F352352

General Info

Members Datasets Scaffolds Average Seq Length
239 171 237 267

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_34374_c1|nmdc:mga0n895_34374_c1_1962_2903
Length 313
Sequence LFFAFVGFYSAAAGFFYPSVKALLYGIVRRRSAGNIRNAFPNRGGTMQGKQLWALAFAGAMVATSALAQAPAEVTLTRLACGDGTNDPRRFSDAFAYTETTKPFTFSCYVIKHGNDYMVWDTGYLPGSVPNATNKPITELLSQIHVKPDQVKYVGISHFHADHTGQLAPFANATLLIGKGDWDGVNSNPPMGGANVTGFKDWAGRKVEPLTTDKDVFGDGTVMVLRSPGHTPGHSMLLVRLKEKGPVLLSGDAVHFHENYTSDGVPGFNFDRAQTIASIERMKQIEKNLKATVIIQHDPRDIGKLPAFPQAAK

Samples

Sample ID Description Type Environment
1 2831864461 Roseateles noduli HZ7 Isolate Nodule
2 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
50 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
104 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
105 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
106 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.72
Nodule 1.26
Rhizoplane 0.42
Rhizosphere 83.26
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10048340 3300003203 Unclassified 1443
2 rootH1_10014665 3300003316 Bacteria 15887
3 rootH2_10041674 3300003320 Bacteria 3754
4 rootL2_10000123 3300003322 Bacteria 51034
5 rootH1_10004509 3300003323 Bacteria 42491
6 rootH1_10006693 3300003323 Bacteria 10798
7 Ga0055526_1003290 3300003771 Bacteria 10360
8 Ga0055524_1000318 3300003775 Bacteria 45388
9 Ga0055524_1000652 3300003775 Bacteria 24532
10 Ga0055524_1016561 3300003775 Bacteria 2638
11 Ga0055531_10000936 3300003794 Bacteria 23539
12 Ga0055531_10001294 3300003794 Bacteria 18849
13 Ga0055543_1008306 3300004625 Bacteria 2309
14 Ga0065165_1000024 3300005262 Bacteria 247672
15 Ga0065715_10346795 3300005293 Bacteria 958
16 Ga0070677_10015069 3300005333 Bacteria 2734
17 Ga0070680_100436593 3300005336 Bacteria 1118
18 Ga0068868_100407705 3300005338 Bacteria 1174
19 Ga0070675_100364400 3300005354 Bacteria 1284
20 Ga0070688_100231305 3300005365 Bacteria 1308
21 Ga0070713_100000229 3300005436 Bacteria 37199
22 Ga0070713_100316577 3300005436 Bacteria 1440
23 Ga0070711_100183833 3300005439 Bacteria 1602
24 Ga0070705_100117395 3300005440 Bacteria 1712
25 Ga0070678_100017898 3300005456 Bacteria 4577
26 Ga0070662_100016058 3300005457 Bacteria 5023
27 Ga0070662_100105993 3300005457 Unclassified 2134
28 Ga0070681_10005421 3300005458 Bacteria 12324
29 Ga0068867_100344675 3300005459 Bacteria 1241
30 Ga0068867_100398776 3300005459 Bacteria 1160
31 Ga0070672_100136337 3300005543 Bacteria 2021
32 Ga0070696_100290509 3300005546 Bacteria 1249
33 Ga0070693_100005288 3300005547 Bacteria 6185
34 Ga0070704_100197359 3300005549 Bacteria 1622
35 Ga0070704_100436358 3300005549 Bacteria 1125
36 Ga0070664_100240504 3300005564 Unclassified 1625
37 Ga0068859_100010898 3300005617 Bacteria 9151
38 Ga0068859_100249610 3300005617 Bacteria 1865
39 Ga0081540_1011768 3300005983 Bacteria 5820
40 Ga0081539_10000521 3300005985 Bacteria 80101
41 Ga0081539_10172157 3300005985 Bacteria 1023
42 Ga0070717_10033085 3300006028 Bacteria 4169
43 Ga0070717_10276644 3300006028 Bacteria 1488
44 Ga0075368_10055268 3300006042 Bacteria 1583
45 Ga0075363_100001107 3300006048 Bacteria 9778
46 Ga0070716_100003215 3300006173 Bacteria 7662
47 Ga0075362_10002325 3300006177 Bacteria 6357
48 Ga0075369_10085837 3300006186 Bacteria 1400
49 Ga0097621_100069508 3300006237 Unclassified 2907
50 Ga0097621_100207136 3300006237 Bacteria 1704
51 Ga0097621_100357605 3300006237 Bacteria 1300
52 Ga0068871_100028491 3300006358 Unclassified 4378
53 Ga0075428_100011455 3300006844 Bacteria 9865
54 Ga0075428_100037148 3300006844 Bacteria 5363
55 Ga0075431_100159562 3300006847 Bacteria 2319
56 Ga0075431_100534861 3300006847 Bacteria 1160
57 Ga0075434_100044483 3300006871 Bacteria 4405
58 Ga0075434_100094762 3300006871 Bacteria 2990
59 Ga0075434_100111599 3300006871 Bacteria 2745
60 Ga0075429_100126684 3300006880 Bacteria 2233
61 Ga0068865_100029471 3300006881 Unclassified 3642
62 Ga0075436_100111835 3300006914 Bacteria 1907
63 Ga0097620_100010897 3300006931 Bacteria 9151
64 Ga0097620_100249621 3300006931 Bacteria 1865
65 Ga0099824_1037425 3300006942 Bacteria 1350
66 Ga0099823_1000154 3300006944 Bacteria 36546
67 Ga0111539_10084194 3300009094 Bacteria 3740
68 Ga0105245_10033630 3300009098 Bacteria 4545
69 Ga0114129_10622899 3300009147 Bacteria 1395
70 Ga0105242_10001782 3300009176 Bacteria 16996
71 Ga0105242_10069381 3300009176 Unclassified 2919
72 Ga0157319_1000004 3300012497 Bacteria 394735
73 Ga0157369_10040424 3300013105 Bacteria 5091
74 Ga0157374_10296555 3300013296 Bacteria 1599
75 Ga0163162_10058266 3300013306 Unclassified 3891
76 Ga0157372_10796843 3300013307 Bacteria 1098
77 Ga0157376_10018984 3300014969 Bacteria 5287
78 Ga0163161_10067414 3300017792 Unclassified 2614
79 Ga0209258_106701 3300025242 Bacteria 1776
80 Ga0209673_1009265 3300025273 Bacteria 4289
81 Ga0209564_1000005 3300025295 Bacteria 1147192
82 Ga0209050_1014808 3300025298 Bacteria 3329
83 Ga0209256_1000085 3300025299 Bacteria 219043
84 Ga0209256_1001091 3300025299 Bacteria 31214
85 Ga0209051_1007063 3300025303 Bacteria 6211
86 Ga0209257_1000612 3300025304 Bacteria 58171
87 Ga0209257_1001938 3300025304 Bacteria 22335
88 Ga0209257_1002827 3300025304 Bacteria 16303
89 Ga0207707_10135145 3300025912 Archaea 2156
90 Ga0207652_10434530 3300025921 Bacteria 1184
91 Ga0207687_10142574 3300025927 Bacteria 1819
92 Ga0207700_10725828 3300025928 Bacteria 887
93 Ga0207686_10048866 3300025934 Bacteria 2623
94 Ga0207686_10178811 3300025934 Bacteria 1503
95 Ga0207665_10006782 3300025939 Bacteria 7584
96 Ga0207691_10009067 3300025940 Bacteria 9547
97 Ga0207679_10107977 3300025945 Unclassified 2191
98 Ga0207678_10000937 3300026067 Bacteria 26583
99 Ga0207708_10135369 3300026075 Bacteria 1929
100 Ga0207648_10023365 3300026089 Bacteria 5539
101 Ga0207683_10002468 3300026121 Bacteria 16132
102 Ga0210000_1020349 3300027462 Bacteria 1013
103 Ga0209999_1004026 3300027543 Bacteria 2644
104 Ga0209971_1031317 3300027682 Bacteria 1275
105 Ga0209813_10102531 3300027866 Bacteria 975
106 Ga0307515_10000191 3300028794 Bacteria 149201
107 Ga0307513_10182244 3300031456 Bacteria 1962
108 Ga0307412_10272567 3300031911 Bacteria 1325
109 Ga0373926_0025830 3300035083 Bacteria 2052
110 Ga0373934_0000806 3300035086 Bacteria 11301
111 Ga0373934_0001296 3300035086 Bacteria 9110
112 Ga0373923_0027129 3300035111 Bacteria 2282
113 Ga0373953_0000802 3300035117 Bacteria 8777
114 Ga0373953_0003699 3300035117 Bacteria 4802
115 Ga0373954_0002640 3300035118 Bacteria 7545
116 Ga0373956_0000439 3300035119 Bacteria 16928
117 Ga0373957_0001856 3300035120 Bacteria 5855
118 Ga0373957_0002426 3300035120 Bacteria 5315
119 Ga0373943_0094122 3300035170 Bacteria 1556
120 Ga0373955_0000707 3300035172 Bacteria 14386
121 Ga0373927_0094261 3300035695 Unclassified 1945
122 Ga0373933_0001551 3300035724 Bacteria 13458
123 Ga0373933_0003165 3300035724 Bacteria 9196
124 Ga0373947_0055021 3300035725 Bacteria 2403
125 Ga0373937_0000405 3300036401 Bacteria 40196
126 Ga0373937_0000453 3300036401 Bacteria 37842
127 Ga0373937_0058544 3300036401 Bacteria 3540
128 Ga0436360_0746468 3300039438 Bacteria 870
129 Ga0451802_0649996 3300041460 Bacteria 969
130 Ga0450890_008481 3300042127 Bacteria 1315
131 Ga0439444_0000337 3300042437 Bacteria 4951
132 Ga0439459_0002461 3300042438 Bacteria 2856
133 Ga0439460_0006920 3300042461 Bacteria 2825
134 Ga0451576_0138836 3300045051 Bacteria 2535
135 Ga0451576_0150229 3300045051 Bacteria 2429
136 Ga0495592_0000919 3300046454 Bacteria 20403
137 Ga0495592_0015162 3300046454 Bacteria 5853
138 Ga0495629_0042444 3300046459 Unclassified 3196
139 Ga0495638_0178976 3300046460 Bacteria 1211
140 Ga0495638_0314842 3300046460 Bacteria 838
141 Ga0495641_0208662 3300046461 Bacteria 876
142 Ga0495651_0000582 3300046462 Bacteria 28355
143 Ga0495651_0171750 3300046462 Bacteria 1543
144 Ga0495653_0000157 3300046463 Bacteria 56338
145 Ga0495653_0042535 3300046463 Bacteria 3538
146 Ga0495662_0022550 3300046476 Bacteria 3040
147 Ga0495664_0165972 3300046477 Bacteria 1340
148 Ga0495594_0004022 3300046499 Bacteria 7560
149 Ga0495594_0038415 3300046499 Plasmid 2614
150 Ga0495608_0000401 3300046511 Bacteria 30323
151 Ga0495608_0006121 3300046511 Bacteria 8536
152 Ga0495610_0107546 3300046512 Bacteria 1240
153 Ga0495628_0000635 3300046516 Bacteria 32118
154 Ga0495628_0230460 3300046516 Bacteria 1389
155 Ga0495630_0004279 3300046517 Bacteria 10014
156 Ga0495630_0031089 3300046517 Bacteria 3974
157 Ga0495630_0058977 3300046517 Bacteria 2878
158 Ga0495630_0168466 3300046517 Bacteria 1668
159 Ga0495666_0060045 3300046526 Bacteria 1818
160 Ga0495652_0000971 3300046529 Bacteria 32778
161 Ga0495665_0017971 3300046531 Unclassified 3801
162 Ga0495640_0001911 3300046533 Bacteria 16609
163 Ga0495640_0047175 3300046533 Bacteria 2982
164 Ga0495640_0315081 3300046533 Bacteria 970
165 Ga0495586_0000811 3300046535 Bacteria 17980
166 Ga0495586_0011981 3300046535 Bacteria 4607
167 Ga0495586_0235801 3300046535 Bacteria 1042
168 Ga0495587_0000371 3300046536 Bacteria 31980
169 Ga0495587_0000848 3300046536 Bacteria 20213
170 Ga0495587_0070745 3300046536 Bacteria 2030
171 Ga0495645_0000133 3300046543 Bacteria 50579
172 Ga0495645_0001016 3300046543 Bacteria 19077
173 Ga0495645_0307892 3300046543 Bacteria 1033
174 Ga0495667_0000461 3300046559 Bacteria 26022
175 Ga0495667_0009054 3300046559 Bacteria 6766
176 Ga0495634_0015468 3300046642 Bacteria 5483
177 Ga0495635_0004943 3300046663 Bacteria 9280
178 Ga0495635_0030586 3300046663 Bacteria 3741
179 Ga0495657_0002107 3300046675 Bacteria 16908
180 Ga0495599_0000286 3300046678 Bacteria 30892
181 Ga0495599_0081727 3300046678 Bacteria 2018
182 Ga0495623_0002695 3300046679 Bacteria 11728
183 Ga0495646_0000137 3300046680 Bacteria 37174
184 Ga0495647_0045476 3300046681 Bacteria 1687
185 Ga0495658_0002831 3300046683 Bacteria 8716
186 Ga0495613_0016755 3300046689 Bacteria 5457
187 Ga0495613_0049412 3300046689 Bacteria 3104
188 Ga0495600_0000523 3300046809 Bacteria 19907
189 Ga0495600_0012292 3300046809 Bacteria 5349
190 Ga0495600_0111834 3300046809 Bacteria 1778
191 Ga0495604_0000464 3300047317 Bacteria 35933
192 Ga0495604_0013468 3300047317 Bacteria 6515
193 Ga0495674_0006154 3300047319 Bacteria 11525
194 Ga0495674_0115935 3300047319 Bacteria 2267
195 Ga0495674_0124033 3300047319 Bacteria 2180
196 Ga0495680_0000845 3300047322 Bacteria 33973
197 Ga0495680_0015043 3300047322 Bacteria 6683
198 Ga0495675_0001938 3300047444 Bacteria 12335
199 Ga0495675_0027980 3300047444 Bacteria 3593
200 Ga0495684_0000367 3300047471 Bacteria 36773
201 Ga0495684_0032883 3300047471 Unclassified 3984
202 Ga0495684_0284522 3300047471 Unclassified 1192
203 Ga0495602_0005284 3300048088 Bacteria 13546
204 Ga0496124_0039140 3300048927 Bacteria 4112
205 Ga0501038_0042709 3300049574 Bacteria 3948
206 Ga0501046_0008342 3300049580 Bacteria 9037
207 Ga0501048_0017526 3300049582 Bacteria 5274
208 Ga0501072_0616155 3300049588 Bacteria 855
209 Ga0501074_0105041 3300049590 Bacteria 2022
210 Ga0501081_0023956 3300049743 Bacteria 4095
211 Ga0501045_0120109 3300049824 Bacteria 1951
212 nmdc:mga03683_13991_c1 3300050489 Bacteria 2961
213 nmdc:mga03n38_7307_c1 3300050490 Bacteria 3903
214 nmdc:mga0yw44_189817_c1 3300050492 Bacteria 1355
215 nmdc:mga04h51_117809_c1 3300050495 Bacteria 986
216 nmdc:mga05p37_409052_c1 3300050507 Bacteria 1582
217 nmdc:mga09592_70457_c1 3300050508 Bacteria 2967
218 nmdc:mga06r32_140496_c1 3300050510 Bacteria 2391
219 nmdc:mga06r32_375662_c1 3300050510 Bacteria 1404
220 nmdc:mga08y16_104928_c1 3300050511 Bacteria 2942
221 nmdc:mga0n895_124197_c1 3300050512 Bacteria 2604
222 nmdc:mga0n895_34374_c1 3300050512 Bacteria 4879
223 nmdc:mga0rr50_167672_c1 3300050513 Bacteria 1787
224 nmdc:mga0rr50_236212_c1 3300050513 Bacteria 1514
225 nmdc:mga08x19_267716_c1 3300050514 Unclassified 1182
226 nmdc:mga08x19_27158_c1 3300050514 Bacteria 3578
227 nmdc:mga08x19_480904_c1 3300050514 Bacteria 876
228 nmdc:mga0a205_126982_c1 3300050515 Bacteria 2450
229 Ga0495601_0004013 3300053077 Bacteria 8479
230 Ga0495601_0013515 3300053077 Bacteria 4911
231 Ga0495612_0002317 3300053078 Bacteria 7842
232 Ga0495619_0002207 3300053085 Bacteria 12897
233 Ga0495619_0053412 3300053085 Bacteria 2673
234 Ga0500622_0002983 3300053156 Bacteria 11727
235 Ga0501084_0025020 3300054114 Bacteria 4982
236 Ga0590071_021248 3300059421 Bacteria 1530
237 Ga0501082_0009040 3300060353 Bacteria 8593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100016058 Ga0070662_1000160581 221
2 3300050489 nmdc:mga03683_13991_c1 nmdc:mga03683_13991_c1_380_1183 253
3 3300050490 nmdc:mga03n38_7307_c1 nmdc:mga03n38_7307_c1_595_1398 253
4 3300006942 Ga0099824_1037425 Ga0099824_10374252 255
5 3300006048 Ga0075363_100001107 Ga0075363_10000110711 257
6 3300006177 Ga0075362_10002325 Ga0075362_100023253 257
7 3300035086 Ga0373934_0001296 Ga0373934_0001296_5329_6102 257
8 3300035117 Ga0373953_0003699 Ga0373953_0003699_2266_3039 257
9 3300035120 Ga0373957_0002426 Ga0373957_0002426_4442_5215 257
10 3300035724 Ga0373933_0003165 Ga0373933_0003165_4074_4847 257
11 3300036401 Ga0373937_0000453 Ga0373937_0000453_34245_35018 257
12 3300046462 Ga0495651_0171750 Ga0495651_0171750_181_954 257
13 3300046516 Ga0495628_0230460 Ga0495628_0230460_509_1282 257
14 3300046517 Ga0495630_0168466 Ga0495630_0168466_686_1459 257
15 3300046536 Ga0495587_0000371 Ga0495587_0000371_23108_23881 257
16 3300046543 Ga0495645_0000133 Ga0495645_0000133_4927_5700 257
17 3300046559 Ga0495667_0009054 Ga0495667_0009054_3918_4691 257
18 3300046678 Ga0495599_0081727 Ga0495599_0081727_437_1210 257
19 3300046809 Ga0495600_0111834 Ga0495600_0111834_285_1058 257
20 3300047319 Ga0495674_0124033 Ga0495674_0124033_185_958 257
21 3300047444 Ga0495675_0027980 Ga0495675_0027980_2117_2890 257
22 3300047471 Ga0495684_0032883 Ga0495684_0032883_384_1157 257
23 3300050492 nmdc:mga0yw44_189817_c1 nmdc:mga0yw44_189817_c1_488_1291 257
24 3300050495 nmdc:mga04h51_117809_c1 nmdc:mga04h51_117809_c1_30_833 257
25 3300036401 Ga0373937_0058544 Ga0373937_0058544_2279_3064 260
26 3300046454 Ga0495592_0000919 Ga0495592_0000919_8589_9374 260
27 3300046463 Ga0495653_0042535 Ga0495653_0042535_782_1567 260
28 3300046511 Ga0495608_0006121 Ga0495608_0006121_7559_8344 260
29 3300046517 Ga0495630_0058977 Ga0495630_0058977_997_1782 260
30 3300046526 Ga0495666_0060045 Ga0495666_0060045_978_1763 260
31 3300046533 Ga0495640_0001911 Ga0495640_0001911_12436_13221 260
32 3300046535 Ga0495586_0000811 Ga0495586_0000811_7485_8270 260
33 3300046536 Ga0495587_0070745 Ga0495587_0070745_1163_1948 260
34 3300046543 Ga0495645_0307892 Ga0495645_0307892_65_850 260
35 3300046642 Ga0495634_0015468 Ga0495634_0015468_3043_3828 260
36 3300046663 Ga0495635_0030586 Ga0495635_0030586_446_1231 260
37 3300046683 Ga0495658_0002831 Ga0495658_0002831_5844_6629 260
38 3300046689 Ga0495613_0049412 Ga0495613_0049412_178_963 260
39 3300046809 Ga0495600_0012292 Ga0495600_0012292_3136_3921 260
40 3300047317 Ga0495604_0013468 Ga0495604_0013468_5254_6039 260
41 3300047322 Ga0495680_0015043 Ga0495680_0015043_2018_2803 260
42 3300053077 Ga0495601_0013515 Ga0495601_0013515_668_1453 260
43 3300053085 Ga0495619_0053412 Ga0495619_0053412_721_1506 260
44 3300005985 Ga0081539_10000521 Ga0081539_1000052120 261
45 3300006042 Ga0075368_10055268 Ga0075368_100552683 261
46 3300006186 Ga0075369_10085837 Ga0075369_100858372 261
47 3300027866 Ga0209813_10102531 Ga0209813_101025311 261
48 3300046461 Ga0495641_0208662 Ga0495641_0208662_64_852 261
49 3300046476 Ga0495662_0022550 Ga0495662_0022550_843_1637 261
50 3300046517 Ga0495630_0031089 Ga0495630_0031089_756_1550 261
51 3300046533 Ga0495640_0047175 Ga0495640_0047175_1629_2423 261
52 iso_pu_bacteria 2831864461 2831869480 261
53 iso_pu_bacteria 2886848708 2886850361 261
54 3300046460 Ga0495638_0178976 Ga0495638_0178976_201_1007 262
55 3300027682 Ga0209971_1031317 Ga0209971_10313171 263
56 3300006871 Ga0075434_100094762 Ga0075434_1000947622 264
57 3300009176 Ga0105242_10069381 Ga0105242_100693813 264
58 3300013296 Ga0157374_10296555 Ga0157374_102965552 264
59 3300013306 Ga0163162_10058266 Ga0163162_100582662 264
60 3300014969 Ga0157376_10018984 Ga0157376_100189843 264
61 3300035086 Ga0373934_0000806 Ga0373934_0000806_7573_8367 264
62 3300035111 Ga0373923_0027129 Ga0373923_0027129_696_1490 264
63 3300035117 Ga0373953_0000802 Ga0373953_0000802_3199_3993 264
64 3300035119 Ga0373956_0000439 Ga0373956_0000439_5667_6461 264
65 3300035120 Ga0373957_0001856 Ga0373957_0001856_1906_2700 264
66 3300035172 Ga0373955_0000707 Ga0373955_0000707_6768_7562 264
67 3300035724 Ga0373933_0001551 Ga0373933_0001551_12021_12815 264
68 3300036401 Ga0373937_0000405 Ga0373937_0000405_11981_12775 264
69 3300046454 Ga0495592_0015162 Ga0495592_0015162_2309_3103 264
70 3300046459 Ga0495629_0042444 Ga0495629_0042444_2350_3144 264
71 3300046462 Ga0495651_0000582 Ga0495651_0000582_25018_25812 264
72 3300046463 Ga0495653_0000157 Ga0495653_0000157_43724_44518 264
73 3300046511 Ga0495608_0000401 Ga0495608_0000401_3180_3974 264
74 3300046516 Ga0495628_0000635 Ga0495628_0000635_3800_4594 264
75 3300046517 Ga0495630_0004279 Ga0495630_0004279_8557_9351 264
76 3300046529 Ga0495652_0000971 Ga0495652_0000971_27554_28348 264
77 3300046531 Ga0495665_0017971 Ga0495665_0017971_234_1028 264
78 3300046536 Ga0495587_0000848 Ga0495587_0000848_8076_8870 264
79 3300046543 Ga0495645_0001016 Ga0495645_0001016_11955_12749 264
80 3300046559 Ga0495667_0000461 Ga0495667_0000461_11928_12722 264
81 3300046663 Ga0495635_0004943 Ga0495635_0004943_7718_8512 264
82 3300046675 Ga0495657_0002107 Ga0495657_0002107_6394_7188 264
83 3300046678 Ga0495599_0000286 Ga0495599_0000286_24353_25147 264
84 3300046679 Ga0495623_0002695 Ga0495623_0002695_10291_11085 264
85 3300046680 Ga0495646_0000137 Ga0495646_0000137_27041_27835 264
86 3300046689 Ga0495613_0016755 Ga0495613_0016755_2681_3475 264
87 3300046809 Ga0495600_0000523 Ga0495600_0000523_3145_3939 264
88 3300047317 Ga0495604_0000464 Ga0495604_0000464_27294_28088 264
89 3300047319 Ga0495674_0006154 Ga0495674_0006154_9230_10024 264
90 3300047322 Ga0495680_0000845 Ga0495680_0000845_25418_26212 264
91 3300047444 Ga0495675_0001938 Ga0495675_0001938_3721_4515 264
92 3300047471 Ga0495684_0000367 Ga0495684_0000367_11747_12541 264
93 3300048088 Ga0495602_0005284 Ga0495602_0005284_9717_10511 264
94 3300050512 nmdc:mga0n895_124197_c1 nmdc:mga0n895_124197_c1_1621_2415 264
95 3300050514 nmdc:mga08x19_267716_c1 nmdc:mga08x19_267716_c1_143_937 264
96 3300053077 Ga0495601_0004013 Ga0495601_0004013_44_838 264
97 3300053078 Ga0495612_0002317 Ga0495612_0002317_566_1360 264
98 3300053085 Ga0495619_0002207 Ga0495619_0002207_11418_12212 264
99 3300003316 rootH1_10014665 rootH1_1001466515 265
100 3300003320 rootH2_10041674 rootH2_100416741 265
101 3300003322 rootL2_10000123 rootL2_1000012338 265
102 3300003323 rootH1_10004509 rootH1_1000450924 265
103 3300003323 rootH1_10006693 rootH1_1000669310 265
104 3300003771 Ga0055526_1003290 Ga0055526_100329010 265
105 3300003775 Ga0055524_1000318 Ga0055524_100031834 265
106 3300003775 Ga0055524_1000652 Ga0055524_100065211 265
107 3300003775 Ga0055524_1016561 Ga0055524_10165611 265
108 3300003794 Ga0055531_10000936 Ga0055531_1000093612 265
109 3300003794 Ga0055531_10001294 Ga0055531_100012947 265
110 3300004625 Ga0055543_1008306 Ga0055543_10083062 265
111 3300005262 Ga0065165_1000024 Ga0065165_100002460 265
112 3300006944 Ga0099823_1000154 Ga0099823_100015420 265
113 3300012497 Ga0157319_1000004 Ga0157319_1000004240 265
114 3300013105 Ga0157369_10040424 Ga0157369_100404243 265
115 3300025242 Ga0209258_106701 Ga0209258_1067012 265
116 3300025273 Ga0209673_1009265 Ga0209673_10092653 265
117 3300025295 Ga0209564_1000005 Ga0209564_1000005438 265
118 3300025298 Ga0209050_1014808 Ga0209050_10148083 265
119 3300025299 Ga0209256_1000085 Ga0209256_1000085169 265
120 3300025299 Ga0209256_1001091 Ga0209256_100109116 265
121 3300025303 Ga0209051_1007063 Ga0209051_10070638 265
122 3300025304 Ga0209257_1000612 Ga0209257_100061214 265
123 3300025304 Ga0209257_1001938 Ga0209257_100193812 265
124 3300025304 Ga0209257_1002827 Ga0209257_100282716 265
125 3300028794 Ga0307515_10000191 Ga0307515_10000191111 265
126 3300041460 Ga0451802_0649996 Ga0451802_0649996_34_831 265
127 3300042127 Ga0450890_008481 Ga0450890_008481_188_985 265
128 3300042438 Ga0439459_0002461 Ga0439459_0002461_1877_2674 265
129 3300046460 Ga0495638_0314842 Ga0495638_0314842_29_826 265
130 3300048927 Ga0496124_0039140 Ga0496124_0039140_1931_2728 265
131 3300053156 Ga0500622_0002983 Ga0500622_0002983_10455_11252 265
132 3300035118 Ga0373954_0002640 Ga0373954_0002640_1770_2579 266
133 3300046477 Ga0495664_0165972 Ga0495664_0165972_110_910 266
134 3300046512 Ga0495610_0107546 Ga0495610_0107546_134_1144 266
135 3300046535 Ga0495586_0235801 Ga0495586_0235801_165_965 266
136 3300005436 Ga0070713_100316577 Ga0070713_1003165772 267
137 3300006871 Ga0075434_100111599 Ga0075434_1001115993 267
138 3300039438 Ga0436360_0746468 Ga0436360_0746468_44_859 267
139 3300045051 Ga0451576_0138836 Ga0451576_0138836_1116_1934 267
140 3300050514 nmdc:mga08x19_27158_c1 nmdc:mga08x19_27158_c1_1467_2270 267
141 3300005333 Ga0070677_10015069 Ga0070677_100150691 268
142 3300005338 Ga0068868_100407705 Ga0068868_1004077052 268
143 3300005354 Ga0070675_100364400 Ga0070675_1003644002 268
144 3300005456 Ga0070678_100017898 Ga0070678_1000178982 268
145 3300005458 Ga0070681_10005421 Ga0070681_100054213 268
146 3300005459 Ga0068867_100398776 Ga0068867_1003987761 268
147 3300005543 Ga0070672_100136337 Ga0070672_1001363372 268
148 3300005547 Ga0070693_100005288 Ga0070693_1000052882 268
149 3300005549 Ga0070704_100197359 Ga0070704_1001973592 268
150 3300005985 Ga0081539_10172157 Ga0081539_101721571 268
151 3300006237 Ga0097621_100069508 Ga0097621_1000695082 268
152 3300006237 Ga0097621_100207136 Ga0097621_1002071362 268
153 3300006358 Ga0068871_100028491 Ga0068871_1000284912 268
154 3300006847 Ga0075431_100159562 Ga0075431_1001595623 268
155 3300006880 Ga0075429_100126684 Ga0075429_1001266841 268
156 3300006881 Ga0068865_100029471 Ga0068865_1000294712 268
157 3300006914 Ga0075436_100111835 Ga0075436_1001118352 268
158 3300009147 Ga0114129_10622899 Ga0114129_106228992 268
159 3300017792 Ga0163161_10067414 Ga0163161_100674142 268
160 3300025912 Ga0207707_10135145 Ga0207707_101351452 268
161 3300025921 Ga0207652_10434530 Ga0207652_104345301 268
162 3300025934 Ga0207686_10178811 Ga0207686_101788112 268
163 3300025940 Ga0207691_10009067 Ga0207691_100090674 268
164 3300026067 Ga0207678_10000937 Ga0207678_1000093722 268
165 3300026089 Ga0207648_10023365 Ga0207648_100233652 268
166 3300026121 Ga0207683_10002468 Ga0207683_100024683 268
167 3300027462 Ga0210000_1020349 Ga0210000_10203491 268
168 3300027543 Ga0209999_1004026 Ga0209999_10040262 268
169 3300031911 Ga0307412_10272567 Ga0307412_102725672 268
170 3300042437 Ga0439444_0000337 Ga0439444_0000337_2082_2888 268
171 3300042461 Ga0439460_0006920 Ga0439460_0006920_69_875 268
172 3300050507 nmdc:mga05p37_409052_c1 nmdc:mga05p37_409052_c1_250_1056 268
173 3300050508 nmdc:mga09592_70457_c1 nmdc:mga09592_70457_c1_1317_2123 268
174 3300050512 nmdc:mga0n895_34374_c1 nmdc:mga0n895_34374_c1_1962_2903 268
175 3300050513 nmdc:mga0rr50_167672_c1 nmdc:mga0rr50_167672_c1_854_1663 268
176 3300050513 nmdc:mga0rr50_236212_c1 nmdc:mga0rr50_236212_c1_412_1353 268
177 3300050514 nmdc:mga08x19_480904_c1 nmdc:mga08x19_480904_c1_24_833 268
178 3300050515 nmdc:mga0a205_126982_c1 nmdc:mga0a205_126982_c1_356_1297 268
179 3300005549 Ga0070704_100436358 Ga0070704_1004363581 269
180 3300005564 Ga0070664_100240504 Ga0070664_1002405042 269
181 3300005617 Ga0068859_100010898 Ga0068859_1000108982 269
182 3300006173 Ga0070716_100003215 Ga0070716_1000032153 269
183 3300006931 Ga0097620_100010897 Ga0097620_1000108979 269
184 3300009094 Ga0111539_10084194 Ga0111539_100841945 269
185 3300025939 Ga0207665_10006782 Ga0207665_100067823 269
186 3300025945 Ga0207679_10107977 Ga0207679_101079772 269
187 3300026075 Ga0207708_10135369 Ga0207708_101353693 269
188 3300046499 Ga0495594_0004022 Ga0495594_0004022_102_914 269
189 3300050511 nmdc:mga08y16_104928_c1 nmdc:mga08y16_104928_c1_297_1106 269
190 3300005440 Ga0070705_100117395 Ga0070705_1001173952 270
191 3300035725 Ga0373947_0055021 Ga0373947_0055021_1431_2246 270
192 3300045051 Ga0451576_0150229 Ga0451576_0150229_831_1646 270
193 3300047471 Ga0495684_0284522 Ga0495684_0284522_278_1093 270
194 3300005336 Ga0070680_100436593 Ga0070680_1004365931 271
195 3300005546 Ga0070696_100290509 Ga0070696_1002905091 271
196 3300005617 Ga0068859_100249610 Ga0068859_1002496102 271
197 3300006237 Ga0097621_100357605 Ga0097621_1003576052 271
198 3300006844 Ga0075428_100037148 Ga0075428_1000371483 271
199 3300006847 Ga0075431_100534861 Ga0075431_1005348611 271
200 3300006871 Ga0075434_100044483 Ga0075434_1000444834 271
201 3300006931 Ga0097620_100249621 Ga0097620_1002496212 271
202 3300009098 Ga0105245_10033630 Ga0105245_100336302 271
203 3300009176 Ga0105242_10001782 Ga0105242_1000178219 271
204 3300025927 Ga0207687_10142574 Ga0207687_101425742 271
205 3300025928 Ga0207700_10725828 Ga0207700_107258281 271
206 3300025934 Ga0207686_10048866 Ga0207686_100488662 271
207 3300035083 Ga0373926_0025830 Ga0373926_0025830_49_867 271
208 3300035170 Ga0373943_0094122 Ga0373943_0094122_58_876 271
209 3300035695 Ga0373927_0094261 Ga0373927_0094261_347_1165 271
210 3300046499 Ga0495594_0038415 Ga0495594_0038415_615_1433 271
211 3300046533 Ga0495640_0315081 Ga0495640_0315081_109_927 271
212 3300046535 Ga0495586_0011981 Ga0495586_0011981_896_1714 271
213 3300046681 Ga0495647_0045476 Ga0495647_0045476_178_996 271
214 3300047319 Ga0495674_0115935 Ga0495674_0115935_35_853 271
215 3300050510 nmdc:mga06r32_140496_c1 nmdc:mga06r32_140496_c1_1238_2053 271
216 3300005293 Ga0065715_10346795 Ga0065715_103467951 272
217 3300005365 Ga0070688_100231305 Ga0070688_1002313051 272
218 3300006028 Ga0070717_10276644 Ga0070717_102766442 272
219 3300013307 Ga0157372_10796843 Ga0157372_107968431 272
220 3300031456 Ga0307513_10182244 Ga0307513_101822441 272
221 3300005436 Ga0070713_100000229 Ga0070713_10000022931 273
222 3300005457 Ga0070662_100105993 Ga0070662_1001059932 273
223 3300005459 Ga0068867_100344675 Ga0068867_1003446752 273
224 3300006028 Ga0070717_10033085 Ga0070717_100330853 273
225 3300049574 Ga0501038_0042709 Ga0501038_0042709_2869_3690 273
226 3300049580 Ga0501046_0008342 Ga0501046_0008342_5424_6245 273
227 3300049582 Ga0501048_0017526 Ga0501048_0017526_3660_4481 273
228 3300049588 Ga0501072_0616155 Ga0501072_0616155_15_836 273
229 3300049590 Ga0501074_0105041 Ga0501074_0105041_753_1574 273
230 3300049743 Ga0501081_0023956 Ga0501081_0023956_2885_3706 273
231 3300049824 Ga0501045_0120109 Ga0501045_0120109_589_1410 273
232 3300054114 Ga0501084_0025020 Ga0501084_0025020_334_1155 273
233 3300059421 Ga0590071_021248 Ga0590071_021248_498_1343 273
234 3300060353 Ga0501082_0009040 Ga0501082_0009040_421_1242 273
235 3300003203 JGI25406J46586_10048340 JGI25406J46586_100483402 274
236 3300005439 Ga0070711_100183833 Ga0070711_1001838331 274
237 3300005983 Ga0081540_1011768 Ga0081540_10117685 274
238 3300006844 Ga0075428_100011455 Ga0075428_1000114555 274
239 3300050510 nmdc:mga06r32_375662_c1 nmdc:mga06r32_375662_c1_305_1141 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

102

297

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.869 28 273
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.8628 28 273
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8555 28 273
6n9i-assembly2.cif.gz_B structure of the quorum quenching lactonase from parageobacillus caldoxylosilyticus - free 0.8507 28 267
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.8496 28 273
ID Description Score Start End Superfamily
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8491 29 266 3.60.15.10
3aj0A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8389 28 274 3.60.15.10
2r2dE00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8357 29 274 3.60.15.10
af_Q11123_1_182_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7926 65 259 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7858 32 263 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A537A8F8-F1-model_v4 MBL fold metallo-hydrolase 0.9911 106 274 GO:0016787
AF-A0A537A8F8-F1-model_v4 MBL fold metallo-hydrolase 0.9853 106 274 GO:0016787
AF-A0A3B0T689-F1-model_v4 MBL-fold metallo-hydrolase superfamily 0.97 169 274 GO:0016787
AF-A0A537BIS2-F1-model_v4 N-acyl homoserine lactonase family protein 0.9627 22 274
AF-A0A537BIS2-F1-model_v4 N-acyl homoserine lactonase family protein 0.959 22 274

Feature Viewer

pLDDT pTM Quality
90.25 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map