F352340

General Info

Members Datasets Scaffolds Average Seq Length
239 161 478 319

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0101603|Ga0501035_0101603_1056_2147
Length 314
Sequence MQLGLIGLGKMGGNMRERLRRSGHEVVGFDRNPAVSDVRSMAAMVKKLEAPRVVWVMVPAGDPTRETVAKLADLLDKGDLVIDGGNSRFTDDFENEKLLKAKGIGYLDCGVSGGIWGLENGYGLMVGGTAANVKRAMPVFDALRPEGPREEGFGHYCKMVHNGIEYGLMAAYAEGYELLEAKDIVTDVPGAFKAWTRGTVVRSWLLDLLVKALEEDAHLEDVSGYTADSGEGRWTVEEAIANSVPMPVISASLFARFASRQDESPTMKAVAALRGQFGGHEVMGVEEGQALRRGEQPKGVKAVRTTARRAERRS

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
64 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
73 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
74 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
109 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
146 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
147 2643221679 Angustibacter sp. Root456 Isolate Unclassified
148 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
149 2643221711 Terrabacter sp. Root85 Isolate Unclassified
150 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
151 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
152 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
153 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
154 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
155 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
156 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
157 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
158 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
159 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
160 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
161 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.79
Metatranscriptomes 2.09
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 17.15
Rhizosphere 70.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0101603 3300049822 Bacteria 2523
2 JGI24739J22299_10020958 3300001989 Bacteria 2332
3 JGI24735J21928_10014539 3300002067 Bacteria 2464
4 JGI25406J46586_10011926 3300003203 Bacteria 3792
5 Ga0006562J51391_1047162 3300003578 Bacteria 3620
6 Ga0006562J51391_1047165 3300003578 Bacteria 2430
7 Ga0070689_100108350 3300005340 Bacteria 2207
8 Ga0070668_100110882 3300005347 Bacteria 2184
9 Ga0070659_100441479 3300005366 Bacteria 1103
10 Ga0070710_10000026 3300005437 Bacteria 74564
11 Ga0070685_10025028 3300005466 Bacteria 3285
12 Ga0070665_100037260 3300005548 Bacteria 4892
13 Ga0068857_100053423 3300005577 Bacteria 3584
14 Ga0068857_100074665 3300005577 Bacteria 3022
15 Ga0068859_100204805 3300005617 Bacteria 2058
16 Ga0068864_100234004 3300005618 Bacteria 1700
17 Ga0068861_100063740 3300005719 Bacteria 2834
18 Ga0068863_100042895 3300005841 Bacteria 4297
19 Ga0068860_100018683 3300005843 Bacteria 6741
20 Ga0081539_10000023 3300005985 Bacteria 356082
21 Ga0081539_10000182 3300005985 Bacteria 148133
22 Ga0081539_10011508 3300005985 Bacteria 6983
23 Ga0097620_100204815 3300006931 Bacteria 2058
24 Ga0111539_10137162 3300009094 Bacteria 2865
25 Ga0105249_10412214 3300009553 Bacteria 1383
26 Ga0105239_10063570 3300010375 Bacteria 4053
27 Ga0105239_10541860 3300010375 Bacteria 1325
28 Ga0105246_10043796 3300011119 Bacteria 3038
29 Ga0157369_10265889 3300013105 Bacteria 1788
30 Ga0163162_10189717 3300013306 Bacteria 2183
31 Ga0157372_10153874 3300013307 Bacteria 2655
32 Ga0157375_10086787 3300013308 Bacteria 3181
33 Ga0157375_10259286 3300013308 Bacteria 1900
34 Ga0157375_10387169 3300013308 Bacteria 1565
35 Ga0157375_10399042 3300013308 Bacteria 1542
36 Ga0157379_10181240 3300014968 Bacteria 1903
37 Ga0163161_10138989 3300017792 Bacteria 1838
38 Ga0197907_10208551 3300020069 Bacteria 1170
39 Ga0206354_10499417 3300020081 Bacteria 1680
40 Ga0206353_11419810 3300020082 Bacteria 2898
41 Ga0207688_10000999 3300025901 Bacteria 14407
42 Ga0207643_10029969 3300025908 Bacteria 3027
43 Ga0207662_10095953 3300025918 Bacteria 1831
44 Ga0207652_10193919 3300025921 Bacteria 1827
45 Ga0207687_10056282 3300025927 Bacteria 2758
46 Ga0207709_10131501 3300025935 Bacteria 1706
47 Ga0207670_10098858 3300025936 Bacteria 2080
48 Ga0207670_10124299 3300025936 Bacteria 1880
49 Ga0207689_10078502 3300025942 Bacteria 2713
50 Ga0207668_10045073 3300025972 Bacteria 3005
51 Ga0207658_10200727 3300025986 Bacteria 1665
52 Ga0207677_10248913 3300026023 Bacteria 1442
53 Ga0207677_10313508 3300026023 Bacteria 1301
54 Ga0207703_10062896 3300026035 Bacteria 3041
55 Ga0207678_10146488 3300026067 Bacteria 2015
56 Ga0207641_10002312 3300026088 Bacteria 17694
57 Ga0207641_10074289 3300026088 Bacteria 2932
58 Ga0207674_10074780 3300026116 Bacteria 3399
59 Ga0207674_10090056 3300026116 Bacteria 3059
60 Ga0207675_100162709 3300026118 Bacteria 2130
61 Ga0207683_10230493 3300026121 Bacteria 1689
62 Ga0207698_10160906 3300026142 Bacteria 1963
63 Ga0268266_10064407 3300028379 Bacteria 3166
64 Ga0268266_10274616 3300028379 Bacteria 1566
65 Ga0268266_10463009 3300028379 Bacteria 1206
66 Ga0268265_10166738 3300028380 Bacteria 1878
67 Ga0268264_10077696 3300028381 Bacteria 2828
68 Ga0316575_10004440 3300031665 Bacteria 4937
69 Ga0316575_10025265 3300031665 Bacteria 2303
70 Ga0316579_10000109 3300031691 Bacteria 21840
71 Ga0316579_10023905 3300031691 Bacteria 2747
72 Ga0316576_10141506 3300031727 Bacteria 1811
73 Ga0316578_10002065 3300031728 Bacteria 8584
74 Ga0316578_10004706 3300031728 Bacteria 6491
75 Ga0316578_10056053 3300031728 Bacteria 2314
76 Ga0307413_10034407 3300031824 Bacteria 2896
77 Ga0307410_10102520 3300031852 Bacteria 2053
78 Ga0307409_100013864 3300031995 Bacteria 5212
79 Ga0307409_100059291 3300031995 Bacteria 2978
80 Ga0307411_10035060 3300032005 Bacteria 3129
81 Ga0307411_10168808 3300032005 Bacteria 1648
82 Ga0307411_10486166 3300032005 Bacteria 1041
83 Ga0307415_100006908 3300032126 Bacteria 6163
84 Ga0307415_100037141 3300032126 Bacteria 3199
85 Ga0316583_10007935 3300032133 Bacteria 3828
86 Ga0316583_10054628 3300032133 Bacteria 1405
87 Ga0316585_10013653 3300032137 Bacteria 2419
88 Ga0316574_0000784 3300035398 Bacteria 13746
89 Ga0316574_0005199 3300035398 Bacteria 6921
90 Ga0316574_0062935 3300035398 Bacteria 2332
91 Ga0373937_0266345 3300036401 Bacteria 1617
92 Ga0316582_0279372 3300036647 Bacteria 1146
93 Ga0316584_0003175 3300036712 Bacteria 10624
94 Ga0316584_0047712 3300036712 Bacteria 3199
95 Ga0395900_0158902 3300037418 Bacteria 2307
96 Ga0395898_0078585 3300037466 Bacteria 3183
97 Ga0395898_0166513 3300037466 Bacteria 2108
98 Ga0395901_0004250 3300038443 Bacteria 14448
99 Ga0395901_0030614 3300038443 Bacteria 5545
100 Ga0395901_0108477 3300038443 Bacteria 2914
101 Ga0395901_0168272 3300038443 Bacteria 2300
102 Ga0395901_0168540 3300038443 Bacteria 2298
103 Ga0395901_0207495 3300038443 Bacteria 2052
104 Ga0395901_0406468 3300038443 Bacteria 1398
105 Ga0439439_0033607 3300041406 Bacteria 1313
106 Ga0451797_0811869 3300041453 Bacteria 1284
107 Ga0451843_0083583 3300041509 Bacteria 3031
108 Ga0466972_0032261 3300044658 Bacteria 2573
109 Ga0466965_0013570 3300044683 Bacteria 3846
110 Ga0466965_0016426 3300044683 Bacteria 3523
111 Ga0466966_0088934 3300044684 Bacteria 1919
112 Ga0466966_0148576 3300044684 Bacteria 1430
113 Ga0466963_0123162 3300044694 Bacteria 1786
114 Ga0466971_0100628 3300044719 Bacteria 1328
115 Ga0466970_0005489 3300044765 Bacteria 6294
116 Ga0466960_0000677 3300044901 Bacteria 11819
117 Ga0466960_0001360 3300044901 Bacteria 8886
118 Ga0466960_0010365 3300044901 Bacteria 3868
119 Ga0466960_0031325 3300044901 Bacteria 2453
120 Ga0466967_0147408 3300045976 Bacteria 2196
121 Ga0466967_0151276 3300045976 Bacteria 2169
122 Ga0466967_0215735 3300045976 Bacteria 1821
123 Ga0495592_0187575 3300046454 Bacteria 1404
124 Ga0495641_0070254 3300046461 Bacteria 1573
125 Ga0495653_0028177 3300046463 Bacteria 4493
126 Ga0495650_0051637 3300046471 Bacteria 1693
127 Ga0495582_0119671 3300046473 Bacteria 1483
128 Ga0495586_0160451 3300046535 Bacteria 1268
129 Ga0495587_0078313 3300046536 Bacteria 1918
130 Ga0495675_0133796 3300047444 Bacteria 1540
131 Ga0496100_0015116 3300048903 Bacteria 4502
132 Ga0496100_0024801 3300048903 Bacteria 3662
133 Ga0496100_0142257 3300048903 Bacteria 1702
134 Ga0496101_0010067 3300048904 Bacteria 6233
135 Ga0496101_0034957 3300048904 Bacteria 3553
136 Ga0496101_0062534 3300048904 Bacteria 2707
137 Ga0496102_0000910 3300048905 Bacteria 27960
138 Ga0496102_0026689 3300048905 Bacteria 5154
139 Ga0496102_0119543 3300048905 Bacteria 2460
140 Ga0496103_0000219 3300048906 Bacteria 56564
141 Ga0496104_0031891 3300048907 Bacteria 4902
142 Ga0496104_0078665 3300048907 Bacteria 3143
143 Ga0496104_0092149 3300048907 Bacteria 2897
144 Ga0496104_0111920 3300048907 Bacteria 2618
145 Ga0496104_0173571 3300048907 Bacteria 2066
146 Ga0496104_0468982 3300048907 Bacteria 1171
147 Ga0496105_0004085 3300048908 Bacteria 10930
148 Ga0496105_0048498 3300048908 Bacteria 3505
149 Ga0496105_0052914 3300048908 Bacteria 3353
150 Ga0496105_0060286 3300048908 Bacteria 3131
151 Ga0496106_0227216 3300048909 Bacteria 1489
152 Ga0496107_0107849 3300048910 Bacteria 2045
153 Ga0496107_0126763 3300048910 Bacteria 1883
154 Ga0496108_0123530 3300048911 Bacteria 2221
155 Ga0496108_0231905 3300048911 Bacteria 1605
156 Ga0496109_0044358 3300048912 Bacteria 4034
157 Ga0496109_0082536 3300048912 Bacteria 2962
158 Ga0496109_0240468 3300048912 Bacteria 1704
159 Ga0496109_0501132 3300048912 Bacteria 1146
160 Ga0496110_0022570 3300048913 Bacteria 5345
161 Ga0496110_0063991 3300048913 Bacteria 3250
162 Ga0496110_0086494 3300048913 Bacteria 2799
163 Ga0496110_0211842 3300048913 Bacteria 1762
164 Ga0496110_0212308 3300048913 Bacteria 1760
165 Ga0496111_0133535 3300048914 Bacteria 1838
166 Ga0496113_0013455 3300048916 Bacteria 5546
167 Ga0496114_0013925 3300048917 Bacteria 6448
168 Ga0496114_0016280 3300048917 Bacteria 5989
169 Ga0496114_0041471 3300048917 Bacteria 3815
170 Ga0496114_0087571 3300048917 Bacteria 2640
171 Ga0496116_0001344 3300048919 Bacteria 27967
172 Ga0496117_0001898 3300048920 Bacteria 28054
173 Ga0496118_0002125 3300048921 Bacteria 27720
174 Ga0496118_0062845 3300048921 Bacteria 2736
175 Ga0496119_0002248 3300048922 Bacteria 21477
176 Ga0496119_0028722 3300048922 Bacteria 3788
177 Ga0496120_0010658 3300048923 Bacteria 6386
178 Ga0496121_0188405 3300048924 Bacteria 1481
179 Ga0496122_0003271 3300048925 Bacteria 21490
180 Ga0496123_0000074 3300048926 Bacteria 196689
181 Ga0496124_0002776 3300048927 Bacteria 22249
182 Ga0496124_0042433 3300048927 Bacteria 3917
183 Ga0496124_0087385 3300048927 Bacteria 2550
184 Ga0496125_0000046 3300048928 Bacteria 295288
185 Ga0496126_0002089 3300048929 Bacteria 27963
186 Ga0496126_0246095 3300048929 Bacteria 1492
187 Ga0501031_0013329 3300049568 Bacteria 5364
188 Ga0501031_0078497 3300049568 Bacteria 2151
189 Ga0501032_0064895 3300049569 Bacteria 2443
190 Ga0501033_0067809 3300049570 Bacteria 2624
191 Ga0501034_0189332 3300049571 Bacteria 2020
192 Ga0501036_0008325 3300049572 Bacteria 8496
193 Ga0501036_0040430 3300049572 Bacteria 3944
194 Ga0501037_0051774 3300049573 Bacteria 3003
195 Ga0501037_0103808 3300049573 Bacteria 2050
196 Ga0501038_0010219 3300049574 Bacteria 8587
197 Ga0501039_0045301 3300049575 Bacteria 3398
198 Ga0501039_0394013 3300049575 Bacteria 1088
199 Ga0501040_0018851 3300049576 Bacteria 4585
200 Ga0501042_0024562 3300049578 Bacteria 4228
201 Ga0501043_0052994 3300049579 Bacteria 3186
202 Ga0501043_0272895 3300049579 Bacteria 1298
203 Ga0501047_0053928 3300049581 Bacteria 3889
204 Ga0501048_0009864 3300049582 Bacteria 7160
205 Ga0501048_0105290 3300049582 Bacteria 1991
206 Ga0501068_0034118 3300049584 Bacteria 3034
207 Ga0501071_0047288 3300049587 Bacteria 3090
208 Ga0501072_0035158 3300049588 Bacteria 3927
209 Ga0501074_0015061 3300049590 Bacteria 5626
210 Ga0501075_0002797 3300049591 Bacteria 11689
211 Ga0501076_0009484 3300049592 Bacteria 7191
212 Ga0501079_0019998 3300049741 Bacteria 5115
213 Ga0501080_0147092 3300049742 Bacteria 2178
214 Ga0501083_0057301 3300049744 Bacteria 2608
215 Ga0501044_0060749 3300049823 Bacteria 3868
216 Ga0501045_0003308 3300049824 Bacteria 11016
217 Ga0495595_0033609 3300053084 Bacteria 2315
218 Ga0500616_0001227 3300053153 Bacteria 25766
219 Ga0501084_0010453 3300054114 Bacteria 7672
220 Ga0501082_0005984 3300060353 Bacteria 10549
221 Ga0501082_0034634 3300060353 Bacteria 4352
222 Ga0530510_0002463 3300061734 Bacteria 12750
223 2523384591 2523231044 Bacteria 6434991
224 2644136615 2643221624 Bacteria 4384879
225 2644447264 2643221679 Bacteria 3839507
226 2644504325 2643221690 Bacteria 4654705
227 2644608443 2643221711 Bacteria 4865335
228 2784470852 2784132109 Bacteria 3141763
229 2812372599 2811994882 Bacteria 4688362
230 2816506314 2816332139 Bacteria 9138787
231 2819428649 2818991318 Bacteria 5266538
232 2819664299 2818991458 Bacteria 4794049
233 2819689905 2818991462 Bacteria 4320267
234 2819726539 2818991469 Bacteria 4644110
235 2837271892 2837268691 Bacteria 7850704
236 2868089903 2868088558 Bacteria 7609351
237 2915363561 2915358134 Bacteria 6050864
238 2919448616 2919446982 Bacteria 3994487
239 8054474878 8054472261 Bacteria 7464355
240 Ga0501035_0101603
241 JGI24739J22299_10020958
242 JGI24735J21928_10014539
243 JGI25406J46586_10011926
244 Ga0006562J51391_1047162
245 Ga0006562J51391_1047165
246 Ga0070689_100108350
247 Ga0070668_100110882
248 Ga0070659_100441479
249 Ga0070710_10000026
250 Ga0070685_10025028
251 Ga0070665_100037260
252 Ga0068857_100053423
253 Ga0068857_100074665
254 Ga0068859_100204805
255 Ga0068864_100234004
256 Ga0068861_100063740
257 Ga0068863_100042895
258 Ga0068860_100018683
259 Ga0081539_10000023
260 Ga0081539_10000182
261 Ga0081539_10011508
262 Ga0097620_100204815
263 Ga0111539_10137162
264 Ga0105249_10412214
265 Ga0105239_10063570
266 Ga0105239_10541860
267 Ga0105246_10043796
268 Ga0157369_10265889
269 Ga0163162_10189717
270 Ga0157372_10153874
271 Ga0157375_10086787
272 Ga0157375_10259286
273 Ga0157375_10387169
274 Ga0157375_10399042
275 Ga0157379_10181240
276 Ga0163161_10138989
277 Ga0197907_10208551
278 Ga0206354_10499417
279 Ga0206353_11419810
280 Ga0207688_10000999
281 Ga0207643_10029969
282 Ga0207662_10095953
283 Ga0207652_10193919
284 Ga0207687_10056282
285 Ga0207709_10131501
286 Ga0207670_10098858
287 Ga0207670_10124299
288 Ga0207689_10078502
289 Ga0207668_10045073
290 Ga0207658_10200727
291 Ga0207677_10248913
292 Ga0207677_10313508
293 Ga0207703_10062896
294 Ga0207678_10146488
295 Ga0207641_10002312
296 Ga0207641_10074289
297 Ga0207674_10074780
298 Ga0207674_10090056
299 Ga0207675_100162709
300 Ga0207683_10230493
301 Ga0207698_10160906
302 Ga0268266_10064407
303 Ga0268266_10274616
304 Ga0268266_10463009
305 Ga0268265_10166738
306 Ga0268264_10077696
307 Ga0316575_10004440
308 Ga0316575_10025265
309 Ga0316579_10000109
310 Ga0316579_10023905
311 Ga0316576_10141506
312 Ga0316578_10002065
313 Ga0316578_10004706
314 Ga0316578_10056053
315 Ga0307413_10034407
316 Ga0307410_10102520
317 Ga0307409_100013864
318 Ga0307409_100059291
319 Ga0307411_10035060
320 Ga0307411_10168808
321 Ga0307411_10486166
322 Ga0307415_100006908
323 Ga0307415_100037141
324 Ga0316583_10007935
325 Ga0316583_10054628
326 Ga0316585_10013653
327 Ga0316574_0000784
328 Ga0316574_0005199
329 Ga0316574_0062935
330 Ga0373937_0266345
331 Ga0316582_0279372
332 Ga0316584_0003175
333 Ga0316584_0047712
334 Ga0395900_0158902
335 Ga0395898_0078585
336 Ga0395898_0166513
337 Ga0395901_0004250
338 Ga0395901_0030614
339 Ga0395901_0108477
340 Ga0395901_0168272
341 Ga0395901_0168540
342 Ga0395901_0207495
343 Ga0395901_0406468
344 Ga0439439_0033607
345 Ga0451797_0811869
346 Ga0451843_0083583
347 Ga0466972_0032261
348 Ga0466965_0013570
349 Ga0466965_0016426
350 Ga0466966_0088934
351 Ga0466966_0148576
352 Ga0466963_0123162
353 Ga0466971_0100628
354 Ga0466970_0005489
355 Ga0466960_0000677
356 Ga0466960_0001360
357 Ga0466960_0010365
358 Ga0466960_0031325
359 Ga0466967_0147408
360 Ga0466967_0151276
361 Ga0466967_0215735
362 Ga0495592_0187575
363 Ga0495641_0070254
364 Ga0495653_0028177
365 Ga0495650_0051637
366 Ga0495582_0119671
367 Ga0495586_0160451
368 Ga0495587_0078313
369 Ga0495675_0133796
370 Ga0496100_0015116
371 Ga0496100_0024801
372 Ga0496100_0142257
373 Ga0496101_0010067
374 Ga0496101_0034957
375 Ga0496101_0062534
376 Ga0496102_0000910
377 Ga0496102_0026689
378 Ga0496102_0119543
379 Ga0496103_0000219
380 Ga0496104_0031891
381 Ga0496104_0078665
382 Ga0496104_0092149
383 Ga0496104_0111920
384 Ga0496104_0173571
385 Ga0496104_0468982
386 Ga0496105_0004085
387 Ga0496105_0048498
388 Ga0496105_0052914
389 Ga0496105_0060286
390 Ga0496106_0227216
391 Ga0496107_0107849
392 Ga0496107_0126763
393 Ga0496108_0123530
394 Ga0496108_0231905
395 Ga0496109_0044358
396 Ga0496109_0082536
397 Ga0496109_0240468
398 Ga0496109_0501132
399 Ga0496110_0022570
400 Ga0496110_0063991
401 Ga0496110_0086494
402 Ga0496110_0211842
403 Ga0496110_0212308
404 Ga0496111_0133535
405 Ga0496113_0013455
406 Ga0496114_0013925
407 Ga0496114_0016280
408 Ga0496114_0041471
409 Ga0496114_0087571
410 Ga0496116_0001344
411 Ga0496117_0001898
412 Ga0496118_0002125
413 Ga0496118_0062845
414 Ga0496119_0002248
415 Ga0496119_0028722
416 Ga0496120_0010658
417 Ga0496121_0188405
418 Ga0496122_0003271
419 Ga0496123_0000074
420 Ga0496124_0002776
421 Ga0496124_0042433
422 Ga0496124_0087385
423 Ga0496125_0000046
424 Ga0496126_0002089
425 Ga0496126_0246095
426 Ga0501031_0013329
427 Ga0501031_0078497
428 Ga0501032_0064895
429 Ga0501033_0067809
430 Ga0501034_0189332
431 Ga0501036_0008325
432 Ga0501036_0040430
433 Ga0501037_0051774
434 Ga0501037_0103808
435 Ga0501038_0010219
436 Ga0501039_0045301
437 Ga0501039_0394013
438 Ga0501040_0018851
439 Ga0501042_0024562
440 Ga0501043_0052994
441 Ga0501043_0272895
442 Ga0501047_0053928
443 Ga0501048_0009864
444 Ga0501048_0105290
445 Ga0501068_0034118
446 Ga0501071_0047288
447 Ga0501072_0035158
448 Ga0501074_0015061
449 Ga0501075_0002797
450 Ga0501076_0009484
451 Ga0501079_0019998
452 Ga0501080_0147092
453 Ga0501083_0057301
454 Ga0501044_0060749
455 Ga0501045_0003308
456 Ga0495595_0033609
457 Ga0500616_0001227
458 Ga0501084_0010453
459 Ga0501082_0005984
460 Ga0501082_0034634
461 Ga0530510_0002463
462 2523384591
463 2644136615
464 2644447264
465 2644504325
466 2644608443
467 2784470852
468 2812372599
469 2816506314
470 2819428649
471 2819664299
472 2819689905
473 2819726539
474 2837271892
475 2868089903
476 2915363561
477 2919448616
478 8054474878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

146

0.9

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

154

294

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 0.9573 1 31
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.9433 2 29
1reo-assembly1.cif.gz_A l-amino acid oxidase from agkistrodon halys pallas 0.9427 2 30
6nev-assembly3.cif.gz_B fad-dependent monooxygenase tropb from t. stipitatus y239f variant 0.942 1 31
3zyx-assembly1.cif.gz_B crystal structure of human monoamine oxidase b in complex with methylene blue and bearing the double mutation i199a-y326a 0.9408 2 30
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9402 3 30 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9376 2 30 3.50.50.60
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9354 2 31 3.50.50.60
2y6qB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9329 2 32 3.50.50.60
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9291 2 163 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7K2P8W7-F1-model_v4 6-phosphogluconate dehydrogenase 0.9987 1 113 GO:0004616
GO:0050661
AF-A0A2S9GEU4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9949 83 166 GO:0004616
GO:0050661
AF-A0A4Q5YXB7-F1-model_v4 deleted 0.9932 1 125
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.9916 38 148 GO:0004616
GO:0050661
AF-A0A7K0RNE6-F1-model_v4 deleted 0.9905 1 97

Map