828 1 149 GO:0016747
AF-A0A4Y9FPW8-F1-model_v4 GNAT family N-acetyltransferase 0.9795 4 150 GO:0016747
AF-A0A7X6P414-F1-model_v4 GNAT family N-acetyltransferase 0.9758 41 150 GO:0016747
AF-A0A653VSX2-F1-model_v4 deleted 0.9757 1 152

Feature Viewer

pLDDT pTM Quality
87.53 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map