F352468

General Info

Members Datasets Scaffolds Average Seq Length
240 149 480 214

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10076113|rootH2_100761135
Length 221
Sequence MTTSALDDTRTDGDRSPRPNGEDDTLASGRAFTWLLLICGALGLVASFVITNDKFNLLQAKIDGRTIHLSCSLNPIISCGDVMESRQAHAFGFQNPIIGLVSYGVVICLAMGVFAGARYKPWFWYGLQAGGLFGVGFISWLQYQTIYNINAICLWCCLAWVVTILIFWYTAVHNIKHGLIKVPAKARSLVLEFHWVVPILWYGVIAMLILTHFWYYWKTVI

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
3 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
4 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
5 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
6 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
7 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
8 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
9 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
10 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
11 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
12 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
13 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
14 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
15 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
16 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
17 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
18 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
19 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
20 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
21 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
22 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
23 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
24 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
25 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
26 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
27 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
28 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
29 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
30 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
31 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
32 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
33 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
34 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
35 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
36 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
37 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
38 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
39 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
40 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
41 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
42 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
43 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
44 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
45 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
46 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
47 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
48 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
49 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
50 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
51 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
52 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
53 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
54 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
55 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
56 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
57 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
58 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
59 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
60 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
61 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
62 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
63 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
64 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
65 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
66 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
67 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
68 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
69 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
70 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
71 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
72 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
73 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
74 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
75 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
76 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
79 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
108 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
112 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
113 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
114 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
115 2643221548 Streptomyces sp. Root55 Isolate Unclassified
116 2643221578 Streptomyces sp. Root63 Isolate Unclassified
117 2643221670 Streptomyces sp. Root431 Isolate Unclassified
118 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
119 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
120 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
121 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
122 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
123 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
124 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
125 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
126 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
127 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
128 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
129 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
130 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
131 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
132 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
133 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
134 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
135 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
136 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
137 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
138 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
139 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
140 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
141 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
142 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
143 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
144 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
145 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
146 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
147 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
148 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
149 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.08
Metatranscriptomes 0
Isolates 17.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0.42
Rhizoplane 0.83
Rhizosphere 86.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10076113 3300003320 Bacteria 5990
2 Ga0070665_100713507 3300005548 Bacteria 1016
3 Ga0075363_100219970 3300006048 Bacteria 1088
4 Ga0307515_10170552 3300028794 Bacteria 2171
5 Ga0307511_10123372 3300030521 Bacteria 1591
6 Ga0307512_10041341 3300030522 Bacteria 3833
7 Ga0307512_10093578 3300030522 Bacteria 2079
8 Ga0307513_10207391 3300031456 Bacteria 1794
9 Ga0307514_10181183 3300031649 Bacteria 1357
10 Ga0307518_10009556 3300031838 Bacteria 6921
11 Ga0307518_10368892 3300031838 Bacteria 823
12 Ga0307407_10672904 3300031903 Bacteria 777
13 Ga0307416_100037730 3300032002 Bacteria 3722
14 Ga0451837_0695368 3300041494 Bacteria 3768
15 Ga0451853_0692840 3300041512 Bacteria 3654
16 Ga0451853_2174117 3300041512 Bacteria 1905
17 Ga0439457_002327 3300042014 Bacteria 5460
18 Ga0450894_000300 3300042131 Bacteria 8849
19 Ga0450894_001026 3300042131 Bacteria 4272
20 Ga0450898_003619 3300042134 Bacteria 2230
21 Ga0450899_001165 3300042135 Bacteria 2983
22 Ga0450900_039196 3300042136 Bacteria 705
23 Ga0450902_054057 3300042137 Bacteria 691
24 Ga0450906_000263 3300042145 Bacteria 10206
25 Ga0450906_006858 3300042145 Bacteria 2278
26 Ga0450908_033446 3300042184 Bacteria 891
27 Ga0466967_0785325 3300045976 Bacteria 945
28 Ga0495592_0011517 3300046454 Bacteria 6694
29 Ga0495592_0053800 3300046454 Bacteria 2984
30 Ga0495603_0000359 3300046455 Bacteria 24579
31 Ga0495603_0000408 3300046455 Bacteria 23714
32 Ga0495603_0000848 3300046455 Bacteria 17528
33 Ga0495603_0003357 3300046455 Bacteria 9525
34 Ga0495603_0024981 3300046455 Bacteria 3613
35 Ga0495603_0053853 3300046455 Bacteria 2386
36 Ga0495603_0078976 3300046455 Bacteria 1929
37 Ga0495629_0008502 3300046459 Bacteria 7558
38 Ga0495629_0009464 3300046459 Bacteria 7126
39 Ga0495629_0017751 3300046459 Bacteria 5100
40 Ga0495629_0017964 3300046459 Bacteria 5070
41 Ga0495629_0028073 3300046459 Bacteria 3996
42 Ga0495629_0078898 3300046459 Bacteria 2298
43 Ga0495629_0195330 3300046459 Bacteria 1400
44 Ga0495651_0029197 3300046462 Bacteria 4301
45 Ga0495651_0143667 3300046462 Bacteria 1727
46 Ga0495653_0371159 3300046463 Bacteria 916
47 Ga0495582_0027059 3300046473 Bacteria 3143
48 Ga0495582_0094031 3300046473 Bacteria 1673
49 Ga0495605_0016866 3300046474 Bacteria 3946
50 Ga0495605_0043172 3300046474 Bacteria 2236
51 Ga0495605_0044620 3300046474 Bacteria 2190
52 Ga0495639_0087586 3300046475 Bacteria 1457
53 Ga0495662_0005811 3300046476 Bacteria 6174
54 Ga0495662_0074439 3300046476 Bacteria 1648
55 Ga0495662_0150324 3300046476 Bacteria 1147
56 Ga0495662_0167273 3300046476 Bacteria 1083
57 Ga0495664_0145034 3300046477 Bacteria 1439
58 Ga0495585_0020277 3300046492 Bacteria 3824
59 Ga0495585_0039886 3300046492 Bacteria 2638
60 Ga0495585_0320566 3300046492 Bacteria 758
61 Ga0495594_0002303 3300046499 Bacteria 9936
62 Ga0495594_0006734 3300046499 Bacteria 5909
63 Ga0495594_0076860 3300046499 Bacteria 1862
64 Ga0495594_0131715 3300046499 Bacteria 1416
65 Ga0495616_0039614 3300046513 Bacteria 2412
66 Ga0495618_0013461 3300046514 Bacteria 4975
67 Ga0495620_0038219 3300046515 Bacteria 2131
68 Ga0495628_0011368 3300046516 Bacteria 7530
69 Ga0495632_0089415 3300046519 Bacteria 1462
70 Ga0495643_0184438 3300046522 Bacteria 1011
71 Ga0495648_0106434 3300046524 Bacteria 1535
72 Ga0495652_0014914 3300046529 Bacteria 6965
73 Ga0495652_0439491 3300046529 Bacteria 915
74 Ga0495654_0065638 3300046530 Bacteria 1732
75 Ga0495640_0033895 3300046533 Bacteria 3626
76 Ga0495640_0048023 3300046533 Bacteria 2952
77 Ga0495609_0046870 3300046538 Bacteria 1935
78 Ga0495597_0027749 3300046542 Bacteria 2594
79 Ga0495645_0160192 3300046543 Bacteria 1556
80 Ga0495622_0008457 3300046557 Bacteria 4764
81 Ga0495622_0026165 3300046557 Bacteria 2726
82 Ga0495622_0047328 3300046557 Bacteria 1998
83 Ga0495622_0091944 3300046557 Bacteria 1393
84 Ga0495667_0158893 3300046559 Bacteria 1454
85 Ga0495668_0003405 3300046616 Bacteria 11943
86 Ga0495634_0005215 3300046642 Bacteria 10041
87 Ga0495611_0003993 3300046648 Bacteria 6423
88 Ga0495625_0017856 3300046660 Bacteria 5545
89 Ga0495625_0054123 3300046660 Bacteria 2867
90 Ga0495625_0160525 3300046660 Bacteria 1506
91 Ga0495635_0150099 3300046663 Bacteria 1586
92 Ga0495661_0105721 3300046665 Bacteria 1576
93 Ga0495588_0001601 3300046674 Bacteria 9670
94 Ga0495657_0010442 3300046675 Bacteria 6987
95 Ga0495657_0014564 3300046675 Bacteria 5770
96 Ga0495657_0030026 3300046675 Bacteria 3809
97 Ga0495657_0122514 3300046675 Bacteria 1636
98 Ga0495599_0199329 3300046678 Bacteria 1230
99 Ga0495623_0049936 3300046679 Bacteria 2651
100 Ga0495613_0000407 3300046689 Bacteria 36936
101 Ga0495613_0007100 3300046689 Bacteria 8337
102 Ga0495613_0043225 3300046689 Bacteria 3333
103 Ga0495613_0066310 3300046689 Bacteria 2636
104 Ga0495624_0037372 3300046690 Bacteria 3125
105 Ga0495589_0001100 3300046794 Bacteria 16116
106 Ga0495589_0040163 3300046794 Bacteria 2337
107 Ga0495589_0084350 3300046794 Bacteria 1544
108 Ga0495600_0010824 3300046809 Bacteria 5672
109 Ga0495604_0006698 3300047317 Bacteria 9132
110 Ga0495604_0063059 3300047317 Bacteria 2828
111 Ga0495604_0071534 3300047317 Bacteria 2623
112 Ga0495604_0086824 3300047317 Bacteria 2331
113 Ga0495636_0010848 3300047318 Bacteria 3603
114 Ga0495636_0037385 3300047318 Bacteria 2005
115 Ga0495636_0083371 3300047318 Bacteria 1379
116 Ga0495636_0237771 3300047318 Bacteria 839
117 Ga0495674_0359157 3300047319 Bacteria 1181
118 Ga0495676_0016390 3300047321 Bacteria 6580
119 Ga0495676_0017744 3300047321 Bacteria 6286
120 Ga0495676_0027401 3300047321 Bacteria 4886
121 Ga0495676_0048025 3300047321 Bacteria 3445
122 Ga0495676_0114703 3300047321 Bacteria 1970
123 Ga0495676_0274637 3300047321 Bacteria 1142
124 Ga0495680_0006363 3300047322 Bacteria 10993
125 Ga0495675_0005386 3300047444 Bacteria 7796
126 Ga0495685_000979 3300047447 Bacteria 8658
127 Ga0495685_005297 3300047447 Bacteria 4205
128 Ga0495685_010294 3300047447 Bacteria 3134
129 Ga0495685_031694 3300047447 Bacteria 1816
130 Ga0495684_0192075 3300047471 Bacteria 1509
131 Ga0495686_0027753 3300047472 Bacteria 3693
132 Ga0495686_0415846 3300047472 Bacteria 719
133 Ga0495593_0127776 3300047673 Bacteria 1291
134 Ga0495602_0056907 3300048088 Bacteria 3435
135 Ga0495602_0637001 3300048088 Bacteria 729
136 Ga0495614_0000423 3300048089 Bacteria 17379
137 Ga0495614_0101070 3300048089 Bacteria 1260
138 Ga0495626_0034821 3300048091 Bacteria 2407
139 Ga0496106_0086981 3300048909 Bacteria 2408
140 Ga0496113_0102982 3300048916 Bacteria 2214
141 Ga0495682_0051700 3300049460 Bacteria 1494
142 Ga0501031_0012531 3300049568 Bacteria 5537
143 Ga0501031_0078258 3300049568 Bacteria 2154
144 Ga0501031_0136214 3300049568 Bacteria 1604
145 Ga0501032_0003244 3300049569 Bacteria 12505
146 Ga0501032_0006504 3300049569 Bacteria 8592
147 Ga0501032_0025668 3300049569 Bacteria 4061
148 Ga0501033_0036939 3300049570 Bacteria 3658
149 Ga0501033_0087344 3300049570 Bacteria 2282
150 Ga0501033_0091339 3300049570 Bacteria 2227
151 Ga0501034_0008192 3300049571 Bacteria 11080
152 Ga0501034_0020747 3300049571 Bacteria 6706
153 Ga0501036_0005315 3300049572 Bacteria 10419
154 Ga0501036_0006291 3300049572 Bacteria 9635
155 Ga0501037_0001737 3300049573 Bacteria 15810
156 Ga0501038_0008525 3300049574 Bacteria 9421
157 Ga0501038_0012669 3300049574 Bacteria 7707
158 Ga0501038_0083374 3300049574 Bacteria 2691
159 Ga0501039_0067164 3300049575 Bacteria 2784
160 Ga0501040_0006679 3300049576 Bacteria 7486
161 Ga0501041_0000555 3300049577 Bacteria 19316
162 Ga0501042_0028916 3300049578 Bacteria 3908
163 Ga0501043_0007646 3300049579 Bacteria 8563
164 Ga0501043_0030743 3300049579 Bacteria 4223
165 Ga0501043_0130751 3300049579 Bacteria 1967
166 Ga0501046_0008120 3300049580 Bacteria 9168
167 Ga0501047_0000248 3300049581 Bacteria 63961
168 Ga0501047_0004057 3300049581 Bacteria 13768
169 Ga0501047_0124635 3300049581 Bacteria 2457
170 Ga0501047_0254890 3300049581 Bacteria 1603
171 Ga0501048_0006297 3300049582 Bacteria 9025
172 Ga0501048_0403671 3300049582 Bacteria 977
173 Ga0501067_0010178 3300049583 Bacteria 5202
174 Ga0501068_0000984 3300049584 Bacteria 14966
175 Ga0501069_0007257 3300049585 Bacteria 5812
176 Ga0501070_0009151 3300049586 Bacteria 8376
177 Ga0501070_0395871 3300049586 Bacteria 1118
178 Ga0501071_0000025 3300049587 Bacteria 49332
179 Ga0501072_0000885 3300049588 Bacteria 21958
180 Ga0501074_0027066 3300049590 Bacteria 4155
181 Ga0501079_0177915 3300049741 Bacteria 1659
182 Ga0501080_0060640 3300049742 Bacteria 3521
183 Ga0501080_0350711 3300049742 Bacteria 1333
184 Ga0501083_0009670 3300049744 Bacteria 6809
185 Ga0501035_0000416 3300049822 Bacteria 48248
186 Ga0501035_0005317 3300049822 Bacteria 12177
187 Ga0501035_0100562 3300049822 Bacteria 2538
188 Ga0501035_0204027 3300049822 Bacteria 1694
189 Ga0501044_0001535 3300049823 Bacteria 27090
190 Ga0501044_0002165 3300049823 Bacteria 22526
191 Ga0501044_0249795 3300049823 Bacteria 1715
192 Ga0501044_0298781 3300049823 Bacteria 1539
193 Ga0501045_0005702 3300049824 Bacteria 8614
194 Ga0501045_0121444 3300049824 Bacteria 1940
195 Ga0500600_0106572 3300053149 Bacteria 1469
196 Ga0501084_0000601 3300054114 Bacteria 27402
197 Ga0501082_0004339 3300060353 Bacteria 12399
198 2554257094 2554235005 Bacteria 6457341
199 2554259545 2554235005 Bacteria 6457341
200 2585300392 2582581312 Bacteria 7308206
201 2616695620 2616644814 Bacteria 11555299
202 2616703271 2616644814 Bacteria 11555299
203 2616900825 2616644941 Bacteria 8510691
204 2643760214 2643221548 Bacteria 8053412
205 2643904488 2643221578 Bacteria 9213798
206 2644389099 2643221670 Bacteria 6497041
207 2644406244 2643221673 Bacteria 9196637
208 2644434355 2643221677 Bacteria 7584031
209 2644460090 2643221682 Bacteria 6743283
210 2785346790 2784746763 Bacteria 9783172
211 2804843732 2802429296 Bacteria 7227771
212 2808915784 2808606375 Bacteria 9466072
213 2819696367 2818991463 Bacteria 7948711
214 2862186249 2862178590 Bacteria 8583590
215 2862281760 2862281513 Bacteria 9621493
216 2862392084 2862382967 Bacteria 10317375
217 2863406973 2863404153 Bacteria 9672205
218 2863409151 2863404153 Bacteria 9672205
219 2867346834 2867346516 Bacteria 7608576
220 2875392692 2875391855 Bacteria 7600475
221 2912731169 2912723979 Bacteria 8557534
222 2912760581 2912757875 Bacteria 7940295
223 2918502520 2918501144 Bacteria 8668083
224 2935393570 2935390628 Bacteria 7043367
225 2946052022 2946045630 Bacteria 8527308
226 2954711811 2954711539 Bacteria 10867210
227 2954721728 2954721474 Bacteria 10456478
228 2954740094 2954731030 Bacteria 10243860
229 2954740640 2954740390 Bacteria 10229294
230 2954758922 2954749733 Bacteria 10366972
231 2954759650 2954759201 Bacteria 9358192
232 2966604417 2966598605 Bacteria 7676064
233 2990059577 2990059506 Bacteria 9321252
234 2990065845 2990059506 Bacteria 9321252
235 3006328013 3006321560 Bacteria 8247479
236 3006430673 3006425503 Bacteria 6491253
237 3006490443 3006486233 Bacteria 8157040
238 8025414813 8025413630 Bacteria 7014048
239 8025483843 8025478263 Bacteria 8209203
240 8048410607 8048406513 Bacteria 8936924
241 rootH2_10076113
242 Ga0070665_100713507
243 Ga0075363_100219970
244 Ga0307515_10170552
245 Ga0307511_10123372
246 Ga0307512_10041341
247 Ga0307512_10093578
248 Ga0307513_10207391
249 Ga0307514_10181183
250 Ga0307518_10009556
251 Ga0307518_10368892
252 Ga0307407_10672904
253 Ga0307416_100037730
254 Ga0451837_0695368
255 Ga0451853_0692840
256 Ga0451853_2174117
257 Ga0439457_002327
258 Ga0450894_000300
259 Ga0450894_001026
260 Ga0450898_003619
261 Ga0450899_001165
262 Ga0450900_039196
263 Ga0450902_054057
264 Ga0450906_000263
265 Ga0450906_006858
266 Ga0450908_033446
267 Ga0466967_0785325
268 Ga0495592_0011517
269 Ga0495592_0053800
270 Ga0495603_0000359
271 Ga0495603_0000408
272 Ga0495603_0000848
273 Ga0495603_0003357
274 Ga0495603_0024981
275 Ga0495603_0053853
276 Ga0495603_0078976
277 Ga0495629_0008502
278 Ga0495629_0009464
279 Ga0495629_0017751
280 Ga0495629_0017964
281 Ga0495629_0028073
282 Ga0495629_0078898
283 Ga0495629_0195330
284 Ga0495651_0029197
285 Ga0495651_0143667
286 Ga0495653_0371159
287 Ga0495582_0027059
288 Ga0495582_0094031
289 Ga0495605_0016866
290 Ga0495605_0043172
291 Ga0495605_0044620
292 Ga0495639_0087586
293 Ga0495662_0005811
294 Ga0495662_0074439
295 Ga0495662_0150324
296 Ga0495662_0167273
297 Ga0495664_0145034
298 Ga0495585_0020277
299 Ga0495585_0039886
300 Ga0495585_0320566
301 Ga0495594_0002303
302 Ga0495594_0006734
303 Ga0495594_0076860
304 Ga0495594_0131715
305 Ga0495616_0039614
306 Ga0495618_0013461
307 Ga0495620_0038219
308 Ga0495628_0011368
309 Ga0495632_0089415
310 Ga0495643_0184438
311 Ga0495648_0106434
312 Ga0495652_0014914
313 Ga0495652_0439491
314 Ga0495654_0065638
315 Ga0495640_0033895
316 Ga0495640_0048023
317 Ga0495609_0046870
318 Ga0495597_0027749
319 Ga0495645_0160192
320 Ga0495622_0008457
321 Ga0495622_0026165
322 Ga0495622_0047328
323 Ga0495622_0091944
324 Ga0495667_0158893
325 Ga0495668_0003405
326 Ga0495634_0005215
327 Ga0495611_0003993
328 Ga0495625_0017856
329 Ga0495625_0054123
330 Ga0495625_0160525
331 Ga0495635_0150099
332 Ga0495661_0105721
333 Ga0495588_0001601
334 Ga0495657_0010442
335 Ga0495657_0014564
336 Ga0495657_0030026
337 Ga0495657_0122514
338 Ga0495599_0199329
339 Ga0495623_0049936
340 Ga0495613_0000407
341 Ga0495613_0007100
342 Ga0495613_0043225
343 Ga0495613_0066310
344 Ga0495624_0037372
345 Ga0495589_0001100
346 Ga0495589_0040163
347 Ga0495589_0084350
348 Ga0495600_0010824
349 Ga0495604_0006698
350 Ga0495604_0063059
351 Ga0495604_0071534
352 Ga0495604_0086824
353 Ga0495636_0010848
354 Ga0495636_0037385
355 Ga0495636_0083371
356 Ga0495636_0237771
357 Ga0495674_0359157
358 Ga0495676_0016390
359 Ga0495676_0017744
360 Ga0495676_0027401
361 Ga0495676_0048025
362 Ga0495676_0114703
363 Ga0495676_0274637
364 Ga0495680_0006363
365 Ga0495675_0005386
366 Ga0495685_000979
367 Ga0495685_005297
368 Ga0495685_010294
369 Ga0495685_031694
370 Ga0495684_0192075
371 Ga0495686_0027753
372 Ga0495686_0415846
373 Ga0495593_0127776
374 Ga0495602_0056907
375 Ga0495602_0637001
376 Ga0495614_0000423
377 Ga0495614_0101070
378 Ga0495626_0034821
379 Ga0496106_0086981
380 Ga0496113_0102982
381 Ga0495682_0051700
382 Ga0501031_0012531
383 Ga0501031_0078258
384 Ga0501031_0136214
385 Ga0501032_0003244
386 Ga0501032_0006504
387 Ga0501032_0025668
388 Ga0501033_0036939
389 Ga0501033_0087344
390 Ga0501033_0091339
391 Ga0501034_0008192
392 Ga0501034_0020747
393 Ga0501036_0005315
394 Ga0501036_0006291
395 Ga0501037_0001737
396 Ga0501038_0008525
397 Ga0501038_0012669
398 Ga0501038_0083374
399 Ga0501039_0067164
400 Ga0501040_0006679
401 Ga0501041_0000555
402 Ga0501042_0028916
403 Ga0501043_0007646
404 Ga0501043_0030743
405 Ga0501043_0130751
406 Ga0501046_0008120
407 Ga0501047_0000248
408 Ga0501047_0004057
409 Ga0501047_0124635
410 Ga0501047_0254890
411 Ga0501048_0006297
412 Ga0501048_0403671
413 Ga0501067_0010178
414 Ga0501068_0000984
415 Ga0501069_0007257
416 Ga0501070_0009151
417 Ga0501070_0395871
418 Ga0501071_0000025
419 Ga0501072_0000885
420 Ga0501074_0027066
421 Ga0501079_0177915
422 Ga0501080_0060640
423 Ga0501080_0350711
424 Ga0501083_0009670
425 Ga0501035_0000416
426 Ga0501035_0005317
427 Ga0501035_0100562
428 Ga0501035_0204027
429 Ga0501044_0001535
430 Ga0501044_0002165
431 Ga0501044_0249795
432 Ga0501044_0298781
433 Ga0501045_0005702
434 Ga0501045_0121444
435 Ga0500600_0106572
436 Ga0501084_0000601
437 Ga0501082_0004339
438 2554257094
439 2554259545
440 2585300392
441 2616695620
442 2616703271
443 2616900825
444 2643760214
445 2643904488
446 2644389099
447 2644406244
448 2644434355
449 2644460090
450 2785346790
451 2804843732
452 2808915784
453 2819696367
454 2862186249
455 2862281760
456 2862392084
457 2863406973
458 2863409151
459 2867346834
460 2875392692
461 2912731169
462 2912760581
463 2918502520
464 2935393570
465 2946052022
466 2954711811
467 2954721728
468 2954740094
469 2954740640
470 2954758922
471 2954759650
472 2966604417
473 2990059577
474 2990065845
475 3006328013
476 3006430673
477 3006490443
478 8025414813
479 8025483843
480 8048410607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07884

VKOR

Vitamin K epoxide reductase family

34

171

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wv8-assembly1.cif.gz_A takifugu rubripes vkor-like c138s mutant with vitamin k1 0.7826 27 171
6wvh-assembly1.cif.gz_A human vkor with brodifacoum 0.7675 23 171
6wv5-assembly1.cif.gz_A human vkor c43s mutant with vitamin k1 epoxide 0.7357 34 171
6wvb-assembly1.cif.gz_A takifugu rubripes vkor-like with warfarin 0.7151 25 195
6wv4-assembly1.cif.gz_A human vkor c43s with warfarin 0.6891 25 171
ID Description Score Start End Superfamily
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.9401 26 171 1.20.1440.130
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8862 26 171 1.20.1440.130
af_A1ZAJ5_3_151_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.84 31 171 1.20.1440.130
af_Q9BQB6_5_161_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8055 34 171 1.20.1440.130
af_Q4DTS5_3_150_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.7882 33 184 1.20.1440.130
ID Description Score Start End GO Terms
AF-F3NQC1-F1-model_v4 Putative integral membrane protein 0.951 25 212 GO:0016020
GO:0016491
GO:0048038
AF-M3BBN8-F1-model_v4 Vitamin K epoxide reductase 0.9429 25 214 GO:0016020
GO:0016491
GO:0048038
AF-A0A7K2XC33-F1-model_v4 Vitamin K epoxide reductase domain-containing protein 0.9409 25 160 GO:0016020
GO:0016491
GO:0048038
AF-A0A5J6GJL9-F1-model_v4 Vitamin K epoxide reductase family protein 0.9402 25 212 GO:0016020
GO:0016491
GO:0048038
AF-A0A6V8LF71-F1-model_v4 Vitamin K epoxide reductase domain-containing protein 0.9401 28 183 GO:0016020
GO:0016491
GO:0048038

Map